Citrus Sinensis ID: 017238

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-----

MLFLKSMPVIASPTHYIFQIVRAGITFLACTQVEMPPLMGIEFLCRVADILSDYLGELNEDLIKDNFVIVYELLDEMIDNGFPLTTEPNILREMIAPPNIVSKMLSVVTGNSSNVSDILPGATASCVPWRPTDVKYANNEVYVDLVEEMDAIINRDGVLVKCEIYGEVQVNCLLSGLPDLTLSFANPSILHDVRFHPCVRFRPWESHQILSFVPPDGQFKLMSYRVKKLKSTPIYVKPQLTSDAGTCRISVMVGIRNDPGKTIDSIILQFQLPPCILSADLTSNHGTVNVLSNKICTWSIGRIPKDKAPSLSGTMVLETGLETLRVFPTFQVEFRIMGVALSGLQIDKLDLQNVPNRLYKGFRAVTRAGEYEVRS

ccccccccEEECccEEEEEEEEccEEEEEEEcccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccccccccccHHHHccccccccccccEEECccccccccccccccccccccccccccccccEEEEEEEEEEEEEEcccccEEEEEEEEEEEEEEEcccccccccccccccccccCEEccccccccccccCEEEECcccccEEEEEEEEcccccccEEEEEEEEEcccCEEEEEEEEECccccccccEEEEEEEccccccCEEEEEccEEEEEECccEEEEEEcccccccccEEEEEEEEcccccccccccccEEEEEEcEEEcccEEEEEEEEECccccccccEEEEECcccEEEcc

**FLKSMPVIASPTHYIFQIVRAGITFLACTQVEMPPLMGIEFLCRVADILSDYLGELNEDLIKDNFVIVYELLDEMIDNGFPLTTEPNILREMIAPPNIVSKMLSV********************PWRPTDVKYANNEVYVDLVEEMDAIINRDGVLVKCEIYGEVQVNCLLSGLPDLTLSFANPSILHDVRFHPCVRFRPWESHQILSFVPPDGQFKLMSYRVKKLKSTPIYVKPQLTSDAGTCRISVMVGIRNDPGKTIDSIILQFQLPPCILSADLTSNHGTVNVLSNKICTWSIGRIPKDKAPSLSGTMVLETGLETLRVFPTFQVEFRIMGVALSGLQIDKLDLQNVPNRLYKGFRAVTRAGEYEVRS

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
AP-3 complex subunit mu-1	Part of the AP-3 complex, an adaptor-related complex which is not clathrin-associated. The complex is associated with the Golgi region as well as more peripheral structures. It facilitates the budding of vesicles from the Golgi membrane and may be directly involved in trafficking to lysosomes.	probable	P53676
AP-3 complex subunit mu-1	Part of the AP-3 complex, an adaptor-related complex which is not clathrin-associated. The complex is associated with the Golgi region as well as more peripheral structures. It facilitates the budding of vesicles from the Golgi membrane and may be directly involved in trafficking to lysosomes.	probable	Q24K11
AP-1 complex subunit mu-1	Component of the adaptor complexes which link clathrin to receptors in coated vesicles. Clathrin-associated protein complexes are believed to interact with the cytoplasmic tails of membrane proteins, leading to their selection and concentration.	probable	Q9HFE5

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1W63, chain M
Confidence level:very confident
Coverage over the Query: 4-115,127-375
View the alignment between query and template
View the model in PyMOL