Citrus Sinensis ID: 017264


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370----
MATDLEKKAKEAFIDDYFELAYDLYSQAIEISPNSAELFADRAQASIKLQNFTEAVADANRAIELEPSMSKAYWRKATACMKLEEYETAKVALEKGASLAPGDSRFTNLIKECEERIAEETGELQKQPLETGPTNVVSTNNVQPATNISSTEDVETVMDVSNEAAMAAPARPKYRHEFYQKPEEVVVTVFAKGIPAKNVTVDFGEQILSVSIDVPGEEAYHFQPRLFGKIIPAKCRYEVLSTKVEIRLAKAEPIQWSSLEFSKGAVVPQRVNPPSVSGSPRPTYPSSKPTRVDWDKLEAQVKKEEKEEKLDGDAALNKFFQEIYADADEDTRRAMKKSFVESNGTVLSTNWKEVGSKKVEGSPPDGMEMKKWEY
cHHHHHHHHHHHHHHccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccHHHHHHccHHHccccccccccHHHHcccccEEEEEEEEcccccccEEEEEEccEEEEEEEccccccCEEEcccccccccccccEEEEccEEEEEEccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHccccHHHHHHHHHHHHccccEEEccccccccccCEccccccccccccccc
MATDLEKKAKEAFIDDYFELAYDLYSQAIEISPNSAELFADRAQASIKLQNFTEAVADANRAIELEPSMSKAYWRKATACMKLEEYETAKVALEKGASLAPGDSRFTNLIKECEERIAEETGEL*****************VQPATNISSTEDVETVMDVSNEAAMAAPARPKYRHEFYQKPEEVVVTVFAKGIPAKNVTVDFGEQILSVSIDVPGEEAYHFQPRLFGKIIPAKCRYEVLSTKVEIRLAKAEPIQWS*L********************************************************LNKFFQEIYADADEDTRRAMKKSFVESNGTVLSTNWKEVGS**VEGSPPDGMEMKKWE*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATDLEKKAKEAFIDDYFELAYDLYSQAIEISPNSAELFADRAQASIKLQNFTEAVADANRAIELEPSMSKAYWRKATACMKLEEYETAKVALEKGASLAPGDSRFTNLIKECEERIAEETGELQKQPLETGPTNVVSTNNVQPATNISSTEDVETVMDVSNEAAMAAPARPKYRHEFYQKPEEVVVTVFAKGIPAKNVTVDFGEQILSVSIDVPGEEAYHFQPRLFGKIIPAKCRYEVLSTKVEIRLAKAEPIQWSSLEFSKGAVVPQRVNPPSVSGSPRPTYPSSKPTRVDWDKLEAQVKKEEKEEKLDGDAALNKFFQEIYADADEDTRRAMKKSFVESNGTVLSTNWKEVGSKKVEGSPPDGMEMKKWEY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein SGT1 homolog Involved in basal disease resistance to bacterial blight (X.oryzae). May act as positive regulator of basal defense. Probably required for SCF-mediated ubiquitination, by coupling HSP90 to SCF complex for ubiquitination of HSP90 client proteins.probableQ0JL44
Protein SGT1 homolog B Involved in plant innate immunity. Is essential for resistance conferred by multiple R genes recognizing different oomycete pathogen isolates like avirulent H.parasitica (downy mildew). Contributes additively with RAR1 to RPP5-dependent resistance. Not required for RPM1, RPS2, RPS4 and RPS5-mediated resistance. Functions as negative regulator of RPS5 accumulation by assisting its degradation. May be involved in heat shock response by associating with HSC70-1 chaperone. Required for the SCF(TIR1)-mediated degradation of Aux/IAA proteins, but maybe not for SCF(TIR1) assembly or binding to its Aux/IAA substrates. Probably required for SCF-mediated ubiquitination, by coupling HSP90 to SCF complex for ubiquitination of HSP90 client proteins. Required for the coronatine/jasmonic acid-mediated signal transduction pathway.probableQ9SUT5
Suppressor of G2 allele of SKP1 homolog May play a role in ubiquitination and subsequent proteasomal degradation of target proteins.probableQ9CX34

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1W3B, chain A
Confidence level:very confident
Coverage over the Query: 3-117
View the alignment between query and template
View the model in PyMOL
Template: 2KMW, chain A
Confidence level:very confident
Coverage over the Query: 175-264,280-304
View the alignment between query and template
View the model in PyMOL
Template: 2JTT, chain C
Confidence level:confident
Coverage over the Query: 313-343
View the alignment between query and template
View the model in PyMOL
Template: 3UGM, chain A
Confidence level:probable
Coverage over the Query: 18-101
View the alignment between query and template
View the model in PyMOL