Citrus Sinensis ID: 017272

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370----
MSSSSCLLLSSSVPRIKKEAFANIRTKRDASTSASVSISCKLKPAPPCPLTLFFNSNPAKQKIVLVRSRTETGSGTDSDTDLATLAGEDSAAFDLKNQKLTSWVYFSVILGVVLFLLQLLWIDNSTGYGKAFIDSVSSLSDSHEVVMLVLILIFATVHSGLASLRDMGEKVIGARAYRVLFAGVSLPLAVSTIVYFINHRYDGMQLWQLQGAPGVHQIVWLSSFVSFFFLYPSTFNLLEVAAVDEPKMHLWETGVMRITRHPQMVGQVIWCLAHTLWIGNSVAAAASLGLIGHHLFGVWNGDKRLATRYGEAFEAVKRRTSVIPFAAIITGRQILPKDYYKEFIRLPYLTITALTLGAYIAHPLMQSASFLLHW
ccccccccccccccccccHHHHHHcccccccccccEEEEEEcccccccccccccccccHHHHHHHHccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHEEccccccccccccccccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHccccccccHHcccccccccccccccccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHcHHHHHHHHccccccHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccc
******L**SSSVPR************************CKLKPAPPCPLTLFFNSNPAKQKIVLV********************GEDSAAFDLKNQKLTSWVYFSVILGVVLFLLQLLWIDNSTGYGKAFIDSVSSLSDSHEVVMLVLILIFATVHSGLASLRDMGEKVIGARAYRVLFAGVSLPLAVSTIVYFINHRYDGMQLWQLQGAPGVHQIVWLSSFVSFFFLYPSTFNLLEVAAVDEPKMHLWETGVMRITRHPQMVGQVIWCLAHTLWIGNSVAAAASLGLIGHHLFGVWNGDKRLATRYGEAFEAVKRRTSVIPFAAIITGRQILPKDYYKEFIRLPYLTITALTLGAYIAHPLMQSASFLLHW
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHxxxxHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSSSCLLLSSSVPRIKKEAFANIRTKRDASTSASVSISCKLKPAPPCPLTLFFNSNPAKQKIVLVRSRTETGSGTDSDTDLATLAGEDSAAFDLKNQKLTSWVYFSVILGVVLFLLQLLWIDNSTGYGKAFIDSVSSLSDSHEVVMLVLILIFATVHSGLASLRDMGEKVIGARAYRVLFAGVSLPLAVSTIVYFINHRYDGMQLWQLQGAPGVHQIVWLSSFVSFFFLYPSTFNLLEVAAVDEPKMHLWETGVMRITRHPQMVGQVIWCLAHTLWIGNSVAAAASLGLIGHHLFGVWNGDKRLATRYGEAFEAVKRRTSVIPFAAIITGRQILPKDYYKEFIRLPYLTITALTLGAYIAHPLMQSASFLLHW

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
15-cis-zeta-carotene isomerase, chloroplastic Isomerase involved in the biosynthesis of carotenoids. Catalyzes the cis- to trans-conversion of the 15-cis-bond in 9,15,9'-tri-cis-zeta-carotene.confidentQ9SAC0
15-cis-zeta-carotene isomerase, chloroplastic Isomerase involved in the biosynthesis of carotenoids. Catalyzes the cis- to trans-conversion of the 15-cis-bond in 9,15,9'-tri-cis-zeta-carotene.probableB4FHU1

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4A2N, chain B
Confidence level:confident
Coverage over the Query: 246-325
View the alignment between query and template
View the model in PyMOL