Citrus Sinensis ID: 017338
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 373 | ||||||
| 225465012 | 380 | PREDICTED: 3-mercaptopyruvate sulfurtran | 0.997 | 0.978 | 0.790 | 1e-176 | |
| 255544614 | 376 | thiosulfate sulfertansferase, putative [ | 0.994 | 0.986 | 0.798 | 1e-175 | |
| 118484746 | 372 | unknown [Populus trichocarpa] | 0.981 | 0.983 | 0.801 | 1e-174 | |
| 388492146 | 384 | unknown [Lotus japonicus] | 0.997 | 0.968 | 0.782 | 1e-174 | |
| 224096608 | 372 | predicted protein [Populus trichocarpa] | 0.981 | 0.983 | 0.798 | 1e-173 | |
| 4406372 | 375 | thiosulfate sulfurtransferase [Datisca g | 0.991 | 0.986 | 0.784 | 1e-172 | |
| 356525750 | 379 | PREDICTED: 3-mercaptopyruvate sulfurtran | 0.991 | 0.976 | 0.766 | 1e-169 | |
| 358347396 | 381 | Mercaptopyruvate sulfurtransferase-like | 0.994 | 0.973 | 0.772 | 1e-168 | |
| 449497667 | 377 | PREDICTED: thiosulfate/3-mercaptopyruvat | 0.997 | 0.986 | 0.743 | 1e-164 | |
| 449464498 | 377 | PREDICTED: thiosulfate/3-mercaptopyruvat | 0.997 | 0.986 | 0.740 | 1e-164 |
| >gi|225465012|ref|XP_002264748.1| PREDICTED: 3-mercaptopyruvate sulfurtransferase [Vitis vinifera] gi|147820684|emb|CAN69823.1| hypothetical protein VITISV_030676 [Vitis vinifera] gi|297736153|emb|CBI24191.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 624 bits (1608), Expect = e-176, Method: Compositional matrix adjust.
Identities = 295/373 (79%), Positives = 327/373 (87%), Gaps = 1/373 (0%)
Query: 1 MASSLFTRRLVHSSFSISYKPQVFTSLLNKKLFYSRPKHTHTTLKTSSSQSPCVMSSLAA 60
A +LF RL+ SS ++ KPQ+FTS NK+ FYSRP + + SS S C M+S +
Sbjct: 6 FARTLFGNRLIRSSLALYQKPQIFTSFFNKRPFYSRPNAVYLVYR-SSGFSTCAMASSTS 64
Query: 61 GRRADYSTLSVSPKEPVVSVDWLHANLREPDLKVLDASWYMPDEQRNPFQEYQVAHIPGA 120
G R+ +ST SVSP EPVVSVDWLHAN+REPDLKVLDASWYMPDEQRNP QEYQVAHIPGA
Sbjct: 65 GTRSSFSTQSVSPNEPVVSVDWLHANIREPDLKVLDASWYMPDEQRNPLQEYQVAHIPGA 124
Query: 121 LFFDVDGVADRTTNLPHMLPSEEAFAAAVSALGLENKDGLVVYDGKGIFSAARVWWMFRV 180
LFFDVDG++D+TTNLPHMLPSEEAFAAAVSALG+ENKDG+VVYDGKGIFSAARVWWMFRV
Sbjct: 125 LFFDVDGISDQTTNLPHMLPSEEAFAAAVSALGIENKDGVVVYDGKGIFSAARVWWMFRV 184
Query: 181 FGHDRVWVLDGGLPRWRASGYDVESSASGDAILKASAASEAIEKVYQGQVVGPTTFQTKF 240
FGH+R+WVLDGGLP WRASG+DVESSASGDAILKASAASEAIEKVY+ Q VGP TFQT+F
Sbjct: 185 FGHERIWVLDGGLPTWRASGFDVESSASGDAILKASAASEAIEKVYRRQAVGPITFQTRF 244
Query: 241 QPHLIWTLEQVKRNIEEGTYQLVDARSKARFDGDAPEPRKGIRSGHVPGSKCIPFPQMLD 300
QPHL+WTLEQV +NIE T+Q +DARSKARFDG APEPRKGIRSGHVP SKCIPF QMLD
Sbjct: 245 QPHLVWTLEQVNQNIENKTHQHIDARSKARFDGIAPEPRKGIRSGHVPSSKCIPFSQMLD 304
Query: 301 ASQTLLPADELKKRFEQEGISLEKPVVTACGTGVTACILALGLNRLGKHDVAVYDGSWTE 360
+SQ LLPADELKKRF+QEGISL+ PVVT+CGTGVTACILALGL+RLGK DV VYDGSWTE
Sbjct: 305 SSQKLLPADELKKRFDQEGISLDSPVVTSCGTGVTACILALGLHRLGKSDVTVYDGSWTE 364
Query: 361 WGAQPDTPVETSS 373
WGA PDTPV TSS
Sbjct: 365 WGAHPDTPVATSS 377
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255544614|ref|XP_002513368.1| thiosulfate sulfertansferase, putative [Ricinus communis] gi|223547276|gb|EEF48771.1| thiosulfate sulfertansferase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|118484746|gb|ABK94242.1| unknown [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|388492146|gb|AFK34139.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
| >gi|224096608|ref|XP_002310670.1| predicted protein [Populus trichocarpa] gi|222853573|gb|EEE91120.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|4406372|gb|AAD19957.1| thiosulfate sulfurtransferase [Datisca glomerata] | Back alignment and taxonomy information |
|---|
| >gi|356525750|ref|XP_003531486.1| PREDICTED: 3-mercaptopyruvate sulfurtransferase-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|358347396|ref|XP_003637743.1| Mercaptopyruvate sulfurtransferase-like protein [Medicago truncatula] gi|355503678|gb|AES84881.1| Mercaptopyruvate sulfurtransferase-like protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|449497667|ref|XP_004160468.1| PREDICTED: thiosulfate/3-mercaptopyruvate sulfurtransferase 1, mitochondrial-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449464498|ref|XP_004149966.1| PREDICTED: thiosulfate/3-mercaptopyruvate sulfurtransferase 1, mitochondrial-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 373 | ||||||
| TAIR|locus:2207345 | 379 | MST1 "mercaptopyruvate sulfurt | 0.991 | 0.976 | 0.706 | 1.9e-145 | |
| TAIR|locus:2032800 | 342 | RDH2 "rhodanese homologue 2" [ | 0.852 | 0.929 | 0.734 | 1e-130 | |
| UNIPROTKB|Q608D7 | 316 | sseA "Sulfurtransferase" [Meth | 0.364 | 0.430 | 0.518 | 1.1e-70 | |
| UNIPROTKB|E1C8D8 | 293 | MPST "Sulfurtransferase" [Gall | 0.345 | 0.440 | 0.496 | 1.8e-62 | |
| UNIPROTKB|H9L016 | 267 | H9L016 "Sulfurtransferase" [Ga | 0.300 | 0.419 | 0.535 | 5.4e-61 | |
| ZFIN|ZDB-GENE-030131-9020 | 302 | zgc:162544 "zgc:162544" [Danio | 0.439 | 0.543 | 0.421 | 1.1e-60 | |
| UNIPROTKB|J3KPV7 | 317 | MPST "Sulfurtransferase" [Homo | 0.359 | 0.422 | 0.433 | 4.2e-59 | |
| UNIPROTKB|P25325 | 297 | MPST "3-mercaptopyruvate sulfu | 0.359 | 0.451 | 0.433 | 4.2e-59 | |
| UNIPROTKB|E2RJF7 | 298 | MPST "Sulfurtransferase" [Cani | 0.404 | 0.506 | 0.433 | 1.1e-58 | |
| RGD|620065 | 297 | Mpst "mercaptopyruvate sulfurt | 0.359 | 0.451 | 0.441 | 1.4e-58 |
| TAIR|locus:2207345 MST1 "mercaptopyruvate sulfurtransferase 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1421 (505.3 bits), Expect = 1.9e-145, P = 1.9e-145
Identities = 265/375 (70%), Positives = 304/375 (81%)
Query: 1 MASSLFTRRLVHSSFSISYKPQVFTSLLNKKLFYSRPXXXXXXXXXXXXXXPC----VMS 56
MAS+LF+R + +S + P + + N F SR M+
Sbjct: 1 MASTLFSRTFLAASHRL-ITPSLPQKIFNPATFLSRSLHSQLGSASTAYKSTTWARRAMA 59
Query: 57 SLAAGRRADYSTLSVSPKEPVVSVDWLHANLREPDLKVLDASWYMPDEQRNPFQEYQVAH 116
S +A YST SVS EPVVSVDWLHANLREPDLK+LDASWYMPDEQRNP QEYQVAH
Sbjct: 60 STGVETKAGYSTSSVSTSEPVVSVDWLHANLREPDLKILDASWYMPDEQRNPIQEYQVAH 119
Query: 117 IPGALFFDVDGVADRTTNLPHMLPSEEAFAAAVSALGLENKDGLVVYDGKGIFSAARVWW 176
IP ALFFD+DG++DR T+LPHMLP+EEAFAA SALG++NKD +VVYDGKGIFSAARVWW
Sbjct: 120 IPRALFFDLDGISDRKTSLPHMLPTEEAFAAGCSALGIDNKDEVVVYDGKGIFSAARVWW 179
Query: 177 MFRVFGHDRVWVLDGGLPRWRASGYDVESSASGDAILKASAASEAIEKVYQGQVVGPTTF 236
MFRVFGH++VWVLDGGLPRWRASGYDVESSASGDAILKASAASEAIEK+YQGQ V P TF
Sbjct: 180 MFRVFGHEKVWVLDGGLPRWRASGYDVESSASGDAILKASAASEAIEKIYQGQTVSPITF 239
Query: 237 QTKFQPHLIWTLEQVKRNIEEGTYQLVDARSKARFDGDAPEPRKGIRSGHVPGSKCIPFP 296
QTKFQPHL+WTL+QVK N+E+ TYQ +DARSKARFDG APEPRKGIRSGH+PGSKCIPFP
Sbjct: 240 QTKFQPHLVWTLDQVKNNMEDPTYQHIDARSKARFDGTAPEPRKGIRSGHIPGSKCIPFP 299
Query: 297 QMLDASQTLLPADELKKRFEQEGISLEKPVVTACGTGVTACILALGLNRLGKHDVAVYDG 356
QM D+ TLLPA+ELKKRF+QE ISL+KP++ +CGTGVTACILA+GL+RLGK DV +YDG
Sbjct: 300 QMFDSCNTLLPAEELKKRFDQEDISLDKPIMASCGTGVTACILAMGLHRLGKTDVPIYDG 359
Query: 357 SWTEWGAQPDTPVET 371
SWTEW QPD P+E+
Sbjct: 360 SWTEWATQPDLPIES 374
|
|
| TAIR|locus:2032800 RDH2 "rhodanese homologue 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q608D7 sseA "Sulfurtransferase" [Methylococcus capsulatus str. Bath (taxid:243233)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1C8D8 MPST "Sulfurtransferase" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|H9L016 H9L016 "Sulfurtransferase" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-9020 zgc:162544 "zgc:162544" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J3KPV7 MPST "Sulfurtransferase" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P25325 MPST "3-mercaptopyruvate sulfurtransferase" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RJF7 MPST "Sulfurtransferase" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| RGD|620065 Mpst "mercaptopyruvate sulfurtransferase" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 373 | |||
| PLN02723 | 320 | PLN02723, PLN02723, 3-mercaptopyruvate sulfurtrans | 0.0 | |
| COG2897 | 285 | COG2897, SseA, Rhodanese-related sulfurtransferase | 1e-105 | |
| PRK11493 | 281 | PRK11493, sseA, 3-mercaptopyruvate sulfurtransfera | 3e-86 | |
| cd01448 | 122 | cd01448, TST_Repeat_1, Thiosulfate sulfurtransfera | 9e-55 | |
| cd01449 | 118 | cd01449, TST_Repeat_2, Thiosulfate sulfurtransfera | 4e-54 | |
| cd01445 | 138 | cd01445, TST_Repeats, Thiosulfate sulfurtransferas | 7e-22 | |
| smart00450 | 100 | smart00450, RHOD, Rhodanese Homology Domain | 2e-19 | |
| PRK09629 | 610 | PRK09629, PRK09629, bifunctional thiosulfate sulfu | 5e-19 | |
| smart00450 | 100 | smart00450, RHOD, Rhodanese Homology Domain | 1e-18 | |
| pfam00581 | 106 | pfam00581, Rhodanese, Rhodanese-like domain | 2e-18 | |
| pfam00581 | 106 | pfam00581, Rhodanese, Rhodanese-like domain | 3e-18 | |
| cd01445 | 138 | cd01445, TST_Repeats, Thiosulfate sulfurtransferas | 2e-15 | |
| cd00158 | 89 | cd00158, RHOD, Rhodanese Homology Domain (RHOD); a | 1e-12 | |
| cd01519 | 106 | cd01519, RHOD_HSP67B2, Member of the Rhodanese Hom | 1e-09 | |
| cd00158 | 89 | cd00158, RHOD, Rhodanese Homology Domain (RHOD); a | 7e-07 | |
| cd01449 | 118 | cd01449, TST_Repeat_2, Thiosulfate sulfurtransfera | 8e-07 | |
| cd01448 | 122 | cd01448, TST_Repeat_1, Thiosulfate sulfurtransfera | 1e-06 | |
| COG0607 | 110 | COG0607, PspE, Rhodanese-related sulfurtransferase | 3e-04 | |
| cd01524 | 90 | cd01524, RHOD_Pyr_redox, Member of the Rhodanese H | 9e-04 | |
| cd01444 | 96 | cd01444, GlpE_ST, GlpE sulfurtransferase (ST) and | 0.004 |
| >gnl|CDD|178324 PLN02723, PLN02723, 3-mercaptopyruvate sulfurtransferase | Back alignment and domain information |
|---|
Score = 647 bits (1670), Expect = 0.0
Identities = 271/319 (84%), Positives = 299/319 (93%)
Query: 55 MSSLAAGRRADYSTLSVSPKEPVVSVDWLHANLREPDLKVLDASWYMPDEQRNPFQEYQV 114
M+S + +A+YST S+S EPVVSVDWLHANLREPD+KVLDASWYMPDEQRNP QEYQV
Sbjct: 1 MASSGSETKANYSTQSISTNEPVVSVDWLHANLREPDVKVLDASWYMPDEQRNPIQEYQV 60
Query: 115 AHIPGALFFDVDGVADRTTNLPHMLPSEEAFAAAVSALGLENKDGLVVYDGKGIFSAARV 174
AHIPGALFFD+DG++DRTT+LPHMLPSEEAFAAAVSALG+ENKDG+VVYDGKGIFSAARV
Sbjct: 61 AHIPGALFFDLDGISDRTTDLPHMLPSEEAFAAAVSALGIENKDGVVVYDGKGIFSAARV 120
Query: 175 WWMFRVFGHDRVWVLDGGLPRWRASGYDVESSASGDAILKASAASEAIEKVYQGQVVGPT 234
WWMFRVFGH++VWVLDGGLP+WRASGYDVESSASGDAILKASAASEAIEKVYQGQ V P
Sbjct: 121 WWMFRVFGHEKVWVLDGGLPKWRASGYDVESSASGDAILKASAASEAIEKVYQGQTVSPI 180
Query: 235 TFQTKFQPHLIWTLEQVKRNIEEGTYQLVDARSKARFDGDAPEPRKGIRSGHVPGSKCIP 294
TFQTKFQPHL+WTLEQVK+NIE+ TYQ +DARSKARFDG APEPRKGIRSGH+PGSKC+P
Sbjct: 181 TFQTKFQPHLVWTLEQVKKNIEDKTYQHIDARSKARFDGAAPEPRKGIRSGHIPGSKCVP 240
Query: 295 FPQMLDASQTLLPADELKKRFEQEGISLEKPVVTACGTGVTACILALGLNRLGKHDVAVY 354
FPQMLD+SQTLLPA+ELKKRFEQEGISL+ P+V +CGTGVTACILALGL+RLGK DV VY
Sbjct: 241 FPQMLDSSQTLLPAEELKKRFEQEGISLDSPIVASCGTGVTACILALGLHRLGKTDVPVY 300
Query: 355 DGSWTEWGAQPDTPVETSS 373
DGSWTEWGA PDTPV TS+
Sbjct: 301 DGSWTEWGALPDTPVATST 319
|
Length = 320 |
| >gnl|CDD|225450 COG2897, SseA, Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|236917 PRK11493, sseA, 3-mercaptopyruvate sulfurtransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238725 cd01448, TST_Repeat_1, Thiosulfate sulfurtransferase (TST), N-terminal, inactive domain | Back alignment and domain information |
|---|
| >gnl|CDD|238726 cd01449, TST_Repeat_2, Thiosulfate sulfurtransferase (TST), C-terminal, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|238722 cd01445, TST_Repeats, Thiosulfate sulfurtransferases (TST) contain 2 copies of the Rhodanese Homology Domain | Back alignment and domain information |
|---|
| >gnl|CDD|197731 smart00450, RHOD, Rhodanese Homology Domain | Back alignment and domain information |
|---|
| >gnl|CDD|104071 PRK09629, PRK09629, bifunctional thiosulfate sulfurtransferase/phosphatidylserine decarboxylase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|197731 smart00450, RHOD, Rhodanese Homology Domain | Back alignment and domain information |
|---|
| >gnl|CDD|216005 pfam00581, Rhodanese, Rhodanese-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|216005 pfam00581, Rhodanese, Rhodanese-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|238722 cd01445, TST_Repeats, Thiosulfate sulfurtransferases (TST) contain 2 copies of the Rhodanese Homology Domain | Back alignment and domain information |
|---|
| >gnl|CDD|238089 cd00158, RHOD, Rhodanese Homology Domain (RHOD); an alpha beta fold domain found duplicated in the rhodanese protein | Back alignment and domain information |
|---|
| >gnl|CDD|238777 cd01519, RHOD_HSP67B2, Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|238089 cd00158, RHOD, Rhodanese Homology Domain (RHOD); an alpha beta fold domain found duplicated in the rhodanese protein | Back alignment and domain information |
|---|
| >gnl|CDD|238726 cd01449, TST_Repeat_2, Thiosulfate sulfurtransferase (TST), C-terminal, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|238725 cd01448, TST_Repeat_1, Thiosulfate sulfurtransferase (TST), N-terminal, inactive domain | Back alignment and domain information |
|---|
| >gnl|CDD|223680 COG0607, PspE, Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|238782 cd01524, RHOD_Pyr_redox, Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|238721 cd01444, GlpE_ST, GlpE sulfurtransferase (ST) and homologs are members of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 373 | |||
| PLN02723 | 320 | 3-mercaptopyruvate sulfurtransferase | 100.0 | |
| COG2897 | 285 | SseA Rhodanese-related sulfurtransferase [Inorgani | 100.0 | |
| PRK11493 | 281 | sseA 3-mercaptopyruvate sulfurtransferase; Provisi | 100.0 | |
| PRK09629 | 610 | bifunctional thiosulfate sulfurtransferase/phospha | 100.0 | |
| KOG1529 | 286 | consensus Mercaptopyruvate sulfurtransferase/thios | 100.0 | |
| cd01445 | 138 | TST_Repeats Thiosulfate sulfurtransferases (TST) c | 99.92 | |
| cd01445 | 138 | TST_Repeats Thiosulfate sulfurtransferases (TST) c | 99.9 | |
| cd01449 | 118 | TST_Repeat_2 Thiosulfate sulfurtransferase (TST), | 99.9 | |
| cd01448 | 122 | TST_Repeat_1 Thiosulfate sulfurtransferase (TST), | 99.88 | |
| PRK00142 | 314 | putative rhodanese-related sulfurtransferase; Prov | 99.87 | |
| cd01519 | 106 | RHOD_HSP67B2 Member of the Rhodanese Homology Doma | 99.86 | |
| cd01448 | 122 | TST_Repeat_1 Thiosulfate sulfurtransferase (TST), | 99.86 | |
| PLN02160 | 136 | thiosulfate sulfurtransferase | 99.86 | |
| KOG1530 | 136 | consensus Rhodanese-related sulfurtransferase [Ino | 99.86 | |
| PRK11493 | 281 | sseA 3-mercaptopyruvate sulfurtransferase; Provisi | 99.85 | |
| cd01519 | 106 | RHOD_HSP67B2 Member of the Rhodanese Homology Doma | 99.84 | |
| TIGR03865 | 162 | PQQ_CXXCW PQQ-dependent catabolism-associated CXXC | 99.84 | |
| cd01518 | 101 | RHOD_YceA Member of the Rhodanese Homology Domain | 99.84 | |
| cd01449 | 118 | TST_Repeat_2 Thiosulfate sulfurtransferase (TST), | 99.84 | |
| TIGR03865 | 162 | PQQ_CXXCW PQQ-dependent catabolism-associated CXXC | 99.84 | |
| cd01533 | 109 | 4RHOD_Repeat_2 Member of the Rhodanese Homology Do | 99.83 | |
| cd01533 | 109 | 4RHOD_Repeat_2 Member of the Rhodanese Homology Do | 99.83 | |
| PLN02723 | 320 | 3-mercaptopyruvate sulfurtransferase | 99.83 | |
| cd01527 | 99 | RHOD_YgaP Member of the Rhodanese Homology Domain | 99.82 | |
| cd01520 | 128 | RHOD_YbbB Member of the Rhodanese Homology Domain | 99.82 | |
| PRK09629 | 610 | bifunctional thiosulfate sulfurtransferase/phospha | 99.82 | |
| cd01518 | 101 | RHOD_YceA Member of the Rhodanese Homology Domain | 99.82 | |
| cd01520 | 128 | RHOD_YbbB Member of the Rhodanese Homology Domain | 99.81 | |
| PRK00162 | 108 | glpE thiosulfate sulfurtransferase; Validated | 99.81 | |
| cd01525 | 105 | RHOD_Kc Member of the Rhodanese Homology Domain su | 99.8 | |
| smart00450 | 100 | RHOD Rhodanese Homology Domain. An alpha beta fold | 99.8 | |
| cd01526 | 122 | RHOD_ThiF Member of the Rhodanese Homology Domain | 99.8 | |
| TIGR03167 | 311 | tRNA_sel_U_synt tRNA 2-selenouridine synthase. The | 99.8 | |
| cd01527 | 99 | RHOD_YgaP Member of the Rhodanese Homology Domain | 99.79 | |
| COG2897 | 285 | SseA Rhodanese-related sulfurtransferase [Inorgani | 99.79 | |
| cd01525 | 105 | RHOD_Kc Member of the Rhodanese Homology Domain su | 99.79 | |
| cd01534 | 95 | 4RHOD_Repeat_3 Member of the Rhodanese Homology Do | 99.79 | |
| PRK08762 | 376 | molybdopterin biosynthesis protein MoeB; Validated | 99.79 | |
| cd01447 | 103 | Polysulfide_ST Polysulfide-sulfurtransferase - Rho | 99.79 | |
| PRK11784 | 345 | tRNA 2-selenouridine synthase; Provisional | 99.78 | |
| PF00581 | 113 | Rhodanese: Rhodanese-like domain This Prosite entr | 99.78 | |
| cd01523 | 100 | RHOD_Lact_B Member of the Rhodanese Homology Domai | 99.78 | |
| PRK00162 | 108 | glpE thiosulfate sulfurtransferase; Validated | 99.78 | |
| cd01528 | 101 | RHOD_2 Member of the Rhodanese Homology Domain sup | 99.78 | |
| cd01522 | 117 | RHOD_1 Member of the Rhodanese Homology Domain sup | 99.78 | |
| cd01534 | 95 | 4RHOD_Repeat_3 Member of the Rhodanese Homology Do | 99.78 | |
| cd01521 | 110 | RHOD_PspE2 Member of the Rhodanese Homology Domain | 99.77 | |
| cd01521 | 110 | RHOD_PspE2 Member of the Rhodanese Homology Domain | 99.77 | |
| cd01447 | 103 | Polysulfide_ST Polysulfide-sulfurtransferase - Rho | 99.77 | |
| cd01444 | 96 | GlpE_ST GlpE sulfurtransferase (ST) and homologs a | 99.77 | |
| smart00450 | 100 | RHOD Rhodanese Homology Domain. An alpha beta fold | 99.77 | |
| PLN02160 | 136 | thiosulfate sulfurtransferase | 99.76 | |
| cd01524 | 90 | RHOD_Pyr_redox Member of the Rhodanese Homology Do | 99.76 | |
| cd01528 | 101 | RHOD_2 Member of the Rhodanese Homology Domain sup | 99.75 | |
| cd01529 | 96 | 4RHOD_Repeats Member of the Rhodanese Homology Dom | 99.75 | |
| PF00581 | 113 | Rhodanese: Rhodanese-like domain This Prosite entr | 99.75 | |
| cd01526 | 122 | RHOD_ThiF Member of the Rhodanese Homology Domain | 99.75 | |
| cd01530 | 121 | Cdc25 Cdc25 phosphatases are members of the Rhodan | 99.75 | |
| cd01530 | 121 | Cdc25 Cdc25 phosphatases are members of the Rhodan | 99.74 | |
| KOG1530 | 136 | consensus Rhodanese-related sulfurtransferase [Ino | 99.74 | |
| cd01523 | 100 | RHOD_Lact_B Member of the Rhodanese Homology Domai | 99.73 | |
| cd01535 | 145 | 4RHOD_Repeat_4 Member of the Rhodanese Homology Do | 99.73 | |
| cd01529 | 96 | 4RHOD_Repeats Member of the Rhodanese Homology Dom | 99.73 | |
| cd01524 | 90 | RHOD_Pyr_redox Member of the Rhodanese Homology Do | 99.72 | |
| cd01444 | 96 | GlpE_ST GlpE sulfurtransferase (ST) and homologs a | 99.72 | |
| cd01522 | 117 | RHOD_1 Member of the Rhodanese Homology Domain sup | 99.71 | |
| cd01531 | 113 | Acr2p Eukaryotic arsenate resistance proteins are | 99.71 | |
| cd01535 | 145 | 4RHOD_Repeat_4 Member of the Rhodanese Homology Do | 99.71 | |
| cd01532 | 92 | 4RHOD_Repeat_1 Member of the Rhodanese Homology Do | 99.7 | |
| PRK08762 | 376 | molybdopterin biosynthesis protein MoeB; Validated | 99.7 | |
| cd01531 | 113 | Acr2p Eukaryotic arsenate resistance proteins are | 99.7 | |
| cd00158 | 89 | RHOD Rhodanese Homology Domain (RHOD); an alpha be | 99.7 | |
| cd01532 | 92 | 4RHOD_Repeat_1 Member of the Rhodanese Homology Do | 99.7 | |
| TIGR02981 | 101 | phageshock_pspE phage shock operon rhodanese PspE. | 99.68 | |
| COG0607 | 110 | PspE Rhodanese-related sulfurtransferase [Inorgani | 99.68 | |
| PRK01415 | 247 | hypothetical protein; Validated | 99.67 | |
| PRK10287 | 104 | thiosulfate:cyanide sulfurtransferase; Provisional | 99.67 | |
| cd01443 | 113 | Cdc25_Acr2p Cdc25 enzymes are members of the Rhoda | 99.67 | |
| cd00158 | 89 | RHOD Rhodanese Homology Domain (RHOD); an alpha be | 99.66 | |
| cd01443 | 113 | Cdc25_Acr2p Cdc25 enzymes are members of the Rhoda | 99.66 | |
| cd01446 | 132 | DSP_MapKP N-terminal regulatory rhodanese domain o | 99.65 | |
| PRK00142 | 314 | putative rhodanese-related sulfurtransferase; Prov | 99.63 | |
| PRK01415 | 247 | hypothetical protein; Validated | 99.63 | |
| TIGR02981 | 101 | phageshock_pspE phage shock operon rhodanese PspE. | 99.6 | |
| PRK05320 | 257 | rhodanese superfamily protein; Provisional | 99.6 | |
| PRK10287 | 104 | thiosulfate:cyanide sulfurtransferase; Provisional | 99.59 | |
| PRK07878 | 392 | molybdopterin biosynthesis-like protein MoeZ; Vali | 99.59 | |
| COG0607 | 110 | PspE Rhodanese-related sulfurtransferase [Inorgani | 99.57 | |
| PRK05320 | 257 | rhodanese superfamily protein; Provisional | 99.57 | |
| cd01446 | 132 | DSP_MapKP N-terminal regulatory rhodanese domain o | 99.57 | |
| PRK07878 | 392 | molybdopterin biosynthesis-like protein MoeZ; Vali | 99.56 | |
| PRK07411 | 390 | hypothetical protein; Validated | 99.55 | |
| PRK05597 | 355 | molybdopterin biosynthesis protein MoeB; Validated | 99.52 | |
| PRK11784 | 345 | tRNA 2-selenouridine synthase; Provisional | 99.52 | |
| TIGR03167 | 311 | tRNA_sel_U_synt tRNA 2-selenouridine synthase. The | 99.48 | |
| PRK05597 | 355 | molybdopterin biosynthesis protein MoeB; Validated | 99.47 | |
| KOG1529 | 286 | consensus Mercaptopyruvate sulfurtransferase/thios | 99.45 | |
| PRK07411 | 390 | hypothetical protein; Validated | 99.43 | |
| PRK05600 | 370 | thiamine biosynthesis protein ThiF; Validated | 99.42 | |
| PRK05600 | 370 | thiamine biosynthesis protein ThiF; Validated | 99.28 | |
| COG1054 | 308 | Predicted sulfurtransferase [General function pred | 99.17 | |
| PRK01269 | 482 | tRNA s(4)U8 sulfurtransferase; Provisional | 99.11 | |
| COG1054 | 308 | Predicted sulfurtransferase [General function pred | 99.07 | |
| KOG3772 | 325 | consensus M-phase inducer phosphatase [Cell cycle | 98.93 | |
| KOG2017 | 427 | consensus Molybdopterin synthase sulfurylase [Coen | 98.9 | |
| KOG3772 | 325 | consensus M-phase inducer phosphatase [Cell cycle | 98.83 | |
| PRK01269 | 482 | tRNA s(4)U8 sulfurtransferase; Provisional | 98.79 | |
| KOG2017 | 427 | consensus Molybdopterin synthase sulfurylase [Coen | 98.44 | |
| COG5105 | 427 | MIH1 Mitotic inducer, protein phosphatase [Cell di | 98.22 | |
| COG5105 | 427 | MIH1 Mitotic inducer, protein phosphatase [Cell di | 97.73 | |
| KOG1717 | 343 | consensus Dual specificity phosphatase [Defense me | 96.44 | |
| PF04273 | 110 | DUF442: Putative phosphatase (DUF442); InterPro: I | 96.29 | |
| COG2603 | 334 | Predicted ATPase [General function prediction only | 96.28 | |
| TIGR01244 | 135 | conserved hypothetical protein TIGR01244. No membe | 95.95 | |
| COG2603 | 334 | Predicted ATPase [General function prediction only | 93.55 | |
| KOG3636 | 669 | consensus Uncharacterized conserved protein, conta | 91.2 | |
| COG3453 | 130 | Uncharacterized protein conserved in bacteria [Fun | 90.98 | |
| KOG0814 | 237 | consensus Glyoxylase [General function prediction | 89.5 | |
| KOG1093 | 725 | consensus Predicted protein kinase (contains TBC a | 89.42 | |
| TIGR01244 | 135 | conserved hypothetical protein TIGR01244. No membe | 87.67 | |
| PF04273 | 110 | DUF442: Putative phosphatase (DUF442); InterPro: I | 86.35 | |
| KOG1093 | 725 | consensus Predicted protein kinase (contains TBC a | 84.53 | |
| smart00195 | 138 | DSPc Dual specificity phosphatase, catalytic domai | 83.42 | |
| PLN02727 | 986 | NAD kinase | 80.36 |
| >PLN02723 3-mercaptopyruvate sulfurtransferase | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.2e-62 Score=472.17 Aligned_cols=314 Identities=86% Similarity=1.407 Sum_probs=283.9
Q ss_pred hcccccCCCCCCCCCCCCcccHHHHHHhcCCCCeEEEEeecCCCCCCCCChhhhhhCCCcCceecCcccccccCCCCCCC
Q 017338 59 AAGRRADYSTLSVSPKEPVVSVDWLHANLREPDLKVLDASWYMPDEQRNPFQEYQVAHIPGALFFDVDGVADRTTNLPHM 138 (373)
Q Consensus 59 ~~~~~~~~~~~~~~~~~~~is~~~l~~~l~~~~~~iiDvR~~~~~~~r~~~~ey~~gHIpGAi~ip~~~l~~~~~~~~~~ 138 (373)
.+.+.+.+++.+.++...+||++||++++++++++|||+||+++.+.|++.++|..||||||+|+|+..+.+.....+++
T Consensus 5 ~~~~~~~~~~~~~~~~~~lvs~~~L~~~l~~~~~~IiDvr~~~~~~~r~~~~~y~~gHIPgAi~i~~~~~~~~~~~~~~~ 84 (320)
T PLN02723 5 GSETKANYSTQSISTNEPVVSVDWLHANLREPDVKVLDASWYMPDEQRNPIQEYQVAHIPGALFFDLDGISDRTTDLPHM 84 (320)
T ss_pred chhhcccCcccccccCCceecHHHHHHHhcCCCeEEEEeeccccCCCCchHHHHHhccCCCCeecCHHHhcCCCCCcCCC
Confidence 56777888888888888999999999999988899999999888877876678999999999999998887766778899
Q ss_pred CCCHHHHHHHHHHcCCCCCCeEEEEcCCCCchHHHHHHHHHHcCCCceEEecCCHHHHHhCCCCcccCCCcchhHhhhhh
Q 017338 139 LPSEEAFAAAVSALGLENKDGLVVYDGKGIFSAARVWWMFRVFGHDRVWVLDGGLPRWRASGYDVESSASGDAILKASAA 218 (373)
Q Consensus 139 l~~~e~~~~~l~~~gi~~~~~VVvy~~~g~~~a~ra~~~L~~~G~~~v~~L~GG~~~W~~~g~pv~~~~~~~~~~~~~~~ 218 (373)
+|+++.|++.|+.+||+++++|||||+.|.+.++|++|+|+++||++|++||||+.+|+++|+|+++..+.+++++..++
T Consensus 85 lp~~~~~~~~l~~~Gi~~~~~VVvY~~~g~~~a~r~~~~L~~~G~~~V~~LdGG~~~W~~~G~pv~~~~~~~~~~~~~~~ 164 (320)
T PLN02723 85 LPSEEAFAAAVSALGIENKDGVVVYDGKGIFSAARVWWMFRVFGHEKVWVLDGGLPKWRASGYDVESSASGDAILKASAA 164 (320)
T ss_pred CCCHHHHHHHHHHcCCCCCCEEEEEcCCCcchHHHHHHHHHHcCCCceEEcCCCHHHHHHcCCCcccCCCcccccccccc
Confidence 99999999999999999999999999988888899999999999999999999999999999999987654555555555
Q ss_pred HHHHHHhhcCcccCCcceeeccCCccccCHHHHHHHhhCCCcEEEEecCCCccCCCCCCCCCCCCcccCCCCcccCcccc
Q 017338 219 SEAIEKVYQGQVVGPTTFQTKFQPHLIWTLEQVKRNIEEGTYQLVDARSKARFDGDAPEPRKGIRSGHVPGSKCIPFPQM 298 (373)
Q Consensus 219 ~~~~~~~~~~~~~~~~~~~~~~~~~~~is~~el~~~~~~~~~~iIDvR~~~e~~G~~~~~~~~~~~GhIpGA~~ip~~~l 298 (373)
.+.+++.+.++.+.+.+|...+++.++++.+++.+++.+++.+|||+|++.||.|...++....+.||||||+|+|+.++
T Consensus 165 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~iiD~R~~~ef~G~~~~~~~~~~~GHIPgAvnip~~~~ 244 (320)
T PLN02723 165 SEAIEKVYQGQTVSPITFQTKFQPHLVWTLEQVKKNIEDKTYQHIDARSKARFDGAAPEPRKGIRSGHIPGSKCVPFPQM 244 (320)
T ss_pred ccccccccccCCCCCCcccccCCccceecHHHHHHhhcCCCeEEEECCCcccccCCCCCCCCCCcCCcCCCCcccCHHHh
Confidence 56677777666677788988899999999999999998778899999999999998777666678999999999999998
Q ss_pred cccCCCCCCHHHHHHHHHHcCCCCCCcEEEEcCCchHHHHHHHHHHHcCCCCceeecccHHHHhcCCCCCCcCC
Q 017338 299 LDASQTLLPADELKKRFEQEGISLEKPVVTACGTGVTACILALGLNRLGKHDVAVYDGSWTEWGAQPDTPVETS 372 (373)
Q Consensus 299 ~~~~~~~~~~~~l~~~~~~~gi~~~~~IvvyC~~G~ra~~a~~~L~~~G~~~v~~~~GG~~~W~~~~g~Pv~~~ 372 (373)
.+.++.|++.++|++++.+.|++++++||+||++|.+|+.++++|+.+||+||++|+|||.+|...+++|++++
T Consensus 245 ~~~~~~~~~~~el~~~~~~~gi~~~~~iv~yC~sG~~A~~~~~~L~~~G~~~v~~YdGs~~eW~~~~~~Pv~~~ 318 (320)
T PLN02723 245 LDSSQTLLPAEELKKRFEQEGISLDSPIVASCGTGVTACILALGLHRLGKTDVPVYDGSWTEWGALPDTPVATS 318 (320)
T ss_pred cCCCCCCCCHHHHHHHHHhcCCCCCCCEEEECCcHHHHHHHHHHHHHcCCCCeeEeCCCHHHHhcCCCCCccCC
Confidence 88888999999999999999999999999999999999999999999999999999999999999989999976
|
|
| >COG2897 SseA Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11493 sseA 3-mercaptopyruvate sulfurtransferase; Provisional | Back alignment and domain information |
|---|
| >PRK09629 bifunctional thiosulfate sulfurtransferase/phosphatidylserine decarboxylase; Provisional | Back alignment and domain information |
|---|
| >KOG1529 consensus Mercaptopyruvate sulfurtransferase/thiosulfate sulfurtransferase [Defense mechanisms] | Back alignment and domain information |
|---|
| >cd01445 TST_Repeats Thiosulfate sulfurtransferases (TST) contain 2 copies of the Rhodanese Homology Domain | Back alignment and domain information |
|---|
| >cd01445 TST_Repeats Thiosulfate sulfurtransferases (TST) contain 2 copies of the Rhodanese Homology Domain | Back alignment and domain information |
|---|
| >cd01449 TST_Repeat_2 Thiosulfate sulfurtransferase (TST), C-terminal, catalytic domain | Back alignment and domain information |
|---|
| >cd01448 TST_Repeat_1 Thiosulfate sulfurtransferase (TST), N-terminal, inactive domain | Back alignment and domain information |
|---|
| >PRK00142 putative rhodanese-related sulfurtransferase; Provisional | Back alignment and domain information |
|---|
| >cd01519 RHOD_HSP67B2 Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01448 TST_Repeat_1 Thiosulfate sulfurtransferase (TST), N-terminal, inactive domain | Back alignment and domain information |
|---|
| >PLN02160 thiosulfate sulfurtransferase | Back alignment and domain information |
|---|
| >KOG1530 consensus Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11493 sseA 3-mercaptopyruvate sulfurtransferase; Provisional | Back alignment and domain information |
|---|
| >cd01519 RHOD_HSP67B2 Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >TIGR03865 PQQ_CXXCW PQQ-dependent catabolism-associated CXXCW motif protein | Back alignment and domain information |
|---|
| >cd01518 RHOD_YceA Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01449 TST_Repeat_2 Thiosulfate sulfurtransferase (TST), C-terminal, catalytic domain | Back alignment and domain information |
|---|
| >TIGR03865 PQQ_CXXCW PQQ-dependent catabolism-associated CXXCW motif protein | Back alignment and domain information |
|---|
| >cd01533 4RHOD_Repeat_2 Member of the Rhodanese Homology Domain superfamily, repeat 2 | Back alignment and domain information |
|---|
| >cd01533 4RHOD_Repeat_2 Member of the Rhodanese Homology Domain superfamily, repeat 2 | Back alignment and domain information |
|---|
| >PLN02723 3-mercaptopyruvate sulfurtransferase | Back alignment and domain information |
|---|
| >cd01527 RHOD_YgaP Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01520 RHOD_YbbB Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >PRK09629 bifunctional thiosulfate sulfurtransferase/phosphatidylserine decarboxylase; Provisional | Back alignment and domain information |
|---|
| >cd01518 RHOD_YceA Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01520 RHOD_YbbB Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >PRK00162 glpE thiosulfate sulfurtransferase; Validated | Back alignment and domain information |
|---|
| >cd01525 RHOD_Kc Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >smart00450 RHOD Rhodanese Homology Domain | Back alignment and domain information |
|---|
| >cd01526 RHOD_ThiF Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >TIGR03167 tRNA_sel_U_synt tRNA 2-selenouridine synthase | Back alignment and domain information |
|---|
| >cd01527 RHOD_YgaP Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >COG2897 SseA Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd01525 RHOD_Kc Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01534 4RHOD_Repeat_3 Member of the Rhodanese Homology Domain superfamily, repeat 3 | Back alignment and domain information |
|---|
| >PRK08762 molybdopterin biosynthesis protein MoeB; Validated | Back alignment and domain information |
|---|
| >cd01447 Polysulfide_ST Polysulfide-sulfurtransferase - Rhodanese Homology Domain | Back alignment and domain information |
|---|
| >PRK11784 tRNA 2-selenouridine synthase; Provisional | Back alignment and domain information |
|---|
| >PF00581 Rhodanese: Rhodanese-like domain This Prosite entry represents a subset of this family | Back alignment and domain information |
|---|
| >cd01523 RHOD_Lact_B Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >PRK00162 glpE thiosulfate sulfurtransferase; Validated | Back alignment and domain information |
|---|
| >cd01528 RHOD_2 Member of the Rhodanese Homology Domain superfamily, subgroup 2 | Back alignment and domain information |
|---|
| >cd01522 RHOD_1 Member of the Rhodanese Homology Domain superfamily, subgroup 1 | Back alignment and domain information |
|---|
| >cd01534 4RHOD_Repeat_3 Member of the Rhodanese Homology Domain superfamily, repeat 3 | Back alignment and domain information |
|---|
| >cd01521 RHOD_PspE2 Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01521 RHOD_PspE2 Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01447 Polysulfide_ST Polysulfide-sulfurtransferase - Rhodanese Homology Domain | Back alignment and domain information |
|---|
| >cd01444 GlpE_ST GlpE sulfurtransferase (ST) and homologs are members of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >smart00450 RHOD Rhodanese Homology Domain | Back alignment and domain information |
|---|
| >PLN02160 thiosulfate sulfurtransferase | Back alignment and domain information |
|---|
| >cd01524 RHOD_Pyr_redox Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01528 RHOD_2 Member of the Rhodanese Homology Domain superfamily, subgroup 2 | Back alignment and domain information |
|---|
| >cd01529 4RHOD_Repeats Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >PF00581 Rhodanese: Rhodanese-like domain This Prosite entry represents a subset of this family | Back alignment and domain information |
|---|
| >cd01526 RHOD_ThiF Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01530 Cdc25 Cdc25 phosphatases are members of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01530 Cdc25 Cdc25 phosphatases are members of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >KOG1530 consensus Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd01523 RHOD_Lact_B Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01535 4RHOD_Repeat_4 Member of the Rhodanese Homology Domain superfamily, repeat 4 | Back alignment and domain information |
|---|
| >cd01529 4RHOD_Repeats Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01524 RHOD_Pyr_redox Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01444 GlpE_ST GlpE sulfurtransferase (ST) and homologs are members of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01522 RHOD_1 Member of the Rhodanese Homology Domain superfamily, subgroup 1 | Back alignment and domain information |
|---|
| >cd01531 Acr2p Eukaryotic arsenate resistance proteins are members of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01535 4RHOD_Repeat_4 Member of the Rhodanese Homology Domain superfamily, repeat 4 | Back alignment and domain information |
|---|
| >cd01532 4RHOD_Repeat_1 Member of the Rhodanese Homology Domain superfamily, repeat 1 | Back alignment and domain information |
|---|
| >PRK08762 molybdopterin biosynthesis protein MoeB; Validated | Back alignment and domain information |
|---|
| >cd01531 Acr2p Eukaryotic arsenate resistance proteins are members of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd00158 RHOD Rhodanese Homology Domain (RHOD); an alpha beta fold domain found duplicated in the rhodanese protein | Back alignment and domain information |
|---|
| >cd01532 4RHOD_Repeat_1 Member of the Rhodanese Homology Domain superfamily, repeat 1 | Back alignment and domain information |
|---|
| >TIGR02981 phageshock_pspE phage shock operon rhodanese PspE | Back alignment and domain information |
|---|
| >COG0607 PspE Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK01415 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK10287 thiosulfate:cyanide sulfurtransferase; Provisional | Back alignment and domain information |
|---|
| >cd01443 Cdc25_Acr2p Cdc25 enzymes are members of the Rhodanese Homology Domain (RHOD) superfamily | Back alignment and domain information |
|---|
| >cd00158 RHOD Rhodanese Homology Domain (RHOD); an alpha beta fold domain found duplicated in the rhodanese protein | Back alignment and domain information |
|---|
| >cd01443 Cdc25_Acr2p Cdc25 enzymes are members of the Rhodanese Homology Domain (RHOD) superfamily | Back alignment and domain information |
|---|
| >cd01446 DSP_MapKP N-terminal regulatory rhodanese domain of dual specificity phosphatases (DSP), such as Mapk Phosphatase | Back alignment and domain information |
|---|
| >PRK00142 putative rhodanese-related sulfurtransferase; Provisional | Back alignment and domain information |
|---|
| >PRK01415 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR02981 phageshock_pspE phage shock operon rhodanese PspE | Back alignment and domain information |
|---|
| >PRK05320 rhodanese superfamily protein; Provisional | Back alignment and domain information |
|---|
| >PRK10287 thiosulfate:cyanide sulfurtransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated | Back alignment and domain information |
|---|
| >COG0607 PspE Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK05320 rhodanese superfamily protein; Provisional | Back alignment and domain information |
|---|
| >cd01446 DSP_MapKP N-terminal regulatory rhodanese domain of dual specificity phosphatases (DSP), such as Mapk Phosphatase | Back alignment and domain information |
|---|
| >PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated | Back alignment and domain information |
|---|
| >PRK07411 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK05597 molybdopterin biosynthesis protein MoeB; Validated | Back alignment and domain information |
|---|
| >PRK11784 tRNA 2-selenouridine synthase; Provisional | Back alignment and domain information |
|---|
| >TIGR03167 tRNA_sel_U_synt tRNA 2-selenouridine synthase | Back alignment and domain information |
|---|
| >PRK05597 molybdopterin biosynthesis protein MoeB; Validated | Back alignment and domain information |
|---|
| >KOG1529 consensus Mercaptopyruvate sulfurtransferase/thiosulfate sulfurtransferase [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK07411 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK05600 thiamine biosynthesis protein ThiF; Validated | Back alignment and domain information |
|---|
| >PRK05600 thiamine biosynthesis protein ThiF; Validated | Back alignment and domain information |
|---|
| >COG1054 Predicted sulfurtransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK01269 tRNA s(4)U8 sulfurtransferase; Provisional | Back alignment and domain information |
|---|
| >COG1054 Predicted sulfurtransferase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3772 consensus M-phase inducer phosphatase [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG2017 consensus Molybdopterin synthase sulfurylase [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >KOG3772 consensus M-phase inducer phosphatase [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK01269 tRNA s(4)U8 sulfurtransferase; Provisional | Back alignment and domain information |
|---|
| >KOG2017 consensus Molybdopterin synthase sulfurylase [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >COG5105 MIH1 Mitotic inducer, protein phosphatase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >COG5105 MIH1 Mitotic inducer, protein phosphatase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG1717 consensus Dual specificity phosphatase [Defense mechanisms] | Back alignment and domain information |
|---|
| >PF04273 DUF442: Putative phosphatase (DUF442); InterPro: IPR005939 Although this domain is uncharacterised it seems likely that it performs a phosphatase function | Back alignment and domain information |
|---|
| >COG2603 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01244 conserved hypothetical protein TIGR01244 | Back alignment and domain information |
|---|
| >COG2603 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3636 consensus Uncharacterized conserved protein, contains TBC and Rhodanese domains [General function prediction only] | Back alignment and domain information |
|---|
| >COG3453 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG0814 consensus Glyoxylase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1093 consensus Predicted protein kinase (contains TBC and RHOD domains) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01244 conserved hypothetical protein TIGR01244 | Back alignment and domain information |
|---|
| >PF04273 DUF442: Putative phosphatase (DUF442); InterPro: IPR005939 Although this domain is uncharacterised it seems likely that it performs a phosphatase function | Back alignment and domain information |
|---|
| >KOG1093 consensus Predicted protein kinase (contains TBC and RHOD domains) [General function prediction only] | Back alignment and domain information |
|---|
| >smart00195 DSPc Dual specificity phosphatase, catalytic domain | Back alignment and domain information |
|---|
| >PLN02727 NAD kinase | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 373 | ||||
| 3olh_A | 302 | Human 3-Mercaptopyruvate Sulfurtransferase Length = | 1e-60 | ||
| 1urh_A | 280 | The "rhodanese" Fold And Catalytic Mechanism Of 3-M | 4e-56 | ||
| 1orb_A | 296 | Active Site Structural Features For Chemically Modi | 8e-54 | ||
| 1boh_A | 296 | Sulfur-Substituted Rhodanese (Orthorhombic Form) Le | 1e-52 | ||
| 1rhs_A | 296 | Sulfur-Substituted Rhodanese Length = 296 | 1e-52 | ||
| 1dp2_A | 293 | Crystal Structure Of The Complex Between Rhodanese | 2e-52 | ||
| 1rhd_A | 293 | Structure Of Bovine Liver Rhodanese. I. Structure D | 4e-52 | ||
| 3utn_X | 327 | Crystal Structure Of Tum1 Protein From Saccharomyce | 3e-39 | ||
| 1uar_A | 285 | Crystal Structure Of Rhodanese From Thermus Thermop | 4e-23 | ||
| 3hwi_A | 298 | Crystal Structure Of Probable Thiosulfate Sulfurtra | 1e-21 | ||
| 3aax_A | 277 | Crystal Structure Of Probable Thiosulfate Sulfurtra | 2e-21 | ||
| 3aay_A | 277 | Crystal Structure Of Probable Thiosulfate Sulfurtra | 3e-20 | ||
| 1h4k_X | 271 | Sulfurtransferase From Azotobacter Vinelandii In Co | 1e-19 | ||
| 1e0c_A | 271 | Sulfurtransferase From Azotobacter Vinelandii Lengt | 3e-18 | ||
| 3ipp_A | 416 | Crystal Structure Of Sulfur-Free Ynje Length = 416 | 2e-17 | ||
| 3hzu_A | 318 | Crystal Structure Of Probable Thiosulfate Sulfurtra | 2e-17 | ||
| 3ipo_A | 416 | Crystal Structure Of Ynje Length = 416 | 4e-16 | ||
| 2wlx_A | 423 | Putative Thiosulfate Sulfurtransferase Ynje Length | 4e-16 | ||
| 3p3a_A | 320 | Crystal Structure Of A Putative Thiosulfate Sulfurt | 2e-15 | ||
| 2wlr_A | 423 | Putative Thiosulfate Sulfurtransferase Ynje Length | 1e-13 | ||
| 1okg_A | 373 | 3-Mercaptopyruvate Sulfurtransferase From Leishmani | 2e-09 |
| >pdb|3OLH|A Chain A, Human 3-Mercaptopyruvate Sulfurtransferase Length = 302 | Back alignment and structure |
|
| >pdb|1URH|A Chain A, The "rhodanese" Fold And Catalytic Mechanism Of 3-Mercaptopyruvate Sulfotransferases: Crystal Structure Of Ssea From Escherichia Coli Length = 280 | Back alignment and structure |
| >pdb|1ORB|A Chain A, Active Site Structural Features For Chemically Modified Forms Of Rhodanese Length = 296 | Back alignment and structure |
| >pdb|1BOH|A Chain A, Sulfur-Substituted Rhodanese (Orthorhombic Form) Length = 296 | Back alignment and structure |
| >pdb|1RHS|A Chain A, Sulfur-Substituted Rhodanese Length = 296 | Back alignment and structure |
| >pdb|1DP2|A Chain A, Crystal Structure Of The Complex Between Rhodanese And Lipoate Length = 293 | Back alignment and structure |
| >pdb|1RHD|A Chain A, Structure Of Bovine Liver Rhodanese. I. Structure Determination At 2.5 Angstroms Resolution And A Comparison Of The Conformation And Sequence Of Its Two Domains Length = 293 | Back alignment and structure |
| >pdb|3UTN|X Chain X, Crystal Structure Of Tum1 Protein From Saccharomyces Cerevisiae Length = 327 | Back alignment and structure |
| >pdb|1UAR|A Chain A, Crystal Structure Of Rhodanese From Thermus Thermophilus Hb8 Length = 285 | Back alignment and structure |
| >pdb|3HWI|A Chain A, Crystal Structure Of Probable Thiosulfate Sulfurtransferase Cysa2 (Rhodanese-Like Protein) From Mycobacterium Tuberculosis Length = 298 | Back alignment and structure |
| >pdb|3AAX|A Chain A, Crystal Structure Of Probable Thiosulfate Sulfurtransferase Cysa3 (Rv3117) From Mycobacterium Tuberculosis: Monoclinic Form Length = 277 | Back alignment and structure |
| >pdb|3AAY|A Chain A, Crystal Structure Of Probable Thiosulfate Sulfurtransferase Cysa3 (Rv3117) From Mycobacterium Tuberculosis: Orthorhombic Form Length = 277 | Back alignment and structure |
| >pdb|1H4K|X Chain X, Sulfurtransferase From Azotobacter Vinelandii In Complex With Hypophosphite Length = 271 | Back alignment and structure |
| >pdb|1E0C|A Chain A, Sulfurtransferase From Azotobacter Vinelandii Length = 271 | Back alignment and structure |
| >pdb|3IPP|A Chain A, Crystal Structure Of Sulfur-Free Ynje Length = 416 | Back alignment and structure |
| >pdb|3HZU|A Chain A, Crystal Structure Of Probable Thiosulfate Sulfurtransferase Ssea (Rhodanese) From Mycobacterium Tuberculosis Length = 318 | Back alignment and structure |
| >pdb|3IPO|A Chain A, Crystal Structure Of Ynje Length = 416 | Back alignment and structure |
| >pdb|2WLX|A Chain A, Putative Thiosulfate Sulfurtransferase Ynje Length = 423 | Back alignment and structure |
| >pdb|3P3A|A Chain A, Crystal Structure Of A Putative Thiosulfate Sulfurtransferase From Mycobacterium Thermoresistible Length = 320 | Back alignment and structure |
| >pdb|2WLR|A Chain A, Putative Thiosulfate Sulfurtransferase Ynje Length = 423 | Back alignment and structure |
| >pdb|1OKG|A Chain A, 3-Mercaptopyruvate Sulfurtransferase From Leishmania Major Length = 373 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 373 | |||
| 1urh_A | 280 | 3-mercaptopyruvate sulfurtransferase; rhodanese; 2 | 1e-156 | |
| 3olh_A | 302 | MST, 3-mercaptopyruvate sulfurtransferase; structu | 1e-153 | |
| 1rhs_A | 296 | Sulfur-substituted rhodanese; transferase, sulfurt | 1e-151 | |
| 3aay_A | 277 | Putative thiosulfate sulfurtransferase; sulfurtran | 1e-129 | |
| 1e0c_A | 271 | Rhodanese, sulfurtransferase; sulfur metabolism, t | 1e-128 | |
| 1uar_A | 285 | Rhodanese; sulfurtransferase, riken structural gen | 1e-128 | |
| 1okg_A | 373 | Possible 3-mercaptopyruvate sulfurtransferase; rho | 1e-127 | |
| 3hzu_A | 318 | Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, | 1e-122 | |
| 2wlr_A | 423 | Putative thiosulfate sulfurtransferase YNJE; rhoda | 1e-117 | |
| 2wlr_A | 423 | Putative thiosulfate sulfurtransferase YNJE; rhoda | 1e-22 | |
| 2eg4_A | 230 | Probable thiosulfate sulfurtransferase; structural | 8e-85 | |
| 1yt8_A | 539 | Thiosulfate sulfurtransferase; rhodanase domains, | 2e-20 | |
| 1yt8_A | 539 | Thiosulfate sulfurtransferase; rhodanase domains, | 2e-15 | |
| 1yt8_A | 539 | Thiosulfate sulfurtransferase; rhodanase domains, | 2e-13 | |
| 1yt8_A | 539 | Thiosulfate sulfurtransferase; rhodanase domains, | 2e-09 | |
| 1yt8_A | 539 | Thiosulfate sulfurtransferase; rhodanase domains, | 2e-09 | |
| 3d1p_A | 139 | Putative thiosulfate sulfurtransferase YOR285W; at | 8e-17 | |
| 3d1p_A | 139 | Putative thiosulfate sulfurtransferase YOR285W; at | 9e-07 | |
| 3tp9_A | 474 | Beta-lactamase and rhodanese domain protein; struc | 1e-08 | |
| 3tp9_A | 474 | Beta-lactamase and rhodanese domain protein; struc | 7e-06 | |
| 1t3k_A | 152 | Arath CDC25, dual-specificity tyrosine phosphatase | 2e-08 | |
| 1t3k_A | 152 | Arath CDC25, dual-specificity tyrosine phosphatase | 2e-05 | |
| 3ilm_A | 141 | ALR3790 protein; rhodanese-like, NSR437H, NESG, st | 5e-08 | |
| 3ilm_A | 141 | ALR3790 protein; rhodanese-like, NSR437H, NESG, st | 2e-06 | |
| 3r2u_A | 466 | Metallo-beta-lactamase family protein; structural | 5e-08 | |
| 3nhv_A | 144 | BH2092 protein; alpha-beta protein, structural gen | 1e-07 | |
| 3nhv_A | 144 | BH2092 protein; alpha-beta protein, structural gen | 1e-06 | |
| 1tq1_A | 129 | AT5G66040, senescence-associated family protein; C | 3e-07 | |
| 1tq1_A | 129 | AT5G66040, senescence-associated family protein; C | 3e-05 | |
| 1gmx_A | 108 | GLPE protein; transferase, rhodanese, sulfurtransf | 6e-07 | |
| 1gmx_A | 108 | GLPE protein; transferase, rhodanese, sulfurtransf | 7e-06 | |
| 3hix_A | 106 | ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q | 1e-06 | |
| 3hix_A | 106 | ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q | 3e-06 | |
| 3ics_A | 588 | Coenzyme A-disulfide reductase; pyridine nucleotid | 1e-06 | |
| 3flh_A | 124 | Uncharacterized protein LP_1913; alpha-beta protei | 2e-06 | |
| 3flh_A | 124 | Uncharacterized protein LP_1913; alpha-beta protei | 6e-04 | |
| 2hhg_A | 139 | Hypothetical protein RPA3614; MCSG, structural gen | 2e-06 | |
| 2j6p_A | 152 | SB(V)-AS(V) reductase; arsenate reductase, antimon | 3e-06 | |
| 1hzm_A | 154 | Dual specificity protein phosphatase 6; hydrolase; | 3e-06 | |
| 2jtq_A | 85 | Phage shock protein E; solution structure rhodanes | 7e-06 | |
| 3f4a_A | 169 | Uncharacterized protein YGR203W; protein phosphata | 1e-05 | |
| 3ntd_A | 565 | FAD-dependent pyridine nucleotide-disulphide oxido | 2e-05 | |
| 2vsw_A | 153 | Dual specificity protein phosphatase 16; hydrolase | 7e-05 | |
| 2k0z_A | 110 | Uncharacterized protein HP1203; A/B domain, struct | 3e-04 | |
| 2k0z_A | 110 | Uncharacterized protein HP1203; A/B domain, struct | 4e-04 | |
| 2gwf_A | 157 | Ubiquitin carboxyl-terminal hydrolase 8; protein-p | 4e-04 | |
| 3eme_A | 103 | Rhodanese-like domain protein; alpha-beta-alpha sa | 4e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 5e-04 | |
| 3tg1_B | 158 | Dual specificity protein phosphatase 10; kinase/rh | 6e-04 | |
| 1whb_A | 157 | KIAA0055; deubiqutinating enzyme, UBPY, structural | 8e-04 |
| >1urh_A 3-mercaptopyruvate sulfurtransferase; rhodanese; 2.8A {Escherichia coli} SCOP: c.46.1.2 c.46.1.2 Length = 280 | Back alignment and structure |
|---|
Score = 440 bits (1134), Expect = e-156
Identities = 112/297 (37%), Positives = 163/297 (54%), Gaps = 23/297 (7%)
Query: 76 PVVSVDWLHANLREPDLKVLDASWYMPD-EQRNPFQEYQVAHIPGALFFDVDGVADRTTN 134
V DWL ++ +P+++++DA P E RN QEY HIPGA+FFD++ ++D T+
Sbjct: 4 WFVGADWLAEHIDDPEIQIIDARMASPGQEDRNVAQEYLNGHIPGAVFFDIEALSDHTSP 63
Query: 135 LPHMLPSEEAFAAAVSALGLENKDGLVVYDGKGIFSAARVWWMFRVFGHDRVWVLDGGLP 194
LPHMLP E FA A+ LG+ L+VYD +FSA R WWM R FG ++V +L GGL
Sbjct: 64 LPHMLPRPETFAVAMRELGVNQDKHLIVYDEGNLFSAPRAWWMLRTFGVEKVSILGGGLA 123
Query: 195 RWRASGYDVESSASGDAILKASAASEAIEKVYQGQVVGPTTFQTKFQPHLIWTLEQVKRN 254
W+ +E A + F F P + + V
Sbjct: 124 GWQRDDLLLEEGAV---------------------ELPEGEFNAAFNPEAVVKVTDVLLA 162
Query: 255 IEEGTYQLVDARSKARFDGDAPEPRKGIRSGHVPGSKCIPFPQMLDASQTLLPADELKKR 314
E T Q++DAR ARF+ + EPR G+R GH+PG+ +P+ +++ L DEL
Sbjct: 163 SHENTAQIIDARPAARFNAEVDEPRPGLRRGHIPGALNVPWTELVR-EGELKTTDELDAI 221
Query: 315 FEQEGISLEKPVVTACGTGVTACILALGLNRLGKHDVAVYDGSWTEWGAQPDTPVET 371
F G+S +KP++ +CG+GVTA ++ L L L +V +YDG+W+EWGA+ D PVE
Sbjct: 222 FFGRGVSYDKPIIVSCGSGVTAAVVLLALATLDVPNVKLYDGAWSEWGARADLPVEP 278
|
| >3olh_A MST, 3-mercaptopyruvate sulfurtransferase; structural genomics, structural genomics consortium, SGC, RH fold; 2.50A {Homo sapiens} Length = 302 | Back alignment and structure |
|---|
| >1rhs_A Sulfur-substituted rhodanese; transferase, sulfurtransferase; 1.36A {Bos taurus} SCOP: c.46.1.2 c.46.1.2 PDB: 1boh_A 1boi_A 1orb_A 2ora_A 1dp2_A* 1rhd_A Length = 296 | Back alignment and structure |
|---|
| >3aay_A Putative thiosulfate sulfurtransferase; sulfurtranserase, structural genomics, PSI, structure initiative; 1.90A {Mycobacterium tuberculosis} PDB: 3aax_A 3hwi_A Length = 277 | Back alignment and structure |
|---|
| >1e0c_A Rhodanese, sulfurtransferase; sulfur metabolism, thiosulfate:cyanide sulfurtransferase; 1.8A {Azotobacter vinelandii} SCOP: c.46.1.2 c.46.1.2 PDB: 1h4k_X 1h4m_X Length = 271 | Back alignment and structure |
|---|
| >1uar_A Rhodanese; sulfurtransferase, riken structural genomics/PROT initiative, RSGI, structural genomics, transferase; 1.70A {Thermus thermophilus} SCOP: c.46.1.2 c.46.1.2 Length = 285 | Back alignment and structure |
|---|
| >1okg_A Possible 3-mercaptopyruvate sulfurtransferase; rhodanese, prolyl isomerase, catalytic triad, serine protease, leishmania pyruvate; HET: CSR; 2.10A {Leishmania major} SCOP: c.46.1.2 c.46.1.2 d.26.1.3 Length = 373 | Back alignment and structure |
|---|
| >3hzu_A Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, infectious disease, transferase structural genomics; 2.10A {Mycobacterium tuberculosis} PDB: 3p3a_A Length = 318 | Back alignment and structure |
|---|
| >2wlr_A Putative thiosulfate sulfurtransferase YNJE; rhodanese domains; HET: EPE; 1.45A {Escherichia coli} PDB: 2wlx_A* 3ipo_A* 3ipp_A Length = 423 | Back alignment and structure |
|---|
| >2wlr_A Putative thiosulfate sulfurtransferase YNJE; rhodanese domains; HET: EPE; 1.45A {Escherichia coli} PDB: 2wlx_A* 3ipo_A* 3ipp_A Length = 423 | Back alignment and structure |
|---|
| >2eg4_A Probable thiosulfate sulfurtransferase; structural genomics, NPPSFA, national Pro protein structural and functional analyses; 1.70A {Thermus thermophilus} PDB: 2eg3_A Length = 230 | Back alignment and structure |
|---|
| >1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Length = 539 | Back alignment and structure |
|---|
| >1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Length = 539 | Back alignment and structure |
|---|
| >1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Length = 539 | Back alignment and structure |
|---|
| >1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Length = 539 | Back alignment and structure |
|---|
| >1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Length = 539 | Back alignment and structure |
|---|
| >3d1p_A Putative thiosulfate sulfurtransferase YOR285W; atomic structure, atomic resolution structure, PSI, MCSG; HET: MSE; 0.98A {Saccharomyces cerevisiae} Length = 139 | Back alignment and structure |
|---|
| >3d1p_A Putative thiosulfate sulfurtransferase YOR285W; atomic structure, atomic resolution structure, PSI, MCSG; HET: MSE; 0.98A {Saccharomyces cerevisiae} Length = 139 | Back alignment and structure |
|---|
| >3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} Length = 474 | Back alignment and structure |
|---|
| >3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} Length = 474 | Back alignment and structure |
|---|
| >1t3k_A Arath CDC25, dual-specificity tyrosine phosphatase; cell cycle, phosphorylation, plant, hydrolase; NMR {Arabidopsis thaliana} SCOP: c.46.1.1 Length = 152 | Back alignment and structure |
|---|
| >1t3k_A Arath CDC25, dual-specificity tyrosine phosphatase; cell cycle, phosphorylation, plant, hydrolase; NMR {Arabidopsis thaliana} SCOP: c.46.1.1 Length = 152 | Back alignment and structure |
|---|
| >3ilm_A ALR3790 protein; rhodanese-like, NSR437H, NESG, structural genomics, protein structure initiative, northeast structural genomics consortium; 2.26A {Nostoc SP} PDB: 2kl3_A Length = 141 | Back alignment and structure |
|---|
| >3ilm_A ALR3790 protein; rhodanese-like, NSR437H, NESG, structural genomics, protein structure initiative, northeast structural genomics consortium; 2.26A {Nostoc SP} PDB: 2kl3_A Length = 141 | Back alignment and structure |
|---|
| >3r2u_A Metallo-beta-lactamase family protein; structural genomics, for structural genomics of infectious diseases, csgid, HYDR; 2.10A {Staphylococcus aureus} Length = 466 | Back alignment and structure |
|---|
| >3nhv_A BH2092 protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.50A {Bacillus halodurans} PDB: 3o3w_A Length = 144 | Back alignment and structure |
|---|
| >3nhv_A BH2092 protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.50A {Bacillus halodurans} PDB: 3o3w_A Length = 144 | Back alignment and structure |
|---|
| >1tq1_A AT5G66040, senescence-associated family protein; CESG, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: c.46.1.3 Length = 129 | Back alignment and structure |
|---|
| >1tq1_A AT5G66040, senescence-associated family protein; CESG, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: c.46.1.3 Length = 129 | Back alignment and structure |
|---|
| >1gmx_A GLPE protein; transferase, rhodanese, sulfurtransferase, glycerol metabolism; 1.1A {Escherichia coli} SCOP: c.46.1.3 PDB: 1gn0_A Length = 108 | Back alignment and structure |
|---|
| >1gmx_A GLPE protein; transferase, rhodanese, sulfurtransferase, glycerol metabolism; 1.1A {Escherichia coli} SCOP: c.46.1.3 PDB: 1gn0_A Length = 108 | Back alignment and structure |
|---|
| >3hix_A ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q8YQN0_anAsp, NSR437I, NESG, structural genomics, PSI-2, protein structure initiative; 1.92A {Anabaena SP} PDB: 3k9r_A Length = 106 | Back alignment and structure |
|---|
| >3hix_A ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q8YQN0_anAsp, NSR437I, NESG, structural genomics, PSI-2, protein structure initiative; 1.92A {Anabaena SP} PDB: 3k9r_A Length = 106 | Back alignment and structure |
|---|
| >3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Length = 588 | Back alignment and structure |
|---|
| >3flh_A Uncharacterized protein LP_1913; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} PDB: 3fnj_A 3i3u_A Length = 124 | Back alignment and structure |
|---|
| >3flh_A Uncharacterized protein LP_1913; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} PDB: 3fnj_A 3i3u_A Length = 124 | Back alignment and structure |
|---|
| >2hhg_A Hypothetical protein RPA3614; MCSG, structural genomics, rohopseudom palustris, PSI-2, protein structure initiative; 1.20A {Rhodopseudomonas palustris} Length = 139 | Back alignment and structure |
|---|
| >2j6p_A SB(V)-AS(V) reductase; arsenate reductase, antimonate reductase, CDC25 phosphatase, rhodanese, C-MYC epitope, oxidoreductase; HET: EPE; 2.15A {Leishmania major} Length = 152 | Back alignment and structure |
|---|
| >1hzm_A Dual specificity protein phosphatase 6; hydrolase; NMR {Homo sapiens} SCOP: c.46.1.1 Length = 154 | Back alignment and structure |
|---|
| >2jtq_A Phage shock protein E; solution structure rhodanese, stress response, transferase; NMR {Escherichia coli} PDB: 2jtr_A 2jts_A Length = 85 | Back alignment and structure |
|---|
| >3f4a_A Uncharacterized protein YGR203W; protein phosphatase, rhodanese-like family, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.80A {Saccharomyces cerevisiae} PDB: 3fs5_A* Length = 169 | Back alignment and structure |
|---|
| >3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Length = 565 | Back alignment and structure |
|---|
| >2vsw_A Dual specificity protein phosphatase 16; hydrolase, dual specificity phosphatase, nucleus, cytoplasm, rhodanese domain, CAsp8; 2.20A {Homo sapiens} PDB: 3tg3_A Length = 153 | Back alignment and structure |
|---|
| >2k0z_A Uncharacterized protein HP1203; A/B domain, structural genomics, unknown function, PSI-2, PR structure initiative; NMR {Helicobacter pylori} Length = 110 | Back alignment and structure |
|---|
| >2k0z_A Uncharacterized protein HP1203; A/B domain, structural genomics, unknown function, PSI-2, PR structure initiative; NMR {Helicobacter pylori} Length = 110 | Back alignment and structure |
|---|
| >2gwf_A Ubiquitin carboxyl-terminal hydrolase 8; protein-protein complex, E3 ligase, protein ubiquitination, hydrolase, protease, UBL conjugation pathway; 2.30A {Homo sapiens} SCOP: c.46.1.4 Length = 157 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3tg1_B Dual specificity protein phosphatase 10; kinase/rhodanese-like domain, docking interaction, transfera hydrolase complex; 2.71A {Homo sapiens} Length = 158 | Back alignment and structure |
|---|
| >1whb_A KIAA0055; deubiqutinating enzyme, UBPY, structural genomics, riken structural genomics/proteomics initiative, RSGI, hydrolase; NMR {Homo sapiens} SCOP: c.46.1.4 Length = 157 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 373 | |||
| 3utn_X | 327 | Thiosulfate sulfurtransferase TUM1; rhodanese-like | 100.0 | |
| 3olh_A | 302 | MST, 3-mercaptopyruvate sulfurtransferase; structu | 100.0 | |
| 1urh_A | 280 | 3-mercaptopyruvate sulfurtransferase; rhodanese; 2 | 100.0 | |
| 1rhs_A | 296 | Sulfur-substituted rhodanese; transferase, sulfurt | 100.0 | |
| 1e0c_A | 271 | Rhodanese, sulfurtransferase; sulfur metabolism, t | 100.0 | |
| 3hzu_A | 318 | Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, | 100.0 | |
| 1uar_A | 285 | Rhodanese; sulfurtransferase, riken structural gen | 100.0 | |
| 3aay_A | 277 | Putative thiosulfate sulfurtransferase; sulfurtran | 100.0 | |
| 1okg_A | 373 | Possible 3-mercaptopyruvate sulfurtransferase; rho | 100.0 | |
| 2wlr_A | 423 | Putative thiosulfate sulfurtransferase YNJE; rhoda | 100.0 | |
| 2wlr_A | 423 | Putative thiosulfate sulfurtransferase YNJE; rhoda | 100.0 | |
| 2eg4_A | 230 | Probable thiosulfate sulfurtransferase; structural | 100.0 | |
| 3tp9_A | 474 | Beta-lactamase and rhodanese domain protein; struc | 100.0 | |
| 1yt8_A | 539 | Thiosulfate sulfurtransferase; rhodanase domains, | 100.0 | |
| 1yt8_A | 539 | Thiosulfate sulfurtransferase; rhodanase domains, | 100.0 | |
| 3r2u_A | 466 | Metallo-beta-lactamase family protein; structural | 99.97 | |
| 3d1p_A | 139 | Putative thiosulfate sulfurtransferase YOR285W; at | 99.9 | |
| 3iwh_A | 103 | Rhodanese-like domain protein; alpha-beta-alpha sa | 99.89 | |
| 3eme_A | 103 | Rhodanese-like domain protein; alpha-beta-alpha sa | 99.89 | |
| 3foj_A | 100 | Uncharacterized protein; protein SSP1007, structur | 99.89 | |
| 3d1p_A | 139 | Putative thiosulfate sulfurtransferase YOR285W; at | 99.88 | |
| 1tq1_A | 129 | AT5G66040, senescence-associated family protein; C | 99.88 | |
| 3gk5_A | 108 | Uncharacterized rhodanese-related protein TVG08686 | 99.88 | |
| 3eme_A | 103 | Rhodanese-like domain protein; alpha-beta-alpha sa | 99.87 | |
| 3foj_A | 100 | Uncharacterized protein; protein SSP1007, structur | 99.87 | |
| 1gmx_A | 108 | GLPE protein; transferase, rhodanese, sulfurtransf | 99.87 | |
| 1qxn_A | 137 | SUD, sulfide dehydrogenase; polysulfide-sulfur tra | 99.87 | |
| 3iwh_A | 103 | Rhodanese-like domain protein; alpha-beta-alpha sa | 99.87 | |
| 3ilm_A | 141 | ALR3790 protein; rhodanese-like, NSR437H, NESG, st | 99.87 | |
| 2hhg_A | 139 | Hypothetical protein RPA3614; MCSG, structural gen | 99.87 | |
| 3hzu_A | 318 | Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, | 99.87 | |
| 1urh_A | 280 | 3-mercaptopyruvate sulfurtransferase; rhodanese; 2 | 99.86 | |
| 3hix_A | 106 | ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q | 99.86 | |
| 3nhv_A | 144 | BH2092 protein; alpha-beta protein, structural gen | 99.86 | |
| 1gmx_A | 108 | GLPE protein; transferase, rhodanese, sulfurtransf | 99.86 | |
| 3gk5_A | 108 | Uncharacterized rhodanese-related protein TVG08686 | 99.85 | |
| 1tq1_A | 129 | AT5G66040, senescence-associated family protein; C | 99.85 | |
| 2k0z_A | 110 | Uncharacterized protein HP1203; A/B domain, struct | 99.85 | |
| 2fsx_A | 148 | RV0390, COG0607: rhodanese-related sulfurtransfera | 99.85 | |
| 1qxn_A | 137 | SUD, sulfide dehydrogenase; polysulfide-sulfur tra | 99.85 | |
| 2hhg_A | 139 | Hypothetical protein RPA3614; MCSG, structural gen | 99.85 | |
| 1e0c_A | 271 | Rhodanese, sulfurtransferase; sulfur metabolism, t | 99.85 | |
| 3ilm_A | 141 | ALR3790 protein; rhodanese-like, NSR437H, NESG, st | 99.84 | |
| 3nhv_A | 144 | BH2092 protein; alpha-beta protein, structural gen | 99.84 | |
| 3hix_A | 106 | ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q | 99.84 | |
| 1wv9_A | 94 | Rhodanese homolog TT1651; CDC25, phosphatase, sulf | 99.84 | |
| 1uar_A | 285 | Rhodanese; sulfurtransferase, riken structural gen | 99.84 | |
| 2k0z_A | 110 | Uncharacterized protein HP1203; A/B domain, struct | 99.83 | |
| 3aay_A | 277 | Putative thiosulfate sulfurtransferase; sulfurtran | 99.83 | |
| 3flh_A | 124 | Uncharacterized protein LP_1913; alpha-beta protei | 99.83 | |
| 1rhs_A | 296 | Sulfur-substituted rhodanese; transferase, sulfurt | 99.82 | |
| 3i2v_A | 127 | Adenylyltransferase and sulfurtransferase MOCS3; r | 99.82 | |
| 3olh_A | 302 | MST, 3-mercaptopyruvate sulfurtransferase; structu | 99.82 | |
| 2jtq_A | 85 | Phage shock protein E; solution structure rhodanes | 99.82 | |
| 3flh_A | 124 | Uncharacterized protein LP_1913; alpha-beta protei | 99.82 | |
| 1t3k_A | 152 | Arath CDC25, dual-specificity tyrosine phosphatase | 99.81 | |
| 1okg_A | 373 | Possible 3-mercaptopyruvate sulfurtransferase; rho | 99.8 | |
| 1t3k_A | 152 | Arath CDC25, dual-specificity tyrosine phosphatase | 99.8 | |
| 2fsx_A | 148 | RV0390, COG0607: rhodanese-related sulfurtransfera | 99.8 | |
| 1wv9_A | 94 | Rhodanese homolog TT1651; CDC25, phosphatase, sulf | 99.8 | |
| 1vee_A | 134 | Proline-rich protein family; hypothetical protein, | 99.79 | |
| 3g5j_A | 134 | Putative ATP/GTP binding protein; N-terminal domai | 99.78 | |
| 3i2v_A | 127 | Adenylyltransferase and sulfurtransferase MOCS3; r | 99.77 | |
| 3g5j_A | 134 | Putative ATP/GTP binding protein; N-terminal domai | 99.77 | |
| 2ouc_A | 142 | Dual specificity protein phosphatase 10; rhodanese | 99.76 | |
| 2vsw_A | 153 | Dual specificity protein phosphatase 16; hydrolase | 99.76 | |
| 1hzm_A | 154 | Dual specificity protein phosphatase 6; hydrolase; | 99.76 | |
| 2jtq_A | 85 | Phage shock protein E; solution structure rhodanes | 99.75 | |
| 4f67_A | 265 | UPF0176 protein LPG2838; structural genomics, PSI- | 99.74 | |
| 2vsw_A | 153 | Dual specificity protein phosphatase 16; hydrolase | 99.74 | |
| 1vee_A | 134 | Proline-rich protein family; hypothetical protein, | 99.73 | |
| 4f67_A | 265 | UPF0176 protein LPG2838; structural genomics, PSI- | 99.73 | |
| 2ouc_A | 142 | Dual specificity protein phosphatase 10; rhodanese | 99.72 | |
| 2j6p_A | 152 | SB(V)-AS(V) reductase; arsenate reductase, antimon | 99.72 | |
| 1hzm_A | 154 | Dual specificity protein phosphatase 6; hydrolase; | 99.72 | |
| 3utn_X | 327 | Thiosulfate sulfurtransferase TUM1; rhodanese-like | 99.72 | |
| 1qb0_A | 211 | Protein (M-phase inducer phosphatase 2 (CDC25B)); | 99.72 | |
| 1qb0_A | 211 | Protein (M-phase inducer phosphatase 2 (CDC25B)); | 99.72 | |
| 2j6p_A | 152 | SB(V)-AS(V) reductase; arsenate reductase, antimon | 99.72 | |
| 2a2k_A | 175 | M-phase inducer phosphatase 2; dual specificity, s | 99.72 | |
| 1c25_A | 161 | CDC25A; hydrolase, cell cycle phosphatase,dual spe | 99.71 | |
| 2a2k_A | 175 | M-phase inducer phosphatase 2; dual specificity, s | 99.71 | |
| 2eg4_A | 230 | Probable thiosulfate sulfurtransferase; structural | 99.7 | |
| 1c25_A | 161 | CDC25A; hydrolase, cell cycle phosphatase,dual spe | 99.7 | |
| 3f4a_A | 169 | Uncharacterized protein YGR203W; protein phosphata | 99.7 | |
| 1whb_A | 157 | KIAA0055; deubiqutinating enzyme, UBPY, structural | 99.68 | |
| 3op3_A | 216 | M-phase inducer phosphatase 3; structural genomics | 99.68 | |
| 3tp9_A | 474 | Beta-lactamase and rhodanese domain protein; struc | 99.68 | |
| 3f4a_A | 169 | Uncharacterized protein YGR203W; protein phosphata | 99.68 | |
| 3tg1_B | 158 | Dual specificity protein phosphatase 10; kinase/rh | 99.68 | |
| 3op3_A | 216 | M-phase inducer phosphatase 3; structural genomics | 99.67 | |
| 3tg1_B | 158 | Dual specificity protein phosphatase 10; kinase/rh | 99.64 | |
| 2gwf_A | 157 | Ubiquitin carboxyl-terminal hydrolase 8; protein-p | 99.64 | |
| 3ics_A | 588 | Coenzyme A-disulfide reductase; pyridine nucleotid | 99.61 | |
| 3ntd_A | 565 | FAD-dependent pyridine nucleotide-disulphide oxido | 99.59 | |
| 1whb_A | 157 | KIAA0055; deubiqutinating enzyme, UBPY, structural | 99.56 | |
| 2gwf_A | 157 | Ubiquitin carboxyl-terminal hydrolase 8; protein-p | 99.54 | |
| 3ntd_A | 565 | FAD-dependent pyridine nucleotide-disulphide oxido | 99.52 | |
| 3ics_A | 588 | Coenzyme A-disulfide reductase; pyridine nucleotid | 99.47 | |
| 3r2u_A | 466 | Metallo-beta-lactamase family protein; structural | 99.44 | |
| 2f46_A | 156 | Hypothetical protein; structural genomics, joint c | 97.44 | |
| 2f46_A | 156 | Hypothetical protein; structural genomics, joint c | 96.78 | |
| 4erc_A | 150 | Dual specificity protein phosphatase 23; alpha bet | 91.09 | |
| 1xri_A | 151 | AT1G05000; structural genomics, protein structure | 89.71 | |
| 2img_A | 151 | Dual specificity protein phosphatase 23; DUSP23, V | 86.41 | |
| 1v8c_A | 168 | MOAD related protein; riken structural genomics/pr | 81.82 | |
| 4erc_A | 150 | Dual specificity protein phosphatase 23; alpha bet | 80.38 |
| >3utn_X Thiosulfate sulfurtransferase TUM1; rhodanese-like domain; 1.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
Probab=100.00 E-value=4.9e-59 Score=445.58 Aligned_cols=273 Identities=32% Similarity=0.627 Sum_probs=235.7
Q ss_pred CcccHHHHHHhcCCC---CeEEEEeecCCCCCCCCChhhh-hhCCCcCceecCcccccccCCCCCCCCCCHHHHHHHHHH
Q 017338 76 PVVSVDWLHANLREP---DLKVLDASWYMPDEQRNPFQEY-QVAHIPGALFFDVDGVADRTTNLPHMLPSEEAFAAAVSA 151 (373)
Q Consensus 76 ~~is~~~l~~~l~~~---~~~iiDvR~~~~~~~r~~~~ey-~~gHIpGAi~ip~~~l~~~~~~~~~~l~~~e~~~~~l~~ 151 (373)
.+|||++|.++++.+ .+++||++|+||+..|++..|| ++||||||++++++.+.+..+++++|||++++|++.|+.
T Consensus 28 ~LIsp~~l~~ll~~~~~~rvv~lDasw~lP~~~r~~~~E~~~~~HIPGAv~~Dld~~~d~~~~~ph~LP~~~~f~~~l~~ 107 (327)
T 3utn_X 28 DLISPKAFVKLVASEKVHRIVPVDATWYLPSWKLDNKVDFLTKPRIPNSIFFDIDAISDKKSPYPHMFPTKKVFDDAMSN 107 (327)
T ss_dssp EEECHHHHHHHHHHCSSSCEEEEECCCCCGGGCCCHHHHHHHSCBCTTCEECCTTTSSCTTSSSTTCCCCHHHHHHHHHH
T ss_pred cccCHHHHHHHHhCCCCCcEEEEEecCCCCCCCCCHHHHHHhhCcCCCCeeeChHHhcCCCCCCCCCCcCHHHHHHHHHH
Confidence 489999999998643 4899999999999999998898 679999999999999999999999999999999999999
Q ss_pred cCCCCCCeEEEEcCCCCchHHHHHHHHHHcCCCceEEecCCHHHHHhCCCCcccCCCcchhHhhhhhHHHHHHhhcCccc
Q 017338 152 LGLENKDGLVVYDGKGIFSAARVWWMFRVFGHDRVWVLDGGLPRWRASGYDVESSASGDAILKASAASEAIEKVYQGQVV 231 (373)
Q Consensus 152 ~gi~~~~~VVvy~~~g~~~a~ra~~~L~~~G~~~v~~L~GG~~~W~~~g~pv~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 231 (373)
+||+++++|||||+.+...|+|+||+|+++||++|++|||| .+|+++|+|++++..... .....
T Consensus 108 lGI~~d~~VVvYD~~~~~~AaR~wW~Lr~~Gh~~V~vLdGg-~aW~~~g~p~~~~~~~~~---------------~p~p~ 171 (327)
T 3utn_X 108 LGVQKDDILVVYDRVGNFSSPRCAWTLGVMGHPKVYLLNNF-NQYREFKYPLDSSKVAAF---------------SPYPK 171 (327)
T ss_dssp TTCCTTCEEEEECSSSSSSHHHHHHHHHHTTCSEEEEESCH-HHHHHTTCCCBCCCCSCS---------------CSSCC
T ss_pred cCCCCCCEEEEEeCCCCcHHHHHHHHHHHcCCCceeecccH-HHHHHhCCCcccCCccCc---------------CCcCC
Confidence 99999999999999888889999999999999999999987 899999999998753210 00001
Q ss_pred CCcceeeccCCccccCHHHHHHHhhCC----CcEEEEecCCCccCCCCCCCCCCCCcccCCCCcccCcccccccCCCCC-
Q 017338 232 GPTTFQTKFQPHLIWTLEQVKRNIEEG----TYQLVDARSKARFDGDAPEPRKGIRSGHVPGSKCIPFPQMLDASQTLL- 306 (373)
Q Consensus 232 ~~~~~~~~~~~~~~is~~el~~~~~~~----~~~iIDvR~~~e~~G~~~~~~~~~~~GhIpGA~~ip~~~l~~~~~~~~- 306 (373)
....+...+++..+++.+++.+.++++ +++|||+|++++|.|+.++|+.+.+.||||||+|+||.++.+.++.++
T Consensus 172 ~~~~~~~~~~~~~v~~~~~v~~~v~~~~~~~~~~lvDaRs~~rf~G~~~ep~~~~r~GHIPGA~nlP~~~~ld~~~~~~~ 251 (327)
T 3utn_X 172 SHYESSESFQDKEIVDYEEMFQLVKSGELAKKFNAFDARSLGRFEGTEPEPRSDIPSGHIPGTQPLPYGSLLDPETKTYP 251 (327)
T ss_dssp CCCCCSCCCHHHHEECHHHHHHHHHTTCHHHHCEEEECSCHHHHHTSSCCSSSSCCCCBCTTEEECCGGGGSCTTTCCCC
T ss_pred cccccccccCchheecHHHHhhhhhcccccccceeeccCccceecccccCccccccCCCCCCCcccChhhccCCCCCCCC
Confidence 112344456677889999999988753 478999999999999999998888899999999999999998776543
Q ss_pred -CHHHHHHHHHH------cCCCCCCcEEEEcCCchHHHHHHHHHHHcCCCCceeecccHHHHhcC
Q 017338 307 -PADELKKRFEQ------EGISLEKPVVTACGTGVTACILALGLNRLGKHDVAVYDGSWTEWGAQ 364 (373)
Q Consensus 307 -~~~~l~~~~~~------~gi~~~~~IvvyC~~G~ra~~a~~~L~~~G~~~v~~~~GG~~~W~~~ 364 (373)
+.+++++.+++ .|++++++||+||++|++|+.++++|+.+||++|++|||||.||..+
T Consensus 252 ~~~e~l~~~l~~~~~~~~~gid~~k~vI~yCgsGvtA~~~~laL~~lG~~~v~lYdGSWsEW~~r 316 (327)
T 3utn_X 252 EAGEAIHATLEKALKDFHCTLDPSKPTICSCGTGVSGVIIKTALELAGVPNVRLYDGSWTEWVLK 316 (327)
T ss_dssp CTTHHHHHHHHHHHHHTTCCCCTTSCEEEECSSSHHHHHHHHHHHHTTCCSEEEESSHHHHHHHH
T ss_pred CcHHHHHHHHHHHHHHhhcCCCCCCCEEEECChHHHHHHHHHHHHHcCCCCceeCCCcHHHhccc
Confidence 33555555543 38999999999999999999999999999999999999999999876
|
| >3olh_A MST, 3-mercaptopyruvate sulfurtransferase; structural genomics, structural genomics consortium, SGC, RH fold; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1urh_A 3-mercaptopyruvate sulfurtransferase; rhodanese; 2.8A {Escherichia coli} SCOP: c.46.1.2 c.46.1.2 | Back alignment and structure |
|---|
| >1rhs_A Sulfur-substituted rhodanese; transferase, sulfurtransferase; 1.36A {Bos taurus} SCOP: c.46.1.2 c.46.1.2 PDB: 1boh_A 1boi_A 1orb_A 2ora_A 1dp2_A* 1rhd_A | Back alignment and structure |
|---|
| >1e0c_A Rhodanese, sulfurtransferase; sulfur metabolism, thiosulfate:cyanide sulfurtransferase; 1.8A {Azotobacter vinelandii} SCOP: c.46.1.2 c.46.1.2 PDB: 1h4k_X 1h4m_X | Back alignment and structure |
|---|
| >3hzu_A Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, infectious disease, transferase structural genomics; 2.10A {Mycobacterium tuberculosis} PDB: 3p3a_A | Back alignment and structure |
|---|
| >1uar_A Rhodanese; sulfurtransferase, riken structural genomics/PROT initiative, RSGI, structural genomics, transferase; 1.70A {Thermus thermophilus} SCOP: c.46.1.2 c.46.1.2 | Back alignment and structure |
|---|
| >3aay_A Putative thiosulfate sulfurtransferase; sulfurtranserase, structural genomics, PSI, structure initiative; 1.90A {Mycobacterium tuberculosis} PDB: 3aax_A 3hwi_A | Back alignment and structure |
|---|
| >1okg_A Possible 3-mercaptopyruvate sulfurtransferase; rhodanese, prolyl isomerase, catalytic triad, serine protease, leishmania pyruvate; HET: CSR; 2.10A {Leishmania major} SCOP: c.46.1.2 c.46.1.2 d.26.1.3 | Back alignment and structure |
|---|
| >2wlr_A Putative thiosulfate sulfurtransferase YNJE; rhodanese domains; HET: EPE; 1.45A {Escherichia coli} PDB: 2wlx_A* 3ipo_A* 3ipp_A | Back alignment and structure |
|---|
| >2wlr_A Putative thiosulfate sulfurtransferase YNJE; rhodanese domains; HET: EPE; 1.45A {Escherichia coli} PDB: 2wlx_A* 3ipo_A* 3ipp_A | Back alignment and structure |
|---|
| >2eg4_A Probable thiosulfate sulfurtransferase; structural genomics, NPPSFA, national Pro protein structural and functional analyses; 1.70A {Thermus thermophilus} PDB: 2eg3_A | Back alignment and structure |
|---|
| >3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 | Back alignment and structure |
|---|
| >1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 | Back alignment and structure |
|---|
| >3r2u_A Metallo-beta-lactamase family protein; structural genomics, for structural genomics of infectious diseases, csgid, HYDR; 2.10A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3d1p_A Putative thiosulfate sulfurtransferase YOR285W; atomic structure, atomic resolution structure, PSI, MCSG; HET: MSE; 0.98A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3iwh_A Rhodanese-like domain protein; alpha-beta-alpha sandwich, structural genomics, C structural genomics of infectious diseases, csgid; 2.00A {Staphylococcus aureus subsp} PDB: 3mzz_A | Back alignment and structure |
|---|
| >3foj_A Uncharacterized protein; protein SSP1007, structural genomics, PSI-2, protein structure initiative; 1.60A {Staphylococcus saprophyticus subsp} | Back alignment and structure |
|---|
| >3d1p_A Putative thiosulfate sulfurtransferase YOR285W; atomic structure, atomic resolution structure, PSI, MCSG; HET: MSE; 0.98A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1tq1_A AT5G66040, senescence-associated family protein; CESG, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: c.46.1.3 | Back alignment and structure |
|---|
| >3gk5_A Uncharacterized rhodanese-related protein TVG0868615; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Thermoplasma volcanium GSS1} | Back alignment and structure |
|---|
| >3foj_A Uncharacterized protein; protein SSP1007, structural genomics, PSI-2, protein structure initiative; 1.60A {Staphylococcus saprophyticus subsp} | Back alignment and structure |
|---|
| >1gmx_A GLPE protein; transferase, rhodanese, sulfurtransferase, glycerol metabolism; 1.1A {Escherichia coli} SCOP: c.46.1.3 PDB: 1gn0_A | Back alignment and structure |
|---|
| >1qxn_A SUD, sulfide dehydrogenase; polysulfide-sulfur transferase, homodimer; NMR {Wolinella succinogenes} SCOP: c.46.1.3 | Back alignment and structure |
|---|
| >3iwh_A Rhodanese-like domain protein; alpha-beta-alpha sandwich, structural genomics, C structural genomics of infectious diseases, csgid; 2.00A {Staphylococcus aureus subsp} PDB: 3mzz_A | Back alignment and structure |
|---|
| >3ilm_A ALR3790 protein; rhodanese-like, NSR437H, NESG, structural genomics, protein structure initiative, northeast structural genomics consortium; 2.26A {Nostoc SP} PDB: 2kl3_A | Back alignment and structure |
|---|
| >2hhg_A Hypothetical protein RPA3614; MCSG, structural genomics, rohopseudom palustris, PSI-2, protein structure initiative; 1.20A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3hzu_A Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, infectious disease, transferase structural genomics; 2.10A {Mycobacterium tuberculosis} PDB: 3p3a_A | Back alignment and structure |
|---|
| >1urh_A 3-mercaptopyruvate sulfurtransferase; rhodanese; 2.8A {Escherichia coli} SCOP: c.46.1.2 c.46.1.2 | Back alignment and structure |
|---|
| >3hix_A ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q8YQN0_anAsp, NSR437I, NESG, structural genomics, PSI-2, protein structure initiative; 1.92A {Anabaena SP} PDB: 3k9r_A | Back alignment and structure |
|---|
| >3nhv_A BH2092 protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.50A {Bacillus halodurans} PDB: 3o3w_A | Back alignment and structure |
|---|
| >1gmx_A GLPE protein; transferase, rhodanese, sulfurtransferase, glycerol metabolism; 1.1A {Escherichia coli} SCOP: c.46.1.3 PDB: 1gn0_A | Back alignment and structure |
|---|
| >3gk5_A Uncharacterized rhodanese-related protein TVG0868615; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Thermoplasma volcanium GSS1} | Back alignment and structure |
|---|
| >1tq1_A AT5G66040, senescence-associated family protein; CESG, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: c.46.1.3 | Back alignment and structure |
|---|
| >2k0z_A Uncharacterized protein HP1203; A/B domain, structural genomics, unknown function, PSI-2, PR structure initiative; NMR {Helicobacter pylori} | Back alignment and structure |
|---|
| >2fsx_A RV0390, COG0607: rhodanese-related sulfurtransferase; RV0390 BR SAD DATA with FBAR, structural genomics, PSI; 1.80A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1qxn_A SUD, sulfide dehydrogenase; polysulfide-sulfur transferase, homodimer; NMR {Wolinella succinogenes} SCOP: c.46.1.3 | Back alignment and structure |
|---|
| >2hhg_A Hypothetical protein RPA3614; MCSG, structural genomics, rohopseudom palustris, PSI-2, protein structure initiative; 1.20A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >1e0c_A Rhodanese, sulfurtransferase; sulfur metabolism, thiosulfate:cyanide sulfurtransferase; 1.8A {Azotobacter vinelandii} SCOP: c.46.1.2 c.46.1.2 PDB: 1h4k_X 1h4m_X | Back alignment and structure |
|---|
| >3ilm_A ALR3790 protein; rhodanese-like, NSR437H, NESG, structural genomics, protein structure initiative, northeast structural genomics consortium; 2.26A {Nostoc SP} PDB: 2kl3_A | Back alignment and structure |
|---|
| >3nhv_A BH2092 protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.50A {Bacillus halodurans} PDB: 3o3w_A | Back alignment and structure |
|---|
| >3hix_A ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q8YQN0_anAsp, NSR437I, NESG, structural genomics, PSI-2, protein structure initiative; 1.92A {Anabaena SP} PDB: 3k9r_A | Back alignment and structure |
|---|
| >1wv9_A Rhodanese homolog TT1651; CDC25, phosphatase, sulfurtransferase, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1uar_A Rhodanese; sulfurtransferase, riken structural genomics/PROT initiative, RSGI, structural genomics, transferase; 1.70A {Thermus thermophilus} SCOP: c.46.1.2 c.46.1.2 | Back alignment and structure |
|---|
| >2k0z_A Uncharacterized protein HP1203; A/B domain, structural genomics, unknown function, PSI-2, PR structure initiative; NMR {Helicobacter pylori} | Back alignment and structure |
|---|
| >3aay_A Putative thiosulfate sulfurtransferase; sulfurtranserase, structural genomics, PSI, structure initiative; 1.90A {Mycobacterium tuberculosis} PDB: 3aax_A 3hwi_A | Back alignment and structure |
|---|
| >3flh_A Uncharacterized protein LP_1913; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} PDB: 3fnj_A 3i3u_A | Back alignment and structure |
|---|
| >1rhs_A Sulfur-substituted rhodanese; transferase, sulfurtransferase; 1.36A {Bos taurus} SCOP: c.46.1.2 c.46.1.2 PDB: 1boh_A 1boi_A 1orb_A 2ora_A 1dp2_A* 1rhd_A | Back alignment and structure |
|---|
| >3i2v_A Adenylyltransferase and sulfurtransferase MOCS3; rhodanese, UBA4, structural genomics, ubiquitin biology, structural genomics consortium, SGC; 1.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3olh_A MST, 3-mercaptopyruvate sulfurtransferase; structural genomics, structural genomics consortium, SGC, RH fold; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2jtq_A Phage shock protein E; solution structure rhodanese, stress response, transferase; NMR {Escherichia coli} PDB: 2jtr_A 2jts_A | Back alignment and structure |
|---|
| >3flh_A Uncharacterized protein LP_1913; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} PDB: 3fnj_A 3i3u_A | Back alignment and structure |
|---|
| >1t3k_A Arath CDC25, dual-specificity tyrosine phosphatase; cell cycle, phosphorylation, plant, hydrolase; NMR {Arabidopsis thaliana} SCOP: c.46.1.1 | Back alignment and structure |
|---|
| >1okg_A Possible 3-mercaptopyruvate sulfurtransferase; rhodanese, prolyl isomerase, catalytic triad, serine protease, leishmania pyruvate; HET: CSR; 2.10A {Leishmania major} SCOP: c.46.1.2 c.46.1.2 d.26.1.3 | Back alignment and structure |
|---|
| >1t3k_A Arath CDC25, dual-specificity tyrosine phosphatase; cell cycle, phosphorylation, plant, hydrolase; NMR {Arabidopsis thaliana} SCOP: c.46.1.1 | Back alignment and structure |
|---|
| >2fsx_A RV0390, COG0607: rhodanese-related sulfurtransferase; RV0390 BR SAD DATA with FBAR, structural genomics, PSI; 1.80A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1wv9_A Rhodanese homolog TT1651; CDC25, phosphatase, sulfurtransferase, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1vee_A Proline-rich protein family; hypothetical protein, structural genomics, rhodanese domain, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} PDB: 2dcq_A | Back alignment and structure |
|---|
| >3g5j_A Putative ATP/GTP binding protein; N-terminal domain of ATP/GTP binding protein, PSI, MCSG, STR genomics, protein structure initiative; HET: PGE; 1.76A {Clostridium difficile} | Back alignment and structure |
|---|
| >3i2v_A Adenylyltransferase and sulfurtransferase MOCS3; rhodanese, UBA4, structural genomics, ubiquitin biology, structural genomics consortium, SGC; 1.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3g5j_A Putative ATP/GTP binding protein; N-terminal domain of ATP/GTP binding protein, PSI, MCSG, STR genomics, protein structure initiative; HET: PGE; 1.76A {Clostridium difficile} | Back alignment and structure |
|---|
| >2ouc_A Dual specificity protein phosphatase 10; rhodanese fold, hydrolase; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2vsw_A Dual specificity protein phosphatase 16; hydrolase, dual specificity phosphatase, nucleus, cytoplasm, rhodanese domain, CAsp8; 2.20A {Homo sapiens} PDB: 3tg3_A | Back alignment and structure |
|---|
| >1hzm_A Dual specificity protein phosphatase 6; hydrolase; NMR {Homo sapiens} SCOP: c.46.1.1 | Back alignment and structure |
|---|
| >2jtq_A Phage shock protein E; solution structure rhodanese, stress response, transferase; NMR {Escherichia coli} PDB: 2jtr_A 2jts_A | Back alignment and structure |
|---|
| >4f67_A UPF0176 protein LPG2838; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium; 1.79A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >2vsw_A Dual specificity protein phosphatase 16; hydrolase, dual specificity phosphatase, nucleus, cytoplasm, rhodanese domain, CAsp8; 2.20A {Homo sapiens} PDB: 3tg3_A | Back alignment and structure |
|---|
| >1vee_A Proline-rich protein family; hypothetical protein, structural genomics, rhodanese domain, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} PDB: 2dcq_A | Back alignment and structure |
|---|
| >4f67_A UPF0176 protein LPG2838; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium; 1.79A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >2ouc_A Dual specificity protein phosphatase 10; rhodanese fold, hydrolase; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2j6p_A SB(V)-AS(V) reductase; arsenate reductase, antimonate reductase, CDC25 phosphatase, rhodanese, C-MYC epitope, oxidoreductase; HET: EPE; 2.15A {Leishmania major} | Back alignment and structure |
|---|
| >1hzm_A Dual specificity protein phosphatase 6; hydrolase; NMR {Homo sapiens} SCOP: c.46.1.1 | Back alignment and structure |
|---|
| >3utn_X Thiosulfate sulfurtransferase TUM1; rhodanese-like domain; 1.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1qb0_A Protein (M-phase inducer phosphatase 2 (CDC25B)); hydrolase, cell cycle phosphatase, dual specificity protein phosphatase; 1.91A {Homo sapiens} SCOP: c.46.1.1 PDB: 1cwr_A 1cws_A 2uzq_A | Back alignment and structure |
|---|
| >1qb0_A Protein (M-phase inducer phosphatase 2 (CDC25B)); hydrolase, cell cycle phosphatase, dual specificity protein phosphatase; 1.91A {Homo sapiens} SCOP: c.46.1.1 PDB: 1cwr_A 1cws_A 2uzq_A | Back alignment and structure |
|---|
| >2j6p_A SB(V)-AS(V) reductase; arsenate reductase, antimonate reductase, CDC25 phosphatase, rhodanese, C-MYC epitope, oxidoreductase; HET: EPE; 2.15A {Leishmania major} | Back alignment and structure |
|---|
| >2a2k_A M-phase inducer phosphatase 2; dual specificity, substrate trapping, active site mutant, hydrolase; 1.52A {Homo sapiens} PDB: 2ifv_A 1ymd_A 1ym9_A 1ymk_A 1yml_A 1ys0_A 1cwt_A 2ifd_A | Back alignment and structure |
|---|
| >1c25_A CDC25A; hydrolase, cell cycle phosphatase,dual specificity protein phosphatase, CDK2; 2.30A {Homo sapiens} SCOP: c.46.1.1 | Back alignment and structure |
|---|
| >2a2k_A M-phase inducer phosphatase 2; dual specificity, substrate trapping, active site mutant, hydrolase; 1.52A {Homo sapiens} PDB: 2ifv_A 1ymd_A 1ym9_A 1ymk_A 1yml_A 1ys0_A 1cwt_A 2ifd_A | Back alignment and structure |
|---|
| >2eg4_A Probable thiosulfate sulfurtransferase; structural genomics, NPPSFA, national Pro protein structural and functional analyses; 1.70A {Thermus thermophilus} PDB: 2eg3_A | Back alignment and structure |
|---|
| >1c25_A CDC25A; hydrolase, cell cycle phosphatase,dual specificity protein phosphatase, CDK2; 2.30A {Homo sapiens} SCOP: c.46.1.1 | Back alignment and structure |
|---|
| >3f4a_A Uncharacterized protein YGR203W; protein phosphatase, rhodanese-like family, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.80A {Saccharomyces cerevisiae} PDB: 3fs5_A* | Back alignment and structure |
|---|
| >1whb_A KIAA0055; deubiqutinating enzyme, UBPY, structural genomics, riken structural genomics/proteomics initiative, RSGI, hydrolase; NMR {Homo sapiens} SCOP: c.46.1.4 | Back alignment and structure |
|---|
| >3op3_A M-phase inducer phosphatase 3; structural genomics, structural genomics consortium, SGC, Al alpha sandwich, kinase, cytosol, hydrolase; 2.63A {Homo sapiens} | Back alignment and structure |
|---|
| >3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >3f4a_A Uncharacterized protein YGR203W; protein phosphatase, rhodanese-like family, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.80A {Saccharomyces cerevisiae} PDB: 3fs5_A* | Back alignment and structure |
|---|
| >3tg1_B Dual specificity protein phosphatase 10; kinase/rhodanese-like domain, docking interaction, transfera hydrolase complex; 2.71A {Homo sapiens} | Back alignment and structure |
|---|
| >3op3_A M-phase inducer phosphatase 3; structural genomics, structural genomics consortium, SGC, Al alpha sandwich, kinase, cytosol, hydrolase; 2.63A {Homo sapiens} | Back alignment and structure |
|---|
| >3tg1_B Dual specificity protein phosphatase 10; kinase/rhodanese-like domain, docking interaction, transfera hydrolase complex; 2.71A {Homo sapiens} | Back alignment and structure |
|---|
| >2gwf_A Ubiquitin carboxyl-terminal hydrolase 8; protein-protein complex, E3 ligase, protein ubiquitination, hydrolase, protease, UBL conjugation pathway; 2.30A {Homo sapiens} SCOP: c.46.1.4 | Back alignment and structure |
|---|
| >3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* | Back alignment and structure |
|---|
| >3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* | Back alignment and structure |
|---|
| >1whb_A KIAA0055; deubiqutinating enzyme, UBPY, structural genomics, riken structural genomics/proteomics initiative, RSGI, hydrolase; NMR {Homo sapiens} SCOP: c.46.1.4 | Back alignment and structure |
|---|
| >2gwf_A Ubiquitin carboxyl-terminal hydrolase 8; protein-protein complex, E3 ligase, protein ubiquitination, hydrolase, protease, UBL conjugation pathway; 2.30A {Homo sapiens} SCOP: c.46.1.4 | Back alignment and structure |
|---|
| >3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* | Back alignment and structure |
|---|
| >3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* | Back alignment and structure |
|---|
| >3r2u_A Metallo-beta-lactamase family protein; structural genomics, for structural genomics of infectious diseases, csgid, HYDR; 2.10A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2f46_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 1.41A {Neisseria meningitidis Z2491} | Back alignment and structure |
|---|
| >2f46_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 1.41A {Neisseria meningitidis Z2491} | Back alignment and structure |
|---|
| >4erc_A Dual specificity protein phosphatase 23; alpha beta, phosphatase(hydrolase), hydrolase; 1.15A {Homo sapiens} PDB: 2img_A | Back alignment and structure |
|---|
| >1xri_A AT1G05000; structural genomics, protein structure initiative, CESG for eukaryotic structural genomics, phosphoprote phosphatase; 3.30A {Arabidopsis thaliana} SCOP: c.45.1.1 PDB: 2q47_A | Back alignment and structure |
|---|
| >2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} | Back alignment and structure |
|---|
| >1v8c_A MOAD related protein; riken structural genomics/proteomics initiative, RSGI, structural genomics, protein binding; 1.60A {Thermus thermophilus} SCOP: d.15.3.1 d.129.5.1 | Back alignment and structure |
|---|
| >4erc_A Dual specificity protein phosphatase 23; alpha beta, phosphatase(hydrolase), hydrolase; 1.15A {Homo sapiens} PDB: 2img_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 373 | ||||
| d1okga1 | 156 | c.46.1.2 (A:7-162) 3-mercaptopyruvate sulfurtransf | 1e-35 | |
| d1okga1 | 156 | c.46.1.2 (A:7-162) 3-mercaptopyruvate sulfurtransf | 0.002 | |
| d1rhsa2 | 144 | c.46.1.2 (A:150-293) Rhodanese {Cow (Bos taurus) [ | 2e-35 | |
| d1rhsa2 | 144 | c.46.1.2 (A:150-293) Rhodanese {Cow (Bos taurus) [ | 8e-08 | |
| d1rhsa1 | 149 | c.46.1.2 (A:1-149) Rhodanese {Cow (Bos taurus) [Ta | 5e-34 | |
| d1rhsa1 | 149 | c.46.1.2 (A:1-149) Rhodanese {Cow (Bos taurus) [Ta | 0.001 | |
| d1urha1 | 147 | c.46.1.2 (A:2-148) 3-mercaptopyruvate sulfurtransf | 1e-32 | |
| d1urha1 | 147 | c.46.1.2 (A:2-148) 3-mercaptopyruvate sulfurtransf | 2e-08 | |
| d1okga2 | 139 | c.46.1.2 (A:163-301) 3-mercaptopyruvate sulfurtran | 1e-29 | |
| d1okga2 | 139 | c.46.1.2 (A:163-301) 3-mercaptopyruvate sulfurtran | 4e-07 | |
| d1uara2 | 141 | c.46.1.2 (A:145-285) Sulfurtransferase {Thermus th | 5e-28 | |
| d1uara2 | 141 | c.46.1.2 (A:145-285) Sulfurtransferase {Thermus th | 4e-07 | |
| d1urha2 | 120 | c.46.1.2 (A:149-268) 3-mercaptopyruvate sulfurtran | 2e-27 | |
| d1urha2 | 120 | c.46.1.2 (A:149-268) 3-mercaptopyruvate sulfurtran | 2e-06 | |
| d1e0ca2 | 136 | c.46.1.2 (A:136-271) Sulfurtransferase {Azotobacte | 2e-25 | |
| d1e0ca2 | 136 | c.46.1.2 (A:136-271) Sulfurtransferase {Azotobacte | 7e-12 | |
| d1uara1 | 143 | c.46.1.2 (A:2-144) Sulfurtransferase {Thermus ther | 9e-24 | |
| d1uara1 | 143 | c.46.1.2 (A:2-144) Sulfurtransferase {Thermus ther | 1e-07 | |
| d1hzma_ | 154 | c.46.1.1 (A:) Erk2 binding domain of Mapk phosphat | 5e-16 | |
| d1hzma_ | 154 | c.46.1.1 (A:) Erk2 binding domain of Mapk phosphat | 0.003 | |
| d1e0ca1 | 135 | c.46.1.2 (A:1-135) Sulfurtransferase {Azotobacter | 8e-14 | |
| d1e0ca1 | 135 | c.46.1.2 (A:1-135) Sulfurtransferase {Azotobacter | 5e-06 | |
| d2gwfa1 | 135 | c.46.1.4 (A:181-315) Ubiquitin carboxyl-terminal h | 7e-10 | |
| d1gmxa_ | 108 | c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia | 4e-09 | |
| d1gmxa_ | 108 | c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia | 7e-09 | |
| d1tq1a_ | 119 | c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senesc | 1e-08 | |
| d1tq1a_ | 119 | c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senesc | 4e-06 | |
| d1yt8a3 | 157 | c.46.1.2 (A:373-529) Thiosulfate sulfurtransferase | 4e-08 | |
| d1yt8a2 | 101 | c.46.1.2 (A:6-106) Thiosulfate sulfurtransferase P | 1e-07 | |
| d1t3ka_ | 132 | c.46.1.1 (A:) Dual specificity phosphatase Cdc25 { | 2e-07 | |
| d1yt8a1 | 136 | c.46.1.2 (A:107-242) Thiosulfate sulfurtransferase | 5e-07 | |
| d1c25a_ | 161 | c.46.1.1 (A:) CDC25a {Human (Homo sapiens) [TaxId: | 0.003 |
| >d1okga1 c.46.1.2 (A:7-162) 3-mercaptopyruvate sulfurtransferase {Leishmania major [TaxId: 5664]} Length = 156 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Rhodanese/Cell cycle control phosphatase superfamily: Rhodanese/Cell cycle control phosphatase family: Multidomain sulfurtransferase (rhodanese) domain: 3-mercaptopyruvate sulfurtransferase species: Leishmania major [TaxId: 5664]
Score = 125 bits (315), Expect = 1e-35
Identities = 32/137 (23%), Positives = 62/137 (45%), Gaps = 8/137 (5%)
Query: 73 PKEPVVSVDWLHANLREPDLKVLDASWYMPDEQRNPFQEYQVAHIPGALFFDVDGVADR- 131
P + + + +L + +++D + + + + +Y H+ A+ DVD +
Sbjct: 5 PGKVFLDPSEVADHLA--EYRIVDCRYSLKIK-DHGSIQYAKEHVKSAIRADVDTNLSKL 61
Query: 132 --TTNLPHMLPSEEAFAAAVSALGLENKDGLVVYDGK-GIFSAARVWWMFRVFGHDRVWV 188
T+ H LP F A G+ + ++ YD + G R+WWM G D +V
Sbjct: 62 VPTSTARHPLPPCAEFIDWCMANGMAGELPVLCYDDECGAMGGCRLWWMLNSLGAD-AYV 120
Query: 189 LDGGLPRWRASGYDVES 205
++GG +A+G ++ES
Sbjct: 121 INGGFQACKAAGLEMES 137
|
| >d1okga1 c.46.1.2 (A:7-162) 3-mercaptopyruvate sulfurtransferase {Leishmania major [TaxId: 5664]} Length = 156 | Back information, alignment and structure |
|---|
| >d1rhsa2 c.46.1.2 (A:150-293) Rhodanese {Cow (Bos taurus) [TaxId: 9913]} Length = 144 | Back information, alignment and structure |
|---|
| >d1rhsa2 c.46.1.2 (A:150-293) Rhodanese {Cow (Bos taurus) [TaxId: 9913]} Length = 144 | Back information, alignment and structure |
|---|
| >d1rhsa1 c.46.1.2 (A:1-149) Rhodanese {Cow (Bos taurus) [TaxId: 9913]} Length = 149 | Back information, alignment and structure |
|---|
| >d1rhsa1 c.46.1.2 (A:1-149) Rhodanese {Cow (Bos taurus) [TaxId: 9913]} Length = 149 | Back information, alignment and structure |
|---|
| >d1urha1 c.46.1.2 (A:2-148) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} Length = 147 | Back information, alignment and structure |
|---|
| >d1urha1 c.46.1.2 (A:2-148) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} Length = 147 | Back information, alignment and structure |
|---|
| >d1okga2 c.46.1.2 (A:163-301) 3-mercaptopyruvate sulfurtransferase {Leishmania major [TaxId: 5664]} Length = 139 | Back information, alignment and structure |
|---|
| >d1okga2 c.46.1.2 (A:163-301) 3-mercaptopyruvate sulfurtransferase {Leishmania major [TaxId: 5664]} Length = 139 | Back information, alignment and structure |
|---|
| >d1uara2 c.46.1.2 (A:145-285) Sulfurtransferase {Thermus thermophilus [TaxId: 274]} Length = 141 | Back information, alignment and structure |
|---|
| >d1uara2 c.46.1.2 (A:145-285) Sulfurtransferase {Thermus thermophilus [TaxId: 274]} Length = 141 | Back information, alignment and structure |
|---|
| >d1urha2 c.46.1.2 (A:149-268) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} Length = 120 | Back information, alignment and structure |
|---|
| >d1urha2 c.46.1.2 (A:149-268) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} Length = 120 | Back information, alignment and structure |
|---|
| >d1e0ca2 c.46.1.2 (A:136-271) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]} Length = 136 | Back information, alignment and structure |
|---|
| >d1e0ca2 c.46.1.2 (A:136-271) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]} Length = 136 | Back information, alignment and structure |
|---|
| >d1uara1 c.46.1.2 (A:2-144) Sulfurtransferase {Thermus thermophilus [TaxId: 274]} Length = 143 | Back information, alignment and structure |
|---|
| >d1uara1 c.46.1.2 (A:2-144) Sulfurtransferase {Thermus thermophilus [TaxId: 274]} Length = 143 | Back information, alignment and structure |
|---|
| >d1hzma_ c.46.1.1 (A:) Erk2 binding domain of Mapk phosphatase mkp-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 154 | Back information, alignment and structure |
|---|
| >d1hzma_ c.46.1.1 (A:) Erk2 binding domain of Mapk phosphatase mkp-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 154 | Back information, alignment and structure |
|---|
| >d1e0ca1 c.46.1.2 (A:1-135) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]} Length = 135 | Back information, alignment and structure |
|---|
| >d1e0ca1 c.46.1.2 (A:1-135) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]} Length = 135 | Back information, alignment and structure |
|---|
| >d2gwfa1 c.46.1.4 (A:181-315) Ubiquitin carboxyl-terminal hydrolase 8, USP8 {Human (Homo sapiens) [TaxId: 9606]} Length = 135 | Back information, alignment and structure |
|---|
| >d1gmxa_ c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia coli [TaxId: 562]} Length = 108 | Back information, alignment and structure |
|---|
| >d1gmxa_ c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia coli [TaxId: 562]} Length = 108 | Back information, alignment and structure |
|---|
| >d1tq1a_ c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senescence-associated protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 119 | Back information, alignment and structure |
|---|
| >d1tq1a_ c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senescence-associated protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 119 | Back information, alignment and structure |
|---|
| >d1yt8a3 c.46.1.2 (A:373-529) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Length = 157 | Back information, alignment and structure |
|---|
| >d1yt8a2 c.46.1.2 (A:6-106) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Length = 101 | Back information, alignment and structure |
|---|
| >d1t3ka_ c.46.1.1 (A:) Dual specificity phosphatase Cdc25 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 132 | Back information, alignment and structure |
|---|
| >d1yt8a1 c.46.1.2 (A:107-242) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Length = 136 | Back information, alignment and structure |
|---|
| >d1c25a_ c.46.1.1 (A:) CDC25a {Human (Homo sapiens) [TaxId: 9606]} Length = 161 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 373 | |||
| d1urha1 | 147 | 3-mercaptopyruvate sulfurtransferase {Escherichia | 100.0 | |
| d1e0ca2 | 136 | Sulfurtransferase {Azotobacter vinelandii [TaxId: | 99.97 | |
| d1rhsa2 | 144 | Rhodanese {Cow (Bos taurus) [TaxId: 9913]} | 99.97 | |
| d1rhsa1 | 149 | Rhodanese {Cow (Bos taurus) [TaxId: 9913]} | 99.97 | |
| d1uara2 | 141 | Sulfurtransferase {Thermus thermophilus [TaxId: 27 | 99.96 | |
| d1uara1 | 143 | Sulfurtransferase {Thermus thermophilus [TaxId: 27 | 99.96 | |
| d1okga1 | 156 | 3-mercaptopyruvate sulfurtransferase {Leishmania m | 99.96 | |
| d1urha2 | 120 | 3-mercaptopyruvate sulfurtransferase {Escherichia | 99.95 | |
| d1okga2 | 139 | 3-mercaptopyruvate sulfurtransferase {Leishmania m | 99.93 | |
| d1urha1 | 147 | 3-mercaptopyruvate sulfurtransferase {Escherichia | 99.93 | |
| d1e0ca1 | 135 | Sulfurtransferase {Azotobacter vinelandii [TaxId: | 99.93 | |
| d1uara1 | 143 | Sulfurtransferase {Thermus thermophilus [TaxId: 27 | 99.93 | |
| d1e0ca2 | 136 | Sulfurtransferase {Azotobacter vinelandii [TaxId: | 99.92 | |
| d1rhsa1 | 149 | Rhodanese {Cow (Bos taurus) [TaxId: 9913]} | 99.9 | |
| d1e0ca1 | 135 | Sulfurtransferase {Azotobacter vinelandii [TaxId: | 99.88 | |
| d1rhsa2 | 144 | Rhodanese {Cow (Bos taurus) [TaxId: 9913]} | 99.88 | |
| d1okga1 | 156 | 3-mercaptopyruvate sulfurtransferase {Leishmania m | 99.88 | |
| d1tq1a_ | 119 | Thiosulfate sulfurtransferase/Senescence-associate | 99.87 | |
| d1yt8a1 | 136 | Thiosulfate sulfurtransferase PA2603 {Pseudomonas | 99.87 | |
| d1yt8a1 | 136 | Thiosulfate sulfurtransferase PA2603 {Pseudomonas | 99.87 | |
| d1uara2 | 141 | Sulfurtransferase {Thermus thermophilus [TaxId: 27 | 99.86 | |
| d1gmxa_ | 108 | Sulfurtransferase GlpE {Escherichia coli [TaxId: 5 | 99.86 | |
| d1tq1a_ | 119 | Thiosulfate sulfurtransferase/Senescence-associate | 99.84 | |
| d1yt8a2 | 101 | Thiosulfate sulfurtransferase PA2603 {Pseudomonas | 99.84 | |
| d1yt8a3 | 157 | Thiosulfate sulfurtransferase PA2603 {Pseudomonas | 99.83 | |
| d1yt8a2 | 101 | Thiosulfate sulfurtransferase PA2603 {Pseudomonas | 99.83 | |
| d1yt8a3 | 157 | Thiosulfate sulfurtransferase PA2603 {Pseudomonas | 99.83 | |
| d1urha2 | 120 | 3-mercaptopyruvate sulfurtransferase {Escherichia | 99.83 | |
| d1gmxa_ | 108 | Sulfurtransferase GlpE {Escherichia coli [TaxId: 5 | 99.83 | |
| d1qxna_ | 137 | Polysulfide-sulfur transferase (sulfide dehydrogen | 99.83 | |
| d1qxna_ | 137 | Polysulfide-sulfur transferase (sulfide dehydrogen | 99.82 | |
| d1t3ka_ | 132 | Dual specificity phosphatase Cdc25 {Thale cress (A | 99.81 | |
| d1yt8a4 | 130 | Thiosulfate sulfurtransferase PA2603 {Pseudomonas | 99.79 | |
| d1okga2 | 139 | 3-mercaptopyruvate sulfurtransferase {Leishmania m | 99.78 | |
| d1yt8a4 | 130 | Thiosulfate sulfurtransferase PA2603 {Pseudomonas | 99.77 | |
| d1t3ka_ | 132 | Dual specificity phosphatase Cdc25 {Thale cress (A | 99.77 | |
| d2gwfa1 | 135 | Ubiquitin carboxyl-terminal hydrolase 8, USP8 {Hum | 99.65 | |
| d1c25a_ | 161 | CDC25a {Human (Homo sapiens) [TaxId: 9606]} | 99.63 | |
| d1hzma_ | 154 | Erk2 binding domain of Mapk phosphatase mkp-3 {Hum | 99.63 | |
| d1c25a_ | 161 | CDC25a {Human (Homo sapiens) [TaxId: 9606]} | 99.6 | |
| d1ymka1 | 174 | CDC25b {Human (Homo sapiens) [TaxId: 9606]} | 99.58 | |
| d2gwfa1 | 135 | Ubiquitin carboxyl-terminal hydrolase 8, USP8 {Hum | 99.55 | |
| d1ymka1 | 174 | CDC25b {Human (Homo sapiens) [TaxId: 9606]} | 99.54 | |
| d1hzma_ | 154 | Erk2 binding domain of Mapk phosphatase mkp-3 {Hum | 99.52 | |
| d1xria_ | 151 | Putative phosphatase At1g05000 {Thale cress (Arabi | 86.55 | |
| d1npya1 | 167 | Shikimate 5-dehydrogenase-like protein HI0607 {Hae | 83.76 | |
| d1npya1 | 167 | Shikimate 5-dehydrogenase-like protein HI0607 {Hae | 82.57 |
| >d1urha1 c.46.1.2 (A:2-148) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Rhodanese/Cell cycle control phosphatase superfamily: Rhodanese/Cell cycle control phosphatase family: Multidomain sulfurtransferase (rhodanese) domain: 3-mercaptopyruvate sulfurtransferase species: Escherichia coli [TaxId: 562]
Probab=100.00 E-value=1.1e-32 Score=232.65 Aligned_cols=134 Identities=43% Similarity=0.857 Sum_probs=122.7
Q ss_pred CCcccHHHHHHhcCCCCeEEEEeecCCCCC-CCCChhhhhhCCCcCceecCcccccccCCCCCCCCCCHHHHHHHHHHcC
Q 017338 75 EPVVSVDWLHANLREPDLKVLDASWYMPDE-QRNPFQEYQVAHIPGALFFDVDGVADRTTNLPHMLPSEEAFAAAVSALG 153 (373)
Q Consensus 75 ~~~is~~~l~~~l~~~~~~iiDvR~~~~~~-~r~~~~ey~~gHIpGAi~ip~~~l~~~~~~~~~~l~~~e~~~~~l~~~g 153 (373)
..+||++||.++|++++++|||+|++++.. .++..++|..||||||+|+++..+.+.....++++|++++|++.++.+|
T Consensus 2 ~~lVs~~wL~~~L~~~~v~iiD~r~~~~~~~~~~~~~~y~~gHIPGAi~~~~~~~~~~~~~~~~~~p~~~~~~~~l~~~G 81 (147)
T d1urha1 2 TWFVGADWLAEHIDDPEIQIIDARMASPGQEDRNVAQEYLNGHIPGAVFFDIEALSDHTSPLPHMLPRPETFAVAMRELG 81 (147)
T ss_dssp CCEECHHHHHTTTTCTTEEEEECCCCCSSCTTCCHHHHHHHSBCTTCEECCGGGGSCSSSSSSSCCCCHHHHHHHHHHTT
T ss_pred CccCcHHHHHHHhCCCCeEEEEeeCCCCCccCccHHHHHHhCCccccEEeehhhhccccccccccCCCHHHHHHHHHHhC
Confidence 468999999999999999999999876533 3455578999999999999999988888888999999999999999999
Q ss_pred CCCCCeEEEEcCCCCchHHHHHHHHHHcCCCceEEecCCHHHHHhCCCCcccCCC
Q 017338 154 LENKDGLVVYDGKGIFSAARVWWMFRVFGHDRVWVLDGGLPRWRASGYDVESSAS 208 (373)
Q Consensus 154 i~~~~~VVvy~~~g~~~a~ra~~~L~~~G~~~v~~L~GG~~~W~~~g~pv~~~~~ 208 (373)
|+++++||+||+.+...|+|++|+|+.+||++|++||||+.+|+++|+|++++.+
T Consensus 82 i~~~~~vVvY~~~~~~~A~r~~~~L~~~G~~~V~vLdGG~~~W~~~g~pv~~~~~ 136 (147)
T d1urha1 82 VNQDKHLIVYDEGNLFSAPRAWWMLRTFGVEKVSILGGGLAGWQRDDLLLEEGAV 136 (147)
T ss_dssp CCTTSEEEEECSSSCSSHHHHHHHHHHTTCSCEEEETTHHHHHHHTTCCCBBSCC
T ss_pred cCCCCeEEEEeCCCcccchhHHHHHHhhcccceEEeCChHHHHHHcCCCccCCCC
Confidence 9999999999987777799999999999999999999999999999999999864
|
| >d1e0ca2 c.46.1.2 (A:136-271) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1rhsa2 c.46.1.2 (A:150-293) Rhodanese {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1rhsa1 c.46.1.2 (A:1-149) Rhodanese {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1uara2 c.46.1.2 (A:145-285) Sulfurtransferase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1uara1 c.46.1.2 (A:2-144) Sulfurtransferase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1okga1 c.46.1.2 (A:7-162) 3-mercaptopyruvate sulfurtransferase {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1urha2 c.46.1.2 (A:149-268) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1okga2 c.46.1.2 (A:163-301) 3-mercaptopyruvate sulfurtransferase {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1urha1 c.46.1.2 (A:2-148) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e0ca1 c.46.1.2 (A:1-135) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1uara1 c.46.1.2 (A:2-144) Sulfurtransferase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1e0ca2 c.46.1.2 (A:136-271) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1rhsa1 c.46.1.2 (A:1-149) Rhodanese {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1e0ca1 c.46.1.2 (A:1-135) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1rhsa2 c.46.1.2 (A:150-293) Rhodanese {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1okga1 c.46.1.2 (A:7-162) 3-mercaptopyruvate sulfurtransferase {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1tq1a_ c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senescence-associated protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1yt8a1 c.46.1.2 (A:107-242) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1yt8a1 c.46.1.2 (A:107-242) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1uara2 c.46.1.2 (A:145-285) Sulfurtransferase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1gmxa_ c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tq1a_ c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senescence-associated protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1yt8a2 c.46.1.2 (A:6-106) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1yt8a3 c.46.1.2 (A:373-529) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1yt8a2 c.46.1.2 (A:6-106) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1yt8a3 c.46.1.2 (A:373-529) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1urha2 c.46.1.2 (A:149-268) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gmxa_ c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qxna_ c.46.1.3 (A:) Polysulfide-sulfur transferase (sulfide dehydrogenase, Sud) {Wolinella succinogenes [TaxId: 844]} | Back information, alignment and structure |
|---|
| >d1qxna_ c.46.1.3 (A:) Polysulfide-sulfur transferase (sulfide dehydrogenase, Sud) {Wolinella succinogenes [TaxId: 844]} | Back information, alignment and structure |
|---|
| >d1t3ka_ c.46.1.1 (A:) Dual specificity phosphatase Cdc25 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1yt8a4 c.46.1.2 (A:243-372) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1okga2 c.46.1.2 (A:163-301) 3-mercaptopyruvate sulfurtransferase {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1yt8a4 c.46.1.2 (A:243-372) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1t3ka_ c.46.1.1 (A:) Dual specificity phosphatase Cdc25 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2gwfa1 c.46.1.4 (A:181-315) Ubiquitin carboxyl-terminal hydrolase 8, USP8 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1c25a_ c.46.1.1 (A:) CDC25a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hzma_ c.46.1.1 (A:) Erk2 binding domain of Mapk phosphatase mkp-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1c25a_ c.46.1.1 (A:) CDC25a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ymka1 c.46.1.1 (A:377-550) CDC25b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gwfa1 c.46.1.4 (A:181-315) Ubiquitin carboxyl-terminal hydrolase 8, USP8 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ymka1 c.46.1.1 (A:377-550) CDC25b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hzma_ c.46.1.1 (A:) Erk2 binding domain of Mapk phosphatase mkp-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xria_ c.45.1.1 (A:) Putative phosphatase At1g05000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|