Citrus Sinensis ID: 017390

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370--

MEVPEFFQGSYCAQFSAEKHHSLDSNKSSNGGDHFIVEELLDFSNEDAILTDAAAFDDVTANSTDSSTVTVVDSCNSSSFSGCGPNFPGENNGCRNFSDAHFSGDLCVPYDDLAELEWLSNIVEESFSCEDLQKLQLISGMKARSDHSSETRQFQPGTNRIYHGSTNTSNNTNANPNNPVFNPEMAVPAKARSKRSRAAPCSWASRLLVLSPPESTSEPEIIPTGPPPPPLQGKKSVKACGSKKKDSGDEGNGEGRKCLHCATDKTPQWRTGPMGPKTLCNACGVRYKSGRLVPEYRPASSPTFVLTKHSNSHRKVLELRRQKELQRAQQQQHQQQQFMHHHHHHQNMMFDLSNGDDYLIHQHVGPDFRQLI

ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccccccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEccccccCEEEEccccccccccc

****EFF**SYCAQFSAEKHH******SSNGGDHFIVEELLDFSNEDAILTDAAA********************************************AHFSGDLCVPYDDLAELEWLSNIVEESFSCEDLQKLQL************************************************************************************************************************CLHCATDKTPQWRTGPMGPKTLCNACGVRYKSGRLVPEY*****************************************************FDLSNGDDYLIHQHVGPDFRQLI

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MEVPEFFQGSYCAQFSAEKHHSLDSNKSSNGGDHFIVEELLDFSNEDAILTDAAAFDDVTANSTDSSTVTVVDSCNSSSFSGCGPNFPGENNGCRNFSDAHFSGDLCVPYDDLAELEWLSNIVEESFSCEDLQKLQLISGMKARSDHSSETRQFQPGTNRIYHGSTNTSNNTNANPNNPVFNPEMAVPAKARSKRSRAAPCSWASRLLVLSPPESTSEPEIIPTGPPPPPLQGKKSVKACGSKKKDSGDEGNGEGRKCLHCATDKTPQWRTGPMGPKTLCNACGVRYKSGRLVPEYRPASSPTFVLTKHSNSHRKxxxxxxxxxxxxxxxxxxxxxQFMHHHHHHQNMMFDLSNGDDYLIHQHVGPDFRQLI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
GATA transcription factor 12	Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes.	probable	P69781

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4GAT, chain A
Confidence level:confident
Coverage over the Query: 253-313
View the alignment between query and template
View the model in PyMOL