Citrus Sinensis ID: 017338


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370---
MASSLFTRRLVHSSFSISYKPQVFTSLLNKKLFYSRPKHTHTTLKTSSSQSPCVMSSLAAGRRADYSTLSVSPKEPVVSVDWLHANLREPDLKVLDASWYMPDEQRNPFQEYQVAHIPGALFFDVDGVADRTTNLPHMLPSEEAFAAAVSALGLENKDGLVVYDGKGIFSAARVWWMFRVFGHDRVWVLDGGLPRWRASGYDVESSASGDAILKASAASEAIEKVYQGQVVGPTTFQTKFQPHLIWTLEQVKRNIEEGTYQLVDARSKARFDGDAPEPRKGIRSGHVPGSKCIPFPQMLDASQTLLPADELKKRFEQEGISLEKPVVTACGTGVTACILALGLNRLGKHDVAVYDGSWTEWGAQPDTPVETSS
cccccccccccccccccccccccccccccccCCcccccccccccccccccccccHHHccccccccccccccccccccccHHHHHHHccccccEEEEEEECcccccccHHHHHHHccccccEECccccccccccccccccccHHHHHHHHHHcccccccEEEEEcccccccHHHHHHHHHHHccccEEEccccHHHHHHccccccccccccHHHHHHHHHHHHHHHHcccccccccEEEEccccccccHHHHHHHHHccccEEEcccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccccccEEEEcccHHHHHHHHHHHHHcccccccccccccccccccccccccccc
********RLVHSSFSISYKPQVFTSLLNKKLFYS****************************************PVVSVDWLHANLREPDLKVLDASWYMPDEQRNPFQEYQVAHIPGALFFDVDGVADRTTNLPHMLPSEEAFAAAVSALGLENKDGLVVYDGKGIFSAARVWWMFRVFGHDRVWVLDGGLPRWRASGYDVESSASGDAILKASAASEAIEKVYQGQVVGPTTFQTKFQPHLIWTLEQVKRNIEEGTYQLVDARSKARFDGDAPEPRKGIRSGHVPGSKCIPFPQMLDASQTLLPADELKKRFEQEGISLEKPVVTACGTGVTACILALGLNRLGKHDVAVYDGSWTEWGAQPDTPV****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASSLFTRRLVHSSFSISYKPQVFTSLLNKKLFYSRPKHTHTTLKTSSSQSPCVMSSLAAGRRADYSTLSVSPKEPVVSVDWLHANLREPDLKVLDASWYMPDEQRNPFQEYQVAHIPGALFFDVDGVADRTTNLPHMLPSEEAFAAAVSALGLENKDGLVVYDGKGIFSAARVWWMFRVFGHDRVWVLDGGLPRWRASGYDVESSASGDAILKASAASEAIEKVYQGQVVGPTTFQTKFQPHLIWTLEQVKRNIEEGTYQLVDARSKARFDGDAPEPRKGIRSGHVPGSKCIPFPQMLDASQTLLPADELKKRFEQEGISLEKPVVTACGTGVTACILALGLNRLGKHDVAVYDGSWTEWGAQPDTPVETSS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Thiosulfate/3-mercaptopyruvate sulfurtransferase 1, mitochondrial Catalyzes the transfer of a sulfur ion from a donor to cyanide or to other thiol compounds. Substrate preference is 3-mercaptopyruvate > thiosulfate. Involved in embryo and seed development.confidentO64530
Thiosulfate/3-mercaptopyruvate sulfurtransferase 2 Catalyzes the transfer of a sulfur ion from a donor to cyanide or to other thiol compounds. Substrate preference is 3-mercaptopyruvate > thiosulfate. Involved in embryo and seed development.probableQ24JL3

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1YT8, chain A
Confidence level:very confident
Coverage over the Query: 75-127,145-218,234-271,283-300,314-372
View the alignment between query and template
View the model in PyMOL
Template: 1RHS, chain A
Confidence level:very confident
Coverage over the Query: 74-208,230-372
View the alignment between query and template
View the model in PyMOL
Template: 3TP9, chain A
Confidence level:very confident
Coverage over the Query: 21-127,144-207,245-271,283-301,315-371
View the alignment between query and template
View the model in PyMOL