Citrus Sinensis ID: 017240

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-----

MEYYCLGARNFAAMAVSPFPTGRTRRKALRVRTKQSAVDCNHSSYKVTARATSNNAGSESCVAVKEEDYIKAGGSQLVFVQMQQNKSMDKQSKLADKLPPISIGNGILDLVVIGCGPAGLALAAESAKLGLNVGLIGPDLPFTNNYGVWEDEFRDLGLEGCIEHVWRDTVVYIDEDEPILIGRAYGRVSRHLLHEELLRRCVESGVSYLSSKVESITESTSGHRLVACEHDMIVPCRLATVASGAASGKLLEYEEWSYIPVGGSLPNTEQRNLAFGAAASMVHPATGYSVVRSLSEAPNYASAIAYILKHDHSRGRLTHEQSNENISMQAWNTLWPQERKRQRAFFLFGLALILQLDIEGIRTFFRTFFRLPKWY

ccEEEcccccccHHcccccccccccHHHHHccccccccccccccccccccccccccccccEEEcccccHHHcccccccHHHccccccccccccccccccccccccccEEEEEEcccHHHHHHHHHHHHcccEEEEEcccccccccccccHHHHHcccccccccccccccEEEEcccccCECcccEEEEcHHHHHHHHHHHHHHcccEEEcccEEEEEEccccCEEEECccccEEEEEEEEEcccccccccEEEcccccccccccccccccccccccccccccccccEEEEEEEccccccHHHHHHHHHHccccccccccccccHHHHHcccccccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHccccccc

**YYCLGARNFAAMAVSPFPTGR*************************************CVAVKEEDYIKAGGSQLVFV******************PPISIGNGILDLVVIGCGPAGLALAAESAKLGLNVGLIGPDLPFTNNYGVWEDEFRDLGLEGCIEHVWRDTVVYIDEDEPILIGRAYGRVSRHLLHEELLRRCVESGVSYLSSKVESITESTSGHRLVACEHDMIVPCRLATVASGAASGKLLEYEEWSYIPVGGSLPNTEQRNLAFGAAASMVHPATGYSVVRSLSEAPNYASAIAYILKHDHS************ISMQAWNTLWPQERKRQRAFFLFGLALILQLDIEGIRTFFRTFFRLPKWY

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Lycopene epsilon cyclase, chloroplastic	Catalyzes the single epsilon-cyclization reaction which converts lycopene to delta-carotene and neurosporene to alpha-zeacarotene. Required for lutein biosynthesis.	probable	Q38932

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3ATR, chain A
Confidence level:confident
Coverage over the Query: 107-366
View the alignment between query and template
View the model in PyMOL

Template: 1GTE, chain A
Confidence level:confident
Coverage over the Query: 45-160,185-246
View the alignment between query and template
View the model in PyMOL