Citrus Sinensis ID: 017332


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370---
MDISDAASTTTTKTVTEYDRAKEVQAFDDTKAGVKGLVDAGVVNIPRIFIRPPAELAEELTTHQSKLQVPVIDLDGIRYNQLEDIVDQVRAASQTWGFFQVINHGVPLNLIQEMIEGVHKFNEQDVEVKKQFYTRERTRNVRFNSNFDLYHSRTASWRDTLAISTSGTKSLEPNEWPKVCRDTIMEYIKEVSKLGETLFEILSMALGLKPEYLKDMGCFNLYSVICHYYPHCPQPELTLGARTHSDPSFLTILLQDQIGGLQVFNENQWIDVNPISGGLVVNIGDFLQVVSNDELKSVDHRVVANVHATARVSVACFFTGHTTETQKPFGPIKELISKENPPVYREFLVGEYFSKYFSKELESKSAGLKQFEV
cccccccccccccccccccHHHHHHHHccccccHHHHHHcccccccccccccccccccccccccccccccEEEccccccccHHHHHHHHHHHHHHccEEEEEcccccHHHHHHHHHHHHHHHcccHHHHHHHccccccccEEEECccccccccccccccEEEcECccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHcccccEEEEEEcccccccccccccccccccccccEEEEccccccEEEEEccEEEEcccccccEEEEcccEEEEECcccccccccEEEEcccccccEEEEEcccccccccccECcccccccccccccccccccHHHHHHHHHHccccccccccccccc
***********************VQAFDDTKAGVKGLVDAGVVNIPRIFIRPPAELA*****HQSKLQVPVIDLDGIRYNQLEDIVDQVRAASQTWGFFQVINHGVPLNLIQEMIEGVHKFNEQDVEVKKQFYTRERTRNVRFNSNFDLYHSRTASWRDTLAISTSGTKSLEPNEWPKVCRDTIMEYIKEVSKLGETLFEILSMALGLKPEYLKDMGCFNLYSVICHYYPHCPQPELTLGARTHSDPSFLTILLQDQIGGLQVFNENQWIDVNPISGGLVVNIGDFLQVVSNDELKSVDHRVVANVHATARVSVACFFTGHTTETQKPFGPIKELISKENPPVYREFLVGEYFSKYFSKELESKSAGLK****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDISDAASTTTTKTVTEYDRAKEVQAFDDTKAGVKGLVDAGVVNIPRIFIRPPAELAEELTTHQSKLQVPVIDLDGIRYNQLEDIVDQVRAASQTWGFFQVINHGVPLNLIQEMIEGVHKFNEQDVEVKKQFYTRERTRNVRFNSNFDLYHSRTASWRDTLAISTSGTKSLEPNEWPKVCRDTIMEYIKEVSKLGETLFEILSMALGLKPEYLKDMGCFNLYSVICHYYPHCPQPELTLGARTHSDPSFLTILLQDQIGGLQVFNENQWIDVNPISGGLVVNIGDFLQVVSNDELKSVDHRVVANVHATARVSVACFFTGHTTETQKPFGPIKELISKENPPVYREFLVGEYFSKYFSKELESKSAGLKQFEV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
1-aminocyclopropane-1-carboxylate oxidase homolog 1 probableQ84MB3

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.14.-.-Acting on paired donors, with incorporation or reduction of molecular oxygen.probable
1.14.11.-With 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1W9Y, chain A
Confidence level:very confident
Coverage over the Query: 67-366
View the alignment between query and template
View the model in PyMOL
Template: 1GP6, chain A
Confidence level:very confident
Coverage over the Query: 31-365
View the alignment between query and template
View the model in PyMOL