Citrus Sinensis ID: 017431

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-

MCKAAVAWEPNKPLVIEDVQVAPPQAGEVRIKILFTALCHTDAYTWSGKDPEGLFPCILGHEAAGIVESVGEGVTEVQPGDHVIPCYQAECRECKFCKSGKTNLCGKVRGATGAGVMMNDRKSRFSINGKPIYHFMGTSTFSQYTVVHDVSVAKIDPQAPLDKVCLLGCGVPTGLGAVWNTAKVEPGSIVAVFGLGTVGLAVAEGAKAAGASRVIGIDIDPKKFDRAKNFGVTEFVNPKDHDKPIQQVLVDLTDGGVDYSFECIGNVSVMRAALECCHKGWGTSVIVGVAASGQEISTRPFQLVTGRVWKGTAFGGFKSRSQVPWLVDKYMKKEIKVDEYVTHNMTLGEINEAFRYMHGGDCLRCVLKMQD

ccEEEEEcccccccEEEEEEEccccccEEEEEEEEEEEcccccEEEEcccccccccccccccccEEEEEEcccccccccccEEEEcccccccccccccccccccccccccccccccccccccccEEEccEEEEEEEccccccccEEEEccEEEEEcccccccEEEEEccccccccccEEEEcccccccEEEEEcccHHHHHHHHHHHHccccEEEEEEccccHHHHHHHccccEEcccccccccHHHHHHHHccccccEEEEccccHHHHHHHHHHccccccEEEEEEEcccccEEEccccccccccEEEEEEcccccccccHHHHHHHHHcccccccccEEccccHHHHHHHHHHHccccEEEEEEEEcc

cEEEEEEcccccccEEEEEEEccccccEEEEEEEEEEEcHHHHHHHHcccccccccEccccEEEEEEEEEcccccccccccEEEEcccccccccHHHHccccccccccHHHHHcccccccccccEEEccEEEEccccccccEcEEEEEHHHEEEccccccHHHHHHHHcHHHHHHHHHHcccccccccEEEEEcccHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHHcccEEEcHHHccccHHHHHHHHccccEcEEEEccccHHHHHHHHHcEcccccEEEEcccccccccEEEccHHHHcccEEEEccHHHccHHHHHHHHHHHHHccccccHHHEEEEEEHHHcHHHHHHHHHccccEEEEEccc

mckaavawepnkplviedvqvappqagEVRIKILFTALChtdaytwsgkdpeglfpcilgheAAGIVesvgegvtevqpgdhvipcyqaecreckfcksgktnlcgkvrgatgagvmmndrksrfsingkpiyhfmgtstfsQYTVVHdvsvakidpqapldkvcllgcgvptglgavwntakvepgsivAVFGLGTVGLAVAEGAKaagasrvigididpkkfdraknfgvtefvnpkdhdkpiQQVLVDLtdggvdysfecIGNVSVMRAALECCHKGWGTSVIVGVAasgqeistrpfqlvtgrvwkgtafggfksrsqvpWLVDKYMKKEIKVDEYVTHNMTLGEINEAFRYMHGGDCLRCVLKMQD

mckaavawepnkplviedVQVAPPQAGEVRIKILFTALCHTDAYTWSGKDPEGLFPCILGHEAAGIVESVGEGVTEVQPGDHVIPCYQAECRECKFcksgktnlcgkvrgatgagvmmndRKSRFSINGKPIYHFMGTSTFSQYTVVHDVSVAKIDPQAPLDKVCLLGCGVPTGLGAVWNTAKVEPGSIVAVFGLGTVGLAVAEGakaagasrvigididpkkfdRAKNFGVtefvnpkdhdkpIQQVLVDLTDGGVDYSFECIGNVSVMRAALECCHKGWGTSVIVGVAAsgqeistrpfqlvtgrVWKGTafggfksrsqvpwLVDKYMKKEIKVDEYVTHNMTLGEINEAFRYMHGGDCLRCVLKMQD

MCKAAVAWEPNKPLVIEDVQVAPPQAGEVRIKILFTALCHTDAYTWSGKDPEGLFPCILGHEAAGIVESVGEGVTEVQPGDHVIPCYQAECRECKFCKSGKTNLCGKVRGATGAGVMMNDRKSRFSINGKPIYHFMGTSTFSQYTVVHDVSVAKIDPQAPLDKVCLLGCGVPTGLGAVWNTAKVEPGSIVAVFGLGTVglavaegakaagaSRVIGIDIDPKKFDRAKNFGVTEFVNPKDHDKPIQQVLVDLTDGGVDYSFECIGNVSVMRAALECCHKGWGTSVIVGVAASGQEISTRPFQLVTGRVWKGTAFGGFKSRSQVPWLVDKYMKKEIKVDEYVTHNMTLGEINEAFRYMHGGDCLRCVLKMQD

*****VAWEPNKPLVIEDVQVAPPQAGEVRIKILFTALCHTDAYTWSGKDPEGLFPCILGHEAAGIVESVGEGVTEVQPGDHVIPCYQAECRECKFCKSGKTNLCGKVRGATGAGVMMNDRKSRFSINGKPIYHFMGTSTFSQYTVVHDVSVAKIDPQAPLDKVCLLGCGVPTGLGAVWNTAKVEPGSIVAVFGLGTVGLAVAEGAKAAGASRVIGIDIDPKKFDRAKNFGVTEFVNPKDHDKPIQQVLVDLTDGGVDYSFECIGNVSVMRAALECCHKGWGTSVIVGVAASGQEISTRPFQLVTGRVWKGTAFGGFKSRSQVPWLVDKYMKKEIKVDEYVTHNMTLGEINEAFRYMHGGDCLRCVL****

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		371	2.2.26 [Sep-21-2011]
P93629		381	Alcohol dehydrogenase cla	N/A	no	0.994	0.968	0.918	0.0
Q96533		379	Alcohol dehydrogenase cla	yes	no	0.986	0.965	0.915	0.0
A2XAZ3		381	Alcohol dehydrogenase cla	N/A	no	0.986	0.960	0.918	0.0
Q0DWH1		381	Alcohol dehydrogenase cla	yes	no	0.986	0.960	0.915	0.0
P80572		378	Alcohol dehydrogenase cla	N/A	no	0.997	0.978	0.878	0.0
P79896		376	Alcohol dehydrogenase cla	N/A	no	0.983	0.970	0.696	1e-151
P81600		375	Alcohol dehydrogenase cla	N/A	no	0.983	0.973	0.674	1e-147
Q3ZC42		374	Alcohol dehydrogenase cla	yes	no	0.989	0.981	0.690	1e-147
P80467		373	Alcohol dehydrogenase cla	N/A	no	0.989	0.983	0.692	1e-146
P86884		376	Alcohol dehydrogenase cla	N/A	no	0.989	0.976	0.682	1e-146

>sp\|P93629\|ADHX_MAIZE Alcohol dehydrogenase class-3 OS=Zea mays GN=FDH PE=2 SV=1	Back alignment and function desciption

 Score =  706 bits (1822), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/369 (91%), Positives = 353/369 (95%)

Query: 2   CKAAVAWEPNKPLVIEDVQVAPPQAGEVRIKILFTALCHTDAYTWSGKDPEGLFPCILGH 61
           CKAAVA+EPNKPLVIEDVQVAPPQAGEVR+KILFTALCHTD YTWSGKDPEGLFPCILGH
Sbjct: 12  CKAAVAYEPNKPLVIEDVQVAPPQAGEVRVKILFTALCHTDHYTWSGKDPEGLFPCILGH 71

Query: 62  EAAGIVESVGEGVTEVQPGDHVIPCYQAECRECKFCKSGKTNLCGKVRGATGAGVMMNDR 121
           EAAGIVESVGEGVT+VQPGDHVIPCYQAEC+ECKFCKSGKTNLCGKVR ATG GVMMND 
Sbjct: 72  EAAGIVESVGEGVTDVQPGDHVIPCYQAECKECKFCKSGKTNLCGKVRSATGVGVMMNDM 131

Query: 122 KSRFSINGKPIYHFMGTSTFSQYTVVHDVSVAKIDPQAPLDKVCLLGCGVPTGLGAVWNT 181
           KSRFS+NGKPIYHFMGTSTFSQYTVVHDVSVAKI+PQAPLDKVCLLGCGVPTGLGAVWNT
Sbjct: 132 KSRFSVNGKPIYHFMGTSTFSQYTVVHDVSVAKINPQAPLDKVCLLGCGVPTGLGAVWNT 191

Query: 182 AKVEPGSIVAVFGLGTVGLAVAEGAKAAGASRVIGIDIDPKKFDRAKNFGVTEFVNPKDH 241
           AKVE GS+VAVFGLGTVGLAVAEGAKAAGASRVIGIDID KKFD AKNFGVTEFVNPK+H
Sbjct: 192 AKVESGSVVAVFGLGTVGLAVAEGAKAAGASRVIGIDIDNKKFDVAKNFGVTEFVNPKEH 251

Query: 242 DKPIQQVLVDLTDGGVDYSFECIGNVSVMRAALECCHKGWGTSVIVGVAASGQEISTRPF 301
           DKPIQQVLVDLTDGGVDYSFECIGNVS+MRAALEC  KGWGTSVIVGVAASGQEISTRPF
Sbjct: 252 DKPIQQVLVDLTDGGVDYSFECIGNVSIMRAALECSDKGWGTSVIVGVAASGQEISTRPF 311

Query: 302 QLVTGRVWKGTAFGGFKSRSQVPWLVDKYMKKEIKVDEYVTHNMTLGEINEAFRYMHGGD 361
           QLVTGRVWKGTAFGGFKSR+QVPWLVDKYMKKEIKVDEY+THNM L +IN+AF  +H G 
Sbjct: 312 QLVTGRVWKGTAFGGFKSRTQVPWLVDKYMKKEIKVDEYITHNMNLADINDAFHLLHEGG 371

Query: 362 CLRCVLKMQ 370
           CLRCVL MQ
Sbjct: 372 CLRCVLAMQ 380

Zea mays (taxid: 4577)
EC: 1EC: .EC: 1EC: .EC: 1EC: .EC: 2EC: 8EC: 4

>sp\|Q96533\|ADHX_ARATH Alcohol dehydrogenase class-3 OS=Arabidopsis thaliana GN=ADH2 PE=1 SV=2	Back alignment and function description

>sp\|A2XAZ3\|ADHX_ORYSI Alcohol dehydrogenase class-3 OS=Oryza sativa subsp. indica GN=ADHIII PE=3 SV=1	Back alignment and function description

>sp\|Q0DWH1\|ADHX_ORYSJ Alcohol dehydrogenase class-3 OS=Oryza sativa subsp. japonica GN=Os02g0815500 PE=2 SV=1	Back alignment and function description

>sp\|P80572\|ADHX_PEA Alcohol dehydrogenase class-3 OS=Pisum sativum PE=1 SV=1	Back alignment and function description

>sp\|P79896\|ADHX_SPAAU Alcohol dehydrogenase class-3 OS=Sparus aurata PE=2 SV=1	Back alignment and function description

>sp\|P81600\|ADHH_GADMO Alcohol dehydrogenase class-3 chain H OS=Gadus morhua PE=1 SV=1	Back alignment and function description

>sp\|Q3ZC42\|ADHX_BOVIN Alcohol dehydrogenase class-3 OS=Bos taurus GN=ADH5 PE=2 SV=1	Back alignment and function description

>sp\|P80467\|ADHX_UROHA Alcohol dehydrogenase class-3 OS=Uromastyx hardwickii PE=1 SV=1	Back alignment and function description

>sp\|P86884\|ADHX_SCYCA Alcohol dehydrogenase class-3 OS=Scyliorhinus canicula PE=1 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		371
255585914		379	alcohol dehydrogenase, putative [Ricinus	1.0	0.978	0.929	0.0
433286663		396	Chain A, Crystal Structure Of S-nitrosog	0.991	0.929	0.926	0.0
353703786		379	alcohol dehydrogenase class III [Solanum	0.991	0.970	0.926	0.0
429840534		378	alcohol dehydrogenase 2 [Diospyros kaki]	0.991	0.973	0.926	0.0
242063486		381	hypothetical protein SORBIDRAFT_04g03705	0.994	0.968	0.924	0.0
224065517		379	glutathione-dependent formaldehyde dehyd	0.994	0.973	0.924	0.0
325910821		379	glutathione-dependent formaldehyde dehyd	0.994	0.973	0.926	0.0
195621922		381	alcohol dehydrogenase class 3 [Zea mays]	0.994	0.968	0.924	0.0
194688556		381	unknown [Zea mays] gi\|194707152\|gb\|ACF87	0.994	0.968	0.924	0.0
195625730		381	alcohol dehydrogenase class 3 [Zea mays]	0.994	0.968	0.921	0.0

>gi\|255585914\|ref\|XP_002533630.1\| alcohol dehydrogenase, putative [Ricinus communis] gi\|223526488\|gb\|EEF28759.1\| alcohol dehydrogenase, putative [Ricinus communis]	Back alignment and taxonomy information

 Score =  721 bits (1861), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/371 (92%), Positives = 361/371 (97%)

Query: 1   MCKAAVAWEPNKPLVIEDVQVAPPQAGEVRIKILFTALCHTDAYTWSGKDPEGLFPCILG 60
           +CKAAVA+EPNKPLVIEDVQVAPPQAGEVR++ILFTALCHTDAYTWSGKDPEGLFPCILG
Sbjct: 9   ICKAAVAYEPNKPLVIEDVQVAPPQAGEVRVQILFTALCHTDAYTWSGKDPEGLFPCILG 68

Query: 61  HEAAGIVESVGEGVTEVQPGDHVIPCYQAECRECKFCKSGKTNLCGKVRGATGAGVMMND 120
           HEAAGIVESVGEGVTEVQPGDHVIPCYQAECR+CKFCKSGKTNLCGKVR ATG GVMMND
Sbjct: 69  HEAAGIVESVGEGVTEVQPGDHVIPCYQAECRDCKFCKSGKTNLCGKVRAATGVGVMMND 128

Query: 121 RKSRFSINGKPIYHFMGTSTFSQYTVVHDVSVAKIDPQAPLDKVCLLGCGVPTGLGAVWN 180
           RKSRFSINGKPIYHFMGTSTFSQYTVVHDVSVAKIDP+APL+KVCLLGCGVPTGLGAVWN
Sbjct: 129 RKSRFSINGKPIYHFMGTSTFSQYTVVHDVSVAKIDPKAPLEKVCLLGCGVPTGLGAVWN 188

Query: 181 TAKVEPGSIVAVFGLGTVGLAVAEGAKAAGASRVIGIDIDPKKFDRAKNFGVTEFVNPKD 240
           TAKVE GSIVAVFGLGTVGLAVAEGAKAAGASR+IGIDID KK+DRAK+FGVTEFVNPKD
Sbjct: 189 TAKVEAGSIVAVFGLGTVGLAVAEGAKAAGASRIIGIDIDSKKYDRAKDFGVTEFVNPKD 248

Query: 241 HDKPIQQVLVDLTDGGVDYSFECIGNVSVMRAALECCHKGWGTSVIVGVAASGQEISTRP 300
           HDKPIQQV+VDLTDGGVDYSFECIGNVSVMR+ALECCHKGWGTSVIVGVAASGQEISTRP
Sbjct: 249 HDKPIQQVIVDLTDGGVDYSFECIGNVSVMRSALECCHKGWGTSVIVGVAASGQEISTRP 308

Query: 301 FQLVTGRVWKGTAFGGFKSRSQVPWLVDKYMKKEIKVDEYVTHNMTLGEINEAFRYMHGG 360
           FQLVTGRVWKGTAFGGFKSRSQVPWLVDKYMKKEIKVDEY+THN+TL EIN+AF  MH G
Sbjct: 309 FQLVTGRVWKGTAFGGFKSRSQVPWLVDKYMKKEIKVDEYITHNLTLVEINKAFDLMHEG 368

Query: 361 DCLRCVLKMQD 371
           DCLRCVL + D
Sbjct: 369 DCLRCVLSVHD 379

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|433286663|pdb|4DL9|A Chain A, Crystal Structure Of S-nitrosoglutathione Reductase From Tomato (solanum Lycopersicum) In Complex With Nad+ gi|433286664|pdb|4DL9|B Chain B, Crystal Structure Of S-nitrosoglutathione Reductase From Tomato (solanum Lycopersicum) In Complex With Nad+ gi|433286665|pdb|4DLA|A Chain A, Crystal Structure Of S-nitrosoglutathione Reductase Apoenzyme From Tomato (solanum Lycopersicum) gi|433286666|pdb|4DLA|B Chain B, Crystal Structure Of S-nitrosoglutathione Reductase Apoenzyme From Tomato (solanum Lycopersicum) gi|433286667|pdb|4DLB|A Chain A, Structure Of S-nitrosoglutathione Reductase From Tomato (solanum Lycopersicum) Crystallized In Presence Of Nadh And Glutathione gi|433286668|pdb|4DLB|B Chain B, Structure Of S-nitrosoglutathione Reductase From Tomato (solanum Lycopersicum) Crystallized In Presence Of Nadh And Glutathione

Back alignment and taxonomy information

>gi\|353703786\|ref\|NP_001238796.1\| alcohol dehydrogenase class III [Solanum lycopersicum] gi\|283825505\|gb\|ADB43258.1\| alcohol dehydrogenase class III [Solanum lycopersicum] gi\|322719690\|gb\|ADX07743.1\| alcohol dehydrogenase class III [Solanum habrochaites] gi\|322719692\|gb\|ADX07744.1\| alcohol dehydrogenase class III [Solanum chmielewskii]	Back alignment and taxonomy information

>gi\|429840534\|gb\|AGA15794.1\| alcohol dehydrogenase 2 [Diospyros kaki]	Back alignment and taxonomy information

>gi\|242063486\|ref\|XP_002453032.1\| hypothetical protein SORBIDRAFT_04g037050 [Sorghum bicolor] gi\|241932863\|gb\|EES06008.1\| hypothetical protein SORBIDRAFT_04g037050 [Sorghum bicolor]	Back alignment and taxonomy information

>gi\|224065517\|ref\|XP_002301836.1\| glutathione-dependent formaldehyde dehydrogenase [Populus trichocarpa] gi\|222843562\|gb\|EEE81109.1\| glutathione-dependent formaldehyde dehydrogenase [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|325910821\|dbj\|BAJ83825.1\| glutathione-dependent formaldehyde dehydrogenase [Epipremnum aureum]	Back alignment and taxonomy information

>gi\|195621922\|gb\|ACG32791.1\| alcohol dehydrogenase class 3 [Zea mays]	Back alignment and taxonomy information

>gi\|194688556\|gb\|ACF78362.1\| unknown [Zea mays] gi\|194707152\|gb\|ACF87660.1\| unknown [Zea mays] gi\|194707766\|gb\|ACF87967.1\| unknown [Zea mays] gi\|413939458\|gb\|AFW74009.1\| putative alcohol dehydrogenase superfamily protein [Zea mays]	Back alignment and taxonomy information

>gi\|195625730\|gb\|ACG34695.1\| alcohol dehydrogenase class 3 [Zea mays]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		371
ZFIN\|ZDB-GENE-011003-1		376	adh5 "alcohol dehydrogenase 5"	0.986	0.973	0.673	6e-135
UNIPROTKB\|P11766		374	ADH5 "Alcohol dehydrogenase cl	0.989	0.981	0.673	2.6e-134
UNIPROTKB\|F1S0C1		374	ADH5 "Uncharacterized protein"	0.989	0.981	0.673	8.8e-134
UNIPROTKB\|F1NI89		370	ADH5 "Uncharacterized protein"	0.986	0.989	0.683	1.4e-133
UNIPROTKB\|F1NKS5		374	ADH5 "Uncharacterized protein"	0.986	0.978	0.683	1.4e-133
UNIPROTKB\|F1PLM5		376	F1PLM5 "Uncharacterized protei	0.989	0.976	0.673	1.4e-133
UNIPROTKB\|J9PA83		374	ADH5 "Uncharacterized protein"	0.989	0.981	0.673	1.4e-133
RGD\|2292706		374	Adh5 "alcohol dehydrogenase 5	0.989	0.981	0.676	6.2e-133
UNIPROTKB\|P12711		374	Adh5 "Alcohol dehydrogenase cl	0.989	0.981	0.676	6.2e-133
MGI\|MGI:87929		374	Adh5 "alcohol dehydrogenase 5	0.989	0.981	0.673	2.1e-132

ZFIN\|ZDB-GENE-011003-1 adh5 "alcohol dehydrogenase 5" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

 Score = 1322 (470.4 bits), Expect = 6.0e-135, P = 6.0e-135
 Identities = 247/367 (67%), Positives = 286/367 (77%)

Query:     2 CKAAVAWEPNKPLVIEDVQVAPPQAGEVRIKILFTALCHTDAYTWSGKDPEGLFPCILGH 61
             CKAAVAWE  KPL IE+V+VAPP+A EVR+KI  T +CHTDAYT SG DPEGLFP ILGH
Sbjct:    10 CKAAVAWEAGKPLTIEEVEVAPPKAHEVRVKIHATGVCHTDAYTLSGSDPEGLFPVILGH 69

Query:    62 EAAGIVESVGEGVTEVQPGDHVIPCYQAECRECKFCKSGKTNLCGKVRGATGAGVMMNDR 121
             E AG VESVGEGVT+ +PGD VIP Y  +C ECKFCK+ KTNLC K+R   G G +M D 
Sbjct:    70 EGAGTVESVGEGVTKFKPGDTVIPLYVPQCGECKFCKNPKTNLCQKIRVTQGQG-LMPDN 128

Query:   122 KSRFSINGKPIYHFMGTSTFSQYTVVHDVSVAKIDPQAPLDKVCLLGCGVPTGLGAVWNT 181
              SRF+  GK ++HFMGTSTFS+YTVV ++S+AK+D  APLDKVCLLGCG+ TG GA  NT
Sbjct:   129 TSRFTCKGKQLFHFMGTSTFSEYTVVAEISLAKVDEHAPLDKVCLLGCGISTGYGAAINT 188

Query:   182 AKVEPGSIVAVFGLGTVXXXXXXXXXXXXXSRVIGIDIDPKKFDRAKNFGVTEFVNPKDH 241
             AKVE GS  AVFGLG V             +R+IGID++P KF+ AK FG TEFVNPKDH
Sbjct:   189 AKVEAGSTCAVFGLGAVGLAVVMGCKSAGATRIIGIDVNPDKFEIAKKFGATEFVNPKDH 248

Query:   242 DKPIQQVLVDLTDGGVDYSFECIGNVSVMRAALECCHKGWGTSVIVGVAASGQEISTRPF 301
              KPIQ+VLV+LTDGGVDYSFECIGNV +MRAALE CHKGWGTSVI+GVA +GQEISTRPF
Sbjct:   249 SKPIQEVLVELTDGGVDYSFECIGNVGIMRAALEACHKGWGTSVIIGVAGAGQEISTRPF 308

Query:   302 QLVTGRVWKGTAFGGFKSRSQVPWLVDKYMKKEIKVDEYVTHNMTLGEINEAFRYMHGGD 361
             QLVTGR WKGTAFGG+KS   VP LV+ YM K++ VDE+VTH +   +INEAF  MH G 
Sbjct:   309 QLVTGRTWKGTAFGGWKSVESVPKLVNDYMNKKLMVDEFVTHTLPFAQINEAFDLMHAGK 368

Query:   362 CLRCVLK 368
              +R VL+
Sbjct:   369 SIRAVLQ 375

GO:0016491 "oxidoreductase activity" evidence=IEA

GO:0055114 "oxidation-reduction process" evidence=IEA

GO:0008270 "zinc ion binding" evidence=IEA

GO:0000166 "nucleotide binding" evidence=IEA

GO:0051903 "S-(hydroxymethyl)glutathione dehydrogenase activity" evidence=IEA

GO:0006069 "ethanol oxidation" evidence=IEA

GO:0046872 "metal ion binding" evidence=IEA

UNIPROTKB\|P11766 ADH5 "Alcohol dehydrogenase class-3" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|F1S0C1 ADH5 "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

UNIPROTKB\|F1NI89 ADH5 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|F1NKS5 ADH5 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|F1PLM5 F1PLM5 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|J9PA83 ADH5 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

RGD\|2292706 Adh5 "alcohol dehydrogenase 5 (class III), chi polypeptide" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|P12711 Adh5 "Alcohol dehydrogenase class-3" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

MGI\|MGI:87929 Adh5 "alcohol dehydrogenase 5 (class III), chi polypeptide" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q1RFI7	FRMA_ECOUT	1, ., 1, ., 1, ., -	0.6311	0.9838	0.9891	yes	no
P80467	ADHX_UROHA	1, ., 1, ., 1, ., 2, 8, 4	0.6929	0.9892	0.9839	N/A	no
Q96533	ADHX_ARATH	1, ., 1, ., 1, ., 2, 8, 4	0.9153	0.9865	0.9656	yes	no
P25141	ADH1_PETHY	1, ., 1, ., 1, ., 1	0.6	0.9946	0.9659	N/A	no
A7ZIA4	FRMA_ECO24	1, ., 1, ., 1, ., -	0.6338	0.9838	0.9891	yes	no
P25437	FRMA_ECOLI	1, ., 1, ., 1, ., -	0.6311	0.9838	0.9891	N/A	no
P73138	FRMA_SYNY3	1, ., 1, ., 1, ., -	0.6438	0.9811	0.9864	N/A	no
P19854	ADHX_HORSE	1, ., 1, ., 1, ., 2, 8, 4	0.6875	0.9892	0.9812	yes	no
P14674	ADH2_SOLTU	1, ., 1, ., 1, ., 1	0.5918	0.9973	0.9736	N/A	no
P14675	ADH3_SOLTU	1, ., 1, ., 1, ., 1	0.5918	0.9973	0.9736	N/A	no
A2XAZ3	ADHX_ORYSI	1, ., 1, ., 1, ., 2, 8, 4	0.9180	0.9865	0.9606	N/A	no
B1J085	FRMA_ECOLC	1, ., 1, ., 1, ., -	0.6338	0.9838	0.9891	yes	no
P14673	ADH1_SOLTU	1, ., 1, ., 1, ., 1	0.5945	0.9973	0.9736	N/A	no
P12711	ADHX_RAT	1, ., 1, ., 1, ., 2, 8, 4	0.7010	0.9892	0.9812	yes	no
Q0TKS7	FRMA_ECOL5	1, ., 1, ., 1, ., -	0.6311	0.9838	0.9891	yes	no
P81601	ADHL_GADMO	1, ., 1, ., 1, ., 2, 8, 4	0.6702	0.9865	0.976	N/A	no
P81600	ADHH_GADMO	1, ., 1, ., 1, ., 2, 8, 4	0.6748	0.9838	0.9733	N/A	no
P93629	ADHX_MAIZE	1, ., 1, ., 1, ., 2, 8, 4	0.9186	0.9946	0.9685	N/A	no
A7ZX04	FRMA_ECOHS	1, ., 1, ., 1, ., -	0.6338	0.9838	0.9891	yes	no
P48977	ADH_MALDO	1, ., 1, ., 1, ., 1	0.5837	0.9973	0.9736	N/A	no
P00333	ADH1_MAIZE	1, ., 1, ., 1, ., 1	0.5945	0.9973	0.9762	N/A	no
P28032	ADH2_SOLLC	1, ., 1, ., 1, ., 1	0.5891	0.9973	0.9736	N/A	no
Q0DWH1	ADHX_ORYSJ	1, ., 1, ., 1, ., 2, 8, 4	0.9153	0.9865	0.9606	yes	no
Q8X5J4	FRMA_ECO57	1, ., 1, ., 1, ., -	0.6338	0.9838	0.9891	N/A	no
P80572	ADHX_PEA	1, ., 1, ., 1, ., 2, 8, 4	0.8783	0.9973	0.9788	N/A	no
O19053	ADHX_RABIT	1, ., 1, ., 1, ., 2, 8, 4	0.6902	0.9892	0.9812	yes	no
Q17335	ADHX_CAEEL	1, ., 1, ., 1, ., 2, 8, 4	0.6193	0.9919	0.9583	yes	no
Q3ZC42	ADHX_BOVIN	1, ., 1, ., 1, ., 2, 8, 4	0.6902	0.9892	0.9812	yes	no
P46415	ADHX_DROME	1, ., 1, ., 1, ., 2, 8, 4	0.6612	0.9865	0.9656	yes	no
P11766	ADHX_HUMAN	1, ., 1, ., 1, ., 2, 8, 4	0.6983	0.9892	0.9812	yes	no
Q75ZX4	ADH1_ORYSI	1, ., 1, ., 1, ., 1	0.6	0.9973	0.9762	N/A	no
P05336	ADH1_HORVU	1, ., 1, ., 1, ., 1	0.5945	0.9973	0.9762	N/A	no
P79896	ADHX_SPAAU	1, ., 1, ., 1, ., 2, 8, 4	0.6967	0.9838	0.9707	N/A	no
P32771	FADH_YEAST	1, ., 1, ., 1, ., -	0.6085	0.9973	0.9585	yes	no
O74540	FADH2_SCHPO	1, ., 1, ., 1, ., -	0.625	0.9892	0.9657	yes	no
P12886	ADH1_PEA	1, ., 1, ., 1, ., 1	0.5783	0.9973	0.9736	N/A	no
P13603	ADH1_TRIRP	1, ., 1, ., 1, ., 1	0.5783	0.9973	0.9736	N/A	no
P17648	ADH_FRAAN	1, ., 1, ., 1, ., 1	0.5810	0.9973	0.9736	N/A	no
P04707	ADH2_MAIZE	1, ., 1, ., 1, ., 1	0.5837	0.9973	0.9762	N/A	no
P14219	ADH1_PENAM	1, ., 1, ., 1, ., 1	0.5945	0.9973	0.9762	N/A	no
P28474	ADHX_MOUSE	1, ., 1, ., 1, ., 2, 8, 4	0.6983	0.9892	0.9812	yes	no
Q54TC2	ADHX_DICDI	1, ., 1, ., 1, ., 2, 8, 4	0.6792	0.9892	0.9683	yes	no
P81431	ADHX_OCTVU	1, ., 1, ., 1, ., 2, 8, 4	0.6594	0.9946	0.9761	N/A	no
P80360	ADHX_MYXGL	1, ., 1, ., 1, ., 2, 8, 4	0.6385	0.9892	0.9760	N/A	no
B1LIP1	FRMA_ECOSM	1, ., 1, ., 1, ., -	0.6311	0.9838	0.9891	yes	no
P86884	ADHX_SCYCA	1, ., 1, ., 1, ., 2, 8, 4	0.6820	0.9892	0.9760	N/A	no
Q3Z550	FRMA_SHISS	1, ., 1, ., 1, ., -	0.6338	0.9838	0.9891	yes	no
A1A835	FRMA_ECOK1	1, ., 1, ., 1, ., -	0.6311	0.9838	0.9891	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	1.1.1	0.998
4th Layer	1.1.1.284	0.994
4th Layer	1.1.1.1	0.994
3rd Layer	1.1.1.73	0.991

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	Sb04g037050.1	hypothetical protein (381 aa)
		(Sorghum bicolor)
Predicted Functional Partners:
	Dha1	SubName- Full=Aldehyde dehydrogenase; Flags- Fragment; (510 aa)				•		0.901
	Sb09g023060.1	hypothetical protein (610 aa)				•		0.899
	Sb08g004840.1	hypothetical protein (488 aa)				•		0.899
	Sb05g005470.1	hypothetical protein (478 aa)				•		0.899
	Sb04g033420.1	hypothetical protein (486 aa)				•		0.899
	Sb03g005240.1	hypothetical protein (592 aa)				•		0.899
	Sb02g043900.1	hypothetical protein (529 aa)				•		0.899
	Sb01g038360.1	hypothetical protein (610 aa)				•		0.899
	Sb03g045400.1	hypothetical protein (285 aa)	•	•	•	•	•	0.745

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		371
cd08300		368	cd08300, alcohol_DH_class_III, class III alcohol d	0.0
cd08301		369	cd08301, alcohol_DH_plants, Plant alcohol dehydrog	0.0
TIGR02818		368	TIGR02818, adh_III_F_hyde, S-(hydroxymethyl)glutat	0.0
cd08277		365	cd08277, liver_alcohol_DH_like, Liver alcohol dehy	0.0
COG1062		366	COG1062, AdhC, Zn-dependent alcohol dehydrogenases	0.0
cd08299		373	cd08299, alcohol_DH_class_I_II_IV, class I, II, IV	0.0
cd05279		365	cd05279, Zn_ADH1, Liver alcohol dehydrogenase and	1e-177
PLN02740		381	PLN02740, PLN02740, Alcohol dehydrogenase-like	1e-172
PLN02827		378	PLN02827, PLN02827, Alcohol dehydrogenase-like	1e-160
cd08279		363	cd08279, Zn_ADH_class_III, Class III alcohol dehyd	1e-137
cd08281		371	cd08281, liver_ADH_like1, Zinc-dependent alcohol d	1e-101
cd08278		365	cd08278, benzyl_alcohol_DH, Benzyl alcohol dehydro	1e-100
TIGR03989		369	TIGR03989, Rxyl_3153, oxidoreductase, Rxyl_3153 fa	1e-95
cd08263		367	cd08263, Zn_ADH10, Alcohol dehydrogenases of the M	9e-73
TIGR03451		358	TIGR03451, mycoS_dep_FDH, S-(hydroxymethyl)mycothi	7e-71
COG1064		339	COG1064, AdhP, Zn-dependent alcohol dehydrogenases	1e-64
cd05188		271	cd05188, MDR, Medium chain reductase/dehydrogenase	6e-61
COG1063		350	COG1063, Tdh, Threonine dehydrogenase and related	4e-58
cd08231		361	cd08231, MDR_TM0436_like, Hypothetical enzyme TM04	2e-56
cd08260		345	cd08260, Zn_ADH6, Alcohol dehydrogenases of the MD	2e-54
cd05278		347	cd05278, FDH_like, Formaldehyde dehydrogenases	5e-53
cd08234		334	cd08234, threonine_DH_like, L-threonine dehydrogen	3e-49
cd08236		343	cd08236, sugar_DH, NAD(P)-dependent sugar dehydrog	7e-49
cd08233		351	cd08233, butanediol_DH_like, (2R,3R)-2,3-butanedio	5e-48
cd08235		343	cd08235, iditol_2_DH_like, L-iditol 2-dehydrogenas	5e-48
cd08254		338	cd08254, hydroxyacyl_CoA_DH, 6-hydroxycyclohex-1-e	2e-47
cd08261		337	cd08261, Zn_ADH7, Alcohol dehydrogenases of the MD	6e-46
cd05285		343	cd05285, sorbitol_DH, Sorbitol dehydrogenase	9e-46
cd08239		339	cd08239, THR_DH_like, L-threonine dehydrogenase (T	3e-44
cd08259		332	cd08259, Zn_ADH5, Alcohol dehydrogenases of the MD	3e-44
cd08283		386	cd08283, FDH_like_1, Glutathione-dependent formald	5e-41
cd08245		330	cd08245, CAD, Cinnamyl alcohol dehydrogenases (CAD	5e-40
cd08297		341	cd08297, CAD3, Cinnamyl alcohol dehydrogenases (CA	1e-39
cd05284		340	cd05284, arabinose_DH_like, D-arabinose dehydrogen	7e-39
cd08284		344	cd08284, FDH_like_2, Glutathione-dependent formald	3e-38
cd05281		341	cd05281, TDH, Threonine dehydrogenase	3e-36
cd08240		350	cd08240, 6_hydroxyhexanoate_dh_like, 6-hydroxyhexa	9e-36
cd08266		342	cd08266, Zn_ADH_like1, Alcohol dehydrogenases of t	1e-35
cd08285		351	cd08285, NADP_ADH, NADP(H)-dependent alcohol dehyd	5e-35
cd08286		345	cd08286, FDH_like_ADH2, formaldehyde dehydrogenase	4e-34
cd05283		337	cd05283, CAD1, Cinnamyl alcohol dehydrogenases (CA	4e-32
cd08232		339	cd08232, idonate-5-DH, L-idonate 5-dehydrogenase	2e-31
cd08258		306	cd08258, Zn_ADH4, Alcohol dehydrogenases of the MD	2e-30
cd08287		345	cd08287, FDH_like_ADH3, formaldehyde dehydrogenase	5e-30
PRK13771		334	PRK13771, PRK13771, putative alcohol dehydrogenase	8e-30
COG0604		326	COG0604, Qor, NADPH:quinone reductase and related	9e-28
cd08282		375	cd08282, PFDH_like, Pseudomonas putida aldehyde-di	1e-27
TIGR00692		340	TIGR00692, tdh, L-threonine 3-dehydrogenase	3e-27
cd08296		333	cd08296, CAD_like, Cinnamyl alcohol dehydrogenases	2e-26
cd08269		312	cd08269, Zn_ADH9, Alcohol dehydrogenases of the MD	2e-26
pfam08240		108	pfam08240, ADH_N, Alcohol dehydrogenase GroES-like	3e-26
cd08298		329	cd08298, CAD2, Cinnamyl alcohol dehydrogenases (CA	3e-26
PRK05396		341	PRK05396, tdh, L-threonine 3-dehydrogenase; Valida	2e-25
pfam00107		131	pfam00107, ADH_zinc_N, Zinc-binding dehydrogenase	2e-25
cd08265		384	cd08265, Zn_ADH3, Alcohol dehydrogenases of the MD	7e-24
cd08249		339	cd08249, enoyl_reductase_like, enoyl_reductase_lik	1e-23
cd08255		277	cd08255, 2-desacetyl-2-hydroxyethyl_bacteriochloro	2e-23
PRK09422		338	PRK09422, PRK09422, ethanol-active dehydrogenase/a	2e-23
PRK10309		347	PRK10309, PRK10309, galactitol-1-phosphate dehydro	5e-22
TIGR03201		349	TIGR03201, dearomat_had, 6-hydroxycyclohex-1-ene-1	6e-21
PLN02702		364	PLN02702, PLN02702, L-idonate 5-dehydrogenase	1e-20
cd05289		309	cd05289, MDR_like_2, alcohol dehydrogenase and qui	2e-20
cd08276		336	cd08276, MDR7, Medium chain dehydrogenases/reducta	4e-20
cd08241		323	cd08241, QOR1, Quinone oxidoreductase (QOR)	1e-19
PRK10083		339	PRK10083, PRK10083, putative oxidoreductase; Provi	2e-18
TIGR02819		393	TIGR02819, fdhA_non_GSH, formaldehyde dehydrogenas	3e-18
cd08256		350	cd08256, Zn_ADH2, Alcohol dehydrogenases of the MD	4e-18
TIGR03366		280	TIGR03366, HpnZ_proposed, putative phosphonate cat	1e-17
cd05286		320	cd05286, QOR2, Quinone oxidoreductase (QOR)	3e-17
cd08262		341	cd08262, Zn_ADH8, Alcohol dehydrogenases of the MD	4e-17
cd08243		320	cd08243, quinone_oxidoreductase_like_1, Quinone ox	4e-17
cd08253		325	cd08253, zeta_crystallin, Zeta-crystallin with NAD	3e-15
PLN02586		360	PLN02586, PLN02586, probable cinnamyl alcohol dehy	4e-15
cd08264		325	cd08264, Zn_ADH_like2, Alcohol dehydrogenases of t	1e-14
cd08268		328	cd08268, MDR2, Medium chain dehydrogenases/reducta	7e-14
cd08267		319	cd08267, MDR1, Medium chain dehydrogenases/reducta	4e-13
PRK09880		343	PRK09880, PRK09880, L-idonate 5-dehydrogenase; Pro	1e-12
cd08271		325	cd08271, MDR5, Medium chain dehydrogenases/reducta	5e-12
cd08272		326	cd08272, MDR6, Medium chain dehydrogenases/reducta	1e-11
cd08242		319	cd08242, MDR_like, Medium chain dehydrogenases/red	1e-11
cd08230		355	cd08230, glucose_DH, Glucose dehydrogenase	4e-11
PLN02514		357	PLN02514, PLN02514, cinnamyl-alcohol dehydrogenase	5e-11
cd05282		323	cd05282, ETR_like, 2-enoyl thioester reductase-lik	2e-10
cd05276		323	cd05276, p53_inducible_oxidoreductase, PIG3 p53-in	7e-10
PLN02178		375	PLN02178, PLN02178, cinnamyl-alcohol dehydrogenase	1e-09
cd08292		324	cd08292, ETR_like_2, 2-enoyl thioester reductase (	1e-09
PRK10754		327	PRK10754, PRK10754, quinone oxidoreductase, NADPH-	2e-09
cd08290		341	cd08290, ETR, 2-enoyl thioester reductase (ETR)	7e-09
cd05195		293	cd05195, enoyl_red, enoyl reductase of polyketide	1e-07
cd08275		337	cd08275, MDR3, Medium chain dehydrogenases/reducta	1e-07
PTZ00354		334	PTZ00354, PTZ00354, alcohol dehydrogenase; Provisi	2e-07
COG2130		340	COG2130, COG2130, Putative NADP-dependent oxidored	2e-07
cd08252		336	cd08252, AL_MDR, Arginate lyase and other MDR fami	5e-07
TIGR02822		329	TIGR02822, adh_fam_2, zinc-binding alcohol dehydro	6e-07
cd08250		329	cd08250, Mgc45594_like, Mgc45594 gene product and	7e-07
cd05288		329	cd05288, PGDH, Prostaglandin dehydrogenases	2e-06
cd08251		303	cd08251, polyketide_synthase, polyketide synthase	5e-06
cd08246		393	cd08246, crotonyl_coA_red, crotonyl-CoA reductase	9e-06
TIGR01751		398	TIGR01751, crot-CoA-red, crotonyl-CoA reductase	2e-05
cd08273		331	cd08273, MDR8, Medium chain dehydrogenases/reducta	4e-05
smart00829		287	smart00829, PKS_ER, Enoylreductase	8e-05
TIGR02817		336	TIGR02817, adh_fam_1, zinc-binding alcohol dehydro	1e-04
cd08247		352	cd08247, AST1_like, AST1 is a cytoplasmic protein	2e-04
TIGR02824		325	TIGR02824, quinone_pig3, putative NAD(P)H quinone	3e-04
cd08244		324	cd08244, MDR_enoyl_red, Possible enoyl reductase	5e-04
pfam02254		116	pfam02254, TrkA_N, TrkA-N domain	5e-04
cd01075		200	cd01075, NAD_bind_Leu_Phe_Val_DH, NAD(P) binding d	5e-04
TIGR03026		409	TIGR03026, NDP-sugDHase, nucleotide sugar dehydrog	8e-04
TIGR01202		308	TIGR01202, bchC, 2-desacetyl-2-hydroxyethyl bacter	0.002
cd08274		350	cd08274, MDR9, Medium chain dehydrogenases/reducta	0.002
COG0677		436	COG0677, WecC, UDP-N-acetyl-D-mannosaminuronate de	0.003
cd08291		324	cd08291, ETR_like_1, 2-enoyl thioester reductase (	0.003

>gnl\|CDD\|176260 cd08300, alcohol_DH_class_III, class III alcohol dehydrogenases	Back alignment and domain information

 Score =  779 bits (2013), Expect = 0.0
 Identities = 287/367 (78%), Positives = 316/367 (86%), Gaps = 1/367 (0%)

Query: 2   CKAAVAWEPNKPLVIEDVQVAPPQAGEVRIKILFTALCHTDAYTWSGKDPEGLFPCILGH 61
           CKAAVAWE  KPL IE+V+VAPP+AGEVRIKIL T +CHTDAYT SG DPEGLFP ILGH
Sbjct: 3   CKAAVAWEAGKPLSIEEVEVAPPKAGEVRIKILATGVCHTDAYTLSGADPEGLFPVILGH 62

Query: 62  EAAGIVESVGEGVTEVQPGDHVIPCYQAECRECKFCKSGKTNLCGKVRGATGAGVMMNDR 121
           E AGIVESVGEGVT V+PGDHVIP Y  EC ECKFCKSGKTNLC K+R   G G +M D 
Sbjct: 63  EGAGIVESVGEGVTSVKPGDHVIPLYTPECGECKFCKSGKTNLCQKIRATQGKG-LMPDG 121

Query: 122 KSRFSINGKPIYHFMGTSTFSQYTVVHDVSVAKIDPQAPLDKVCLLGCGVPTGLGAVWNT 181
            SRFS  GKPIYHFMGTSTFS+YTVV ++SVAKI+P+APLDKVCLLGCGV TG GAV NT
Sbjct: 122 TSRFSCKGKPIYHFMGTSTFSEYTVVAEISVAKINPEAPLDKVCLLGCGVTTGYGAVLNT 181

Query: 182 AKVEPGSIVAVFGLGTVGLAVAEGAKAAGASRVIGIDIDPKKFDRAKNFGVTEFVNPKDH 241
           AKVEPGS VAVFGLG VGLAV +GAKAAGASR+IGIDI+P KF+ AK FG T+ VNPKDH
Sbjct: 182 AKVEPGSTVAVFGLGAVGLAVIQGAKAAGASRIIGIDINPDKFELAKKFGATDCVNPKDH 241

Query: 242 DKPIQQVLVDLTDGGVDYSFECIGNVSVMRAALECCHKGWGTSVIVGVAASGQEISTRPF 301
           DKPIQQVLV++TDGGVDY+FECIGNV VMRAALE CHKGWGTSVI+GVAA+GQEISTRPF
Sbjct: 242 DKPIQQVLVEMTDGGVDYTFECIGNVKVMRAALEACHKGWGTSVIIGVAAAGQEISTRPF 301

Query: 302 QLVTGRVWKGTAFGGFKSRSQVPWLVDKYMKKEIKVDEYVTHNMTLGEINEAFRYMHGGD 361
           QLVTGRVWKGTAFGG+KSRSQVP LV+ YMK +IKVDE++TH M L EINEAF  MH G 
Sbjct: 302 QLVTGRVWKGTAFGGWKSRSQVPKLVEDYMKGKIKVDEFITHTMPLDEINEAFDLMHAGK 361

Query: 362 CLRCVLK 368
            +R V+K
Sbjct: 362 SIRTVVK 368

Members identified as glutathione-dependent formaldehyde dehydrogenase(FDH), a member of the zinc dependent/medium chain alcohol dehydrogenase family. FDH converts formaldehyde and NAD(P) to formate and NAD(P)H. The initial step in this process the spontaneous formation of a S-(hydroxymethyl)glutathione adduct from formaldehyde and glutathione, followed by FDH-mediated oxidation (and detoxification) of the adduct to S-formylglutathione. MDH family uses NAD(H) as a cofactor in the interconversion of alcohols and aldehydes or ketones. Like many zinc-dependent alcohol dehydrogenases (ADH) of the medium chain alcohol dehydrogenase/reductase family (MDR), these FDHs form dimers, with 4 zinc ions per dimer. The medium chain alcohol dehydrogenase family (MDR) have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. Length = 368

>gnl\|CDD\|176261 cd08301, alcohol_DH_plants, Plant alcohol dehydrogenase	Back alignment and domain information

>gnl\|CDD\|131865 TIGR02818, adh_III_F_hyde, S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase	Back alignment and domain information

>gnl\|CDD\|176238 cd08277, liver_alcohol_DH_like, Liver alcohol dehydrogenase	Back alignment and domain information

>gnl\|CDD\|223990 COG1062, AdhC, Zn-dependent alcohol dehydrogenases, class III [Energy production and conversion]	Back alignment and domain information

>gnl\|CDD\|176259 cd08299, alcohol_DH_class_I_II_IV, class I, II, IV alcohol dehydrogenases	Back alignment and domain information

>gnl\|CDD\|176182 cd05279, Zn_ADH1, Liver alcohol dehydrogenase and related zinc-dependent alcohol dehydrogenases	Back alignment and domain information

>gnl\|CDD\|178341 PLN02740, PLN02740, Alcohol dehydrogenase-like	Back alignment and domain information

>gnl\|CDD\|215442 PLN02827, PLN02827, Alcohol dehydrogenase-like	Back alignment and domain information

>gnl\|CDD\|176240 cd08279, Zn_ADH_class_III, Class III alcohol dehydrogenase	Back alignment and domain information

>gnl\|CDD\|176241 cd08281, liver_ADH_like1, Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase)	Back alignment and domain information

>gnl\|CDD\|176239 cd08278, benzyl_alcohol_DH, Benzyl alcohol dehydrogenase	Back alignment and domain information

>gnl\|CDD\|188504 TIGR03989, Rxyl_3153, oxidoreductase, Rxyl_3153 family	Back alignment and domain information

>gnl\|CDD\|176224 cd08263, Zn_ADH10, Alcohol dehydrogenases of the MDR family	Back alignment and domain information

>gnl\|CDD\|132492 TIGR03451, mycoS_dep_FDH, S-(hydroxymethyl)mycothiol dehydrogenase	Back alignment and domain information

>gnl\|CDD\|223992 COG1064, AdhP, Zn-dependent alcohol dehydrogenases [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|176178 cd05188, MDR, Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family	Back alignment and domain information

>gnl\|CDD\|223991 COG1063, Tdh, Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only]	Back alignment and domain information

>gnl\|CDD\|176193 cd08231, MDR_TM0436_like, Hypothetical enzyme TM0436 resembles the zinc-dependent alcohol dehydrogenases (ADH)	Back alignment and domain information

>gnl\|CDD\|176221 cd08260, Zn_ADH6, Alcohol dehydrogenases of the MDR family	Back alignment and domain information

>gnl\|CDD\|176181 cd05278, FDH_like, Formaldehyde dehydrogenases	Back alignment and domain information

>gnl\|CDD\|176196 cd08234, threonine_DH_like, L-threonine dehydrogenase	Back alignment and domain information

>gnl\|CDD\|176198 cd08236, sugar_DH, NAD(P)-dependent sugar dehydrogenases	Back alignment and domain information

>gnl\|CDD\|176195 cd08233, butanediol_DH_like, (2R,3R)-2,3-butanediol dehydrogenase	Back alignment and domain information

>gnl\|CDD\|176197 cd08235, iditol_2_DH_like, L-iditol 2-dehydrogenase	Back alignment and domain information

>gnl\|CDD\|176216 cd08254, hydroxyacyl_CoA_DH, 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase, N-benzyl-3-pyrrolidinol dehydrogenase, and other MDR family members	Back alignment and domain information

>gnl\|CDD\|176222 cd08261, Zn_ADH7, Alcohol dehydrogenases of the MDR family	Back alignment and domain information

>gnl\|CDD\|176188 cd05285, sorbitol_DH, Sorbitol dehydrogenase	Back alignment and domain information

>gnl\|CDD\|176201 cd08239, THR_DH_like, L-threonine dehydrogenase (TDH)-like	Back alignment and domain information

>gnl\|CDD\|176220 cd08259, Zn_ADH5, Alcohol dehydrogenases of the MDR family	Back alignment and domain information

>gnl\|CDD\|176243 cd08283, FDH_like_1, Glutathione-dependent formaldehyde dehydrogenase related proteins, child 1	Back alignment and domain information

>gnl\|CDD\|176207 cd08245, CAD, Cinnamyl alcohol dehydrogenases (CAD) and related proteins	Back alignment and domain information

>gnl\|CDD\|176257 cd08297, CAD3, Cinnamyl alcohol dehydrogenases (CAD)	Back alignment and domain information

>gnl\|CDD\|176187 cd05284, arabinose_DH_like, D-arabinose dehydrogenase	Back alignment and domain information

>gnl\|CDD\|176244 cd08284, FDH_like_2, Glutathione-dependent formaldehyde dehydrogenase related proteins, child 2	Back alignment and domain information

>gnl\|CDD\|176184 cd05281, TDH, Threonine dehydrogenase	Back alignment and domain information

>gnl\|CDD\|176202 cd08240, 6_hydroxyhexanoate_dh_like, 6-hydroxyhexanoate dehydrogenase	Back alignment and domain information

>gnl\|CDD\|176227 cd08266, Zn_ADH_like1, Alcohol dehydrogenases of the MDR family	Back alignment and domain information

>gnl\|CDD\|176245 cd08285, NADP_ADH, NADP(H)-dependent alcohol dehydrogenases	Back alignment and domain information

>gnl\|CDD\|176246 cd08286, FDH_like_ADH2, formaldehyde dehydrogenase (FDH)-like	Back alignment and domain information

>gnl\|CDD\|176186 cd05283, CAD1, Cinnamyl alcohol dehydrogenases (CAD)	Back alignment and domain information

>gnl\|CDD\|176194 cd08232, idonate-5-DH, L-idonate 5-dehydrogenase	Back alignment and domain information

>gnl\|CDD\|176219 cd08258, Zn_ADH4, Alcohol dehydrogenases of the MDR family	Back alignment and domain information

>gnl\|CDD\|176247 cd08287, FDH_like_ADH3, formaldehyde dehydrogenase (FDH)-like	Back alignment and domain information

>gnl\|CDD\|184316 PRK13771, PRK13771, putative alcohol dehydrogenase; Provisional	Back alignment and domain information

>gnl\|CDD\|223677 COG0604, Qor, NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only]	Back alignment and domain information

>gnl\|CDD\|176242 cd08282, PFDH_like, Pseudomonas putida aldehyde-dismutating formaldehyde dehydrogenase (PFDH)	Back alignment and domain information

>gnl\|CDD\|129775 TIGR00692, tdh, L-threonine 3-dehydrogenase	Back alignment and domain information

>gnl\|CDD\|176256 cd08296, CAD_like, Cinnamyl alcohol dehydrogenases (CAD)	Back alignment and domain information

>gnl\|CDD\|176230 cd08269, Zn_ADH9, Alcohol dehydrogenases of the MDR family	Back alignment and domain information

>gnl\|CDD\|219758 pfam08240, ADH_N, Alcohol dehydrogenase GroES-like domain	Back alignment and domain information

>gnl\|CDD\|176258 cd08298, CAD2, Cinnamyl alcohol dehydrogenases (CAD)	Back alignment and domain information

>gnl\|CDD\|180054 PRK05396, tdh, L-threonine 3-dehydrogenase; Validated	Back alignment and domain information

>gnl\|CDD\|215721 pfam00107, ADH_zinc_N, Zinc-binding dehydrogenase	Back alignment and domain information

>gnl\|CDD\|176226 cd08265, Zn_ADH3, Alcohol dehydrogenases of the MDR family	Back alignment and domain information

>gnl\|CDD\|176211 cd08249, enoyl_reductase_like, enoyl_reductase_like	Back alignment and domain information

>gnl\|CDD\|176217 cd08255, 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_like, 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide and other MDR family members	Back alignment and domain information

>gnl\|CDD\|181842 PRK09422, PRK09422, ethanol-active dehydrogenase/acetaldehyde-active reductase; Provisional	Back alignment and domain information

>gnl\|CDD\|182371 PRK10309, PRK10309, galactitol-1-phosphate dehydrogenase; Provisional	Back alignment and domain information

>gnl\|CDD\|132245 TIGR03201, dearomat_had, 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase	Back alignment and domain information

>gnl\|CDD\|215378 PLN02702, PLN02702, L-idonate 5-dehydrogenase	Back alignment and domain information

>gnl\|CDD\|176191 cd05289, MDR_like_2, alcohol dehydrogenase and quinone reductase-like medium chain degydrogenases/reductases	Back alignment and domain information

>gnl\|CDD\|176237 cd08276, MDR7, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family	Back alignment and domain information

>gnl\|CDD\|176203 cd08241, QOR1, Quinone oxidoreductase (QOR)	Back alignment and domain information

>gnl\|CDD\|182229 PRK10083, PRK10083, putative oxidoreductase; Provisional	Back alignment and domain information

>gnl\|CDD\|234025 TIGR02819, fdhA_non_GSH, formaldehyde dehydrogenase, glutathione-independent	Back alignment and domain information

>gnl\|CDD\|176218 cd08256, Zn_ADH2, Alcohol dehydrogenases of the MDR family	Back alignment and domain information

>gnl\|CDD\|132409 TIGR03366, HpnZ_proposed, putative phosphonate catabolism associated alcohol dehydrogenase	Back alignment and domain information

>gnl\|CDD\|176189 cd05286, QOR2, Quinone oxidoreductase (QOR)	Back alignment and domain information

>gnl\|CDD\|176223 cd08262, Zn_ADH8, Alcohol dehydrogenases of the MDR family	Back alignment and domain information

>gnl\|CDD\|176205 cd08243, quinone_oxidoreductase_like_1, Quinone oxidoreductase (QOR)	Back alignment and domain information

>gnl\|CDD\|176215 cd08253, zeta_crystallin, Zeta-crystallin with NADP-dependent quinone reductase activity (QOR)	Back alignment and domain information

>gnl\|CDD\|166227 PLN02586, PLN02586, probable cinnamyl alcohol dehydrogenase	Back alignment and domain information

>gnl\|CDD\|176225 cd08264, Zn_ADH_like2, Alcohol dehydrogenases of the MDR family	Back alignment and domain information

>gnl\|CDD\|176229 cd08268, MDR2, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family	Back alignment and domain information

>gnl\|CDD\|176228 cd08267, MDR1, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family	Back alignment and domain information

>gnl\|CDD\|182130 PRK09880, PRK09880, L-idonate 5-dehydrogenase; Provisional	Back alignment and domain information

>gnl\|CDD\|176232 cd08271, MDR5, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family	Back alignment and domain information

>gnl\|CDD\|176233 cd08272, MDR6, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family	Back alignment and domain information

>gnl\|CDD\|176204 cd08242, MDR_like, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family	Back alignment and domain information

>gnl\|CDD\|176192 cd08230, glucose_DH, Glucose dehydrogenase	Back alignment and domain information

>gnl\|CDD\|166155 PLN02514, PLN02514, cinnamyl-alcohol dehydrogenase	Back alignment and domain information

>gnl\|CDD\|176645 cd05282, ETR_like, 2-enoyl thioester reductase-like	Back alignment and domain information

>gnl\|CDD\|176180 cd05276, p53_inducible_oxidoreductase, PIG3 p53-inducible quinone oxidoreductase	Back alignment and domain information

>gnl\|CDD\|177834 PLN02178, PLN02178, cinnamyl-alcohol dehydrogenase	Back alignment and domain information

>gnl\|CDD\|176252 cd08292, ETR_like_2, 2-enoyl thioester reductase (ETR) like proteins, child 2	Back alignment and domain information

>gnl\|CDD\|182701 PRK10754, PRK10754, quinone oxidoreductase, NADPH-dependent; Provisional	Back alignment and domain information

>gnl\|CDD\|176250 cd08290, ETR, 2-enoyl thioester reductase (ETR)	Back alignment and domain information

>gnl\|CDD\|176179 cd05195, enoyl_red, enoyl reductase of polyketide synthase	Back alignment and domain information

>gnl\|CDD\|176236 cd08275, MDR3, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family	Back alignment and domain information

>gnl\|CDD\|173547 PTZ00354, PTZ00354, alcohol dehydrogenase; Provisional	Back alignment and domain information

>gnl\|CDD\|225041 COG2130, COG2130, Putative NADP-dependent oxidoreductases [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|176214 cd08252, AL_MDR, Arginate lyase and other MDR family members	Back alignment and domain information

>gnl\|CDD\|131869 TIGR02822, adh_fam_2, zinc-binding alcohol dehydrogenase family protein	Back alignment and domain information

>gnl\|CDD\|176212 cd08250, Mgc45594_like, Mgc45594 gene product and other MDR family members	Back alignment and domain information

>gnl\|CDD\|176190 cd05288, PGDH, Prostaglandin dehydrogenases	Back alignment and domain information

>gnl\|CDD\|176213 cd08251, polyketide_synthase, polyketide synthase	Back alignment and domain information

>gnl\|CDD\|176208 cd08246, crotonyl_coA_red, crotonyl-CoA reductase	Back alignment and domain information

>gnl\|CDD\|188164 TIGR01751, crot-CoA-red, crotonyl-CoA reductase	Back alignment and domain information

>gnl\|CDD\|176234 cd08273, MDR8, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family	Back alignment and domain information

>gnl\|CDD\|214840 smart00829, PKS_ER, Enoylreductase	Back alignment and domain information

>gnl\|CDD\|234024 TIGR02817, adh_fam_1, zinc-binding alcohol dehydrogenase family protein	Back alignment and domain information

>gnl\|CDD\|176209 cd08247, AST1_like, AST1 is a cytoplasmic protein associated with the periplasmic membrane in yeast	Back alignment and domain information

>gnl\|CDD\|234027 TIGR02824, quinone_pig3, putative NAD(P)H quinone oxidoreductase, PIG3 family	Back alignment and domain information

>gnl\|CDD\|176206 cd08244, MDR_enoyl_red, Possible enoyl reductase	Back alignment and domain information

>gnl\|CDD\|216949 pfam02254, TrkA_N, TrkA-N domain	Back alignment and domain information

>gnl\|CDD\|133444 cd01075, NAD_bind_Leu_Phe_Val_DH, NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase	Back alignment and domain information

>gnl\|CDD\|234094 TIGR03026, NDP-sugDHase, nucleotide sugar dehydrogenase	Back alignment and domain information

>gnl\|CDD\|130269 TIGR01202, bchC, 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase	Back alignment and domain information

>gnl\|CDD\|176235 cd08274, MDR9, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family	Back alignment and domain information

>gnl\|CDD\|223749 COG0677, WecC, UDP-N-acetyl-D-mannosaminuronate dehydrogenase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>gnl\|CDD\|176251 cd08291, ETR_like_1, 2-enoyl thioester reductase (ETR) like proteins, child 1	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		371
KOG0022		375	consensus Alcohol dehydrogenase, class III [Second	100.0
COG1062		366	AdhC Zn-dependent alcohol dehydrogenases, class II	100.0
COG1064		339	AdhP Zn-dependent alcohol dehydrogenases [General	100.0
KOG0024		354	consensus Sorbitol dehydrogenase [Secondary metabo	100.0
KOG0023		360	consensus Alcohol dehydrogenase, class V [Secondar	100.0
TIGR02818		368	adh_III_F_hyde S-(hydroxymethyl)glutathione dehydr	100.0
cd08300		368	alcohol_DH_class_III class III alcohol dehydrogena	100.0
PLN02740		381	Alcohol dehydrogenase-like	100.0
cd08281		371	liver_ADH_like1 Zinc-dependent alcohol dehydrogena	100.0
cd08301		369	alcohol_DH_plants Plant alcohol dehydrogenase. NAD	100.0
TIGR03451		358	mycoS_dep_FDH mycothiol-dependent formaldehyde deh	100.0
PLN02827		378	Alcohol dehydrogenase-like	100.0
cd08277		365	liver_alcohol_DH_like Liver alcohol dehydrogenase.	100.0
cd08239		339	THR_DH_like L-threonine dehydrogenase (TDH)-like.	100.0
PRK09880		343	L-idonate 5-dehydrogenase; Provisional	100.0
COG1063		350	Tdh Threonine dehydrogenase and related Zn-depende	100.0
COG0604		326	Qor NADPH:quinone reductase and related Zn-depende	100.0
TIGR02819		393	fdhA_non_GSH formaldehyde dehydrogenase, glutathio	100.0
cd08299		373	alcohol_DH_class_I_II_IV class I, II, IV alcohol d	100.0
PRK10309		347	galactitol-1-phosphate dehydrogenase; Provisional	100.0
PLN02586		360	probable cinnamyl alcohol dehydrogenase	100.0
cd05279		365	Zn_ADH1 Liver alcohol dehydrogenase and related zi	100.0
cd08230		355	glucose_DH Glucose dehydrogenase. Glucose dehydrog	100.0
PLN02178		375	cinnamyl-alcohol dehydrogenase	100.0
TIGR03201		349	dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-Co	100.0
cd08231		361	MDR_TM0436_like Hypothetical enzyme TM0436 resembl	100.0
TIGR02822		329	adh_fam_2 zinc-binding alcohol dehydrogenase famil	100.0
cd08233		351	butanediol_DH_like (2R,3R)-2,3-butanediol dehydrog	100.0
PLN02514		357	cinnamyl-alcohol dehydrogenase	100.0
KOG1197		336	consensus Predicted quinone oxidoreductase [Energy	100.0
cd08278		365	benzyl_alcohol_DH Benzyl alcohol dehydrogenase. Be	100.0
cd08285		351	NADP_ADH NADP(H)-dependent alcohol dehydrogenases.	100.0
cd08279		363	Zn_ADH_class_III Class III alcohol dehydrogenase.	100.0
PRK10083		339	putative oxidoreductase; Provisional	100.0
cd08237		341	ribitol-5-phosphate_DH ribitol-5-phosphate dehydro	100.0
cd05278		347	FDH_like Formaldehyde dehydrogenases. Formaldehyde	100.0
cd08238		410	sorbose_phosphate_red L-sorbose-1-phosphate reduct	100.0
cd08296		333	CAD_like Cinnamyl alcohol dehydrogenases (CAD). Ci	100.0
cd08256		350	Zn_ADH2 Alcohol dehydrogenases of the MDR family.	100.0
cd08286		345	FDH_like_ADH2 formaldehyde dehydrogenase (FDH)-lik	100.0
cd08283		386	FDH_like_1 Glutathione-dependent formaldehyde dehy	100.0
TIGR01202		308	bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyl	100.0
cd05284		340	arabinose_DH_like D-arabinose dehydrogenase. This	100.0
cd08263		367	Zn_ADH10 Alcohol dehydrogenases of the MDR family.	100.0
cd08240		350	6_hydroxyhexanoate_dh_like 6-hydroxyhexanoate dehy	100.0
cd08260		345	Zn_ADH6 Alcohol dehydrogenases of the MDR family.	100.0
cd08284		344	FDH_like_2 Glutathione-dependent formaldehyde dehy	100.0
cd08291		324	ETR_like_1 2-enoyl thioester reductase (ETR) like	100.0
cd08246		393	crotonyl_coA_red crotonyl-CoA reductase. Crotonyl-	100.0
cd08282		375	PFDH_like Pseudomonas putida aldehyde-dismutating	100.0
PRK05396		341	tdh L-threonine 3-dehydrogenase; Validated	100.0
cd08287		345	FDH_like_ADH3 formaldehyde dehydrogenase (FDH)-lik	100.0
cd08262		341	Zn_ADH8 Alcohol dehydrogenases of the MDR family.	100.0
PLN02702		364	L-idonate 5-dehydrogenase	100.0
cd08261		337	Zn_ADH7 Alcohol dehydrogenases of the MDR family.	100.0
cd08242		319	MDR_like Medium chain dehydrogenases/reductase (MD	100.0
cd08235		343	iditol_2_DH_like L-iditol 2-dehydrogenase. Putativ	100.0
cd08254		338	hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carbo	100.0
TIGR01751		398	crot-CoA-red crotonyl-CoA reductase. The enzyme mo	100.0
cd08265		384	Zn_ADH3 Alcohol dehydrogenases of the MDR family.	100.0
PRK13771		334	putative alcohol dehydrogenase; Provisional	100.0
cd05285		343	sorbitol_DH Sorbitol dehydrogenase. Sorbitol and a	100.0
PRK09422		338	ethanol-active dehydrogenase/acetaldehyde-active r	100.0
cd08292		324	ETR_like_2 2-enoyl thioester reductase (ETR) like	100.0
cd05283		337	CAD1 Cinnamyl alcohol dehydrogenases (CAD). Cinnam	100.0
cd08236		343	sugar_DH NAD(P)-dependent sugar dehydrogenases. Th	100.0
cd05281		341	TDH Threonine dehydrogenase. L-threonine dehydroge	100.0
cd08297		341	CAD3 Cinnamyl alcohol dehydrogenases (CAD). These	100.0
cd08232		339	idonate-5-DH L-idonate 5-dehydrogenase. L-idonate	100.0
cd08259		332	Zn_ADH5 Alcohol dehydrogenases of the MDR family.	100.0
TIGR03366		280	HpnZ_proposed putative phosphonate catabolism asso	100.0
PLN03154		348	putative allyl alcohol dehydrogenase; Provisional	100.0
TIGR00692		340	tdh L-threonine 3-dehydrogenase. E. coli His-90 mo	100.0
cd08234		334	threonine_DH_like L-threonine dehydrogenase. L-thr	100.0
cd08266		342	Zn_ADH_like1 Alcohol dehydrogenases of the MDR fam	100.0
cd08293		345	PTGR2 Prostaglandin reductase. Prostaglandins and	100.0
KOG0025		354	consensus Zn2+-binding dehydrogenase (nuclear rece	100.0
cd08274		350	MDR9 Medium chain dehydrogenases/reductase (MDR)/z	100.0
cd08264		325	Zn_ADH_like2 Alcohol dehydrogenases of the MDR fam	100.0
cd08295		338	double_bond_reductase_like Arabidopsis alkenal dou	100.0
cd08294		329	leukotriene_B4_DH_like 13-PGR is a bifunctional en	100.0
cd08298		329	CAD2 Cinnamyl alcohol dehydrogenases (CAD). These	100.0
TIGR02825		325	B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15	100.0
PRK10754		327	quinone oxidoreductase, NADPH-dependent; Provision	100.0
cd08245		330	CAD Cinnamyl alcohol dehydrogenases (CAD) and rela	100.0
cd08290		341	ETR 2-enoyl thioester reductase (ETR). 2-enoyl thi	100.0
cd08258		306	Zn_ADH4 Alcohol dehydrogenases of the MDR family.	100.0
TIGR02817		336	adh_fam_1 zinc-binding alcohol dehydrogenase famil	100.0
cd08244		324	MDR_enoyl_red Possible enoyl reductase. Member ide	100.0
cd08276		336	MDR7 Medium chain dehydrogenases/reductase (MDR)/z	100.0
PTZ00354		334	alcohol dehydrogenase; Provisional	100.0
cd08249		339	enoyl_reductase_like enoyl_reductase_like. Member	100.0
cd08250		329	Mgc45594_like Mgc45594 gene product and other MDR	100.0
cd05280		325	MDR_yhdh_yhfp Yhdh and yhfp-like putative quinone	100.0
cd08270		305	MDR4 Medium chain dehydrogenases/reductase (MDR)/z	100.0
cd08243		320	quinone_oxidoreductase_like_1 Quinone oxidoreducta	100.0
KOG1198		347	consensus Zinc-binding oxidoreductase [Energy prod	100.0
cd05282		323	ETR_like 2-enoyl thioester reductase-like. 2-enoyl	100.0
cd08269		312	Zn_ADH9 Alcohol dehydrogenases of the MDR family.	100.0
TIGR02823		323	oxido_YhdH putative quinone oxidoreductase, YhdH/Y	100.0
cd08289		326	MDR_yhfp_like Yhfp putative quinone oxidoreductase	100.0
cd08252		336	AL_MDR Arginate lyase and other MDR family members	100.0
cd08248		350	RTN4I1 Human Reticulon 4 Interacting Protein 1. Hu	100.0
COG2130		340	Putative NADP-dependent oxidoreductases [General f	100.0
cd05286		320	QOR2 Quinone oxidoreductase (QOR). Quinone oxidore	100.0
cd08288		324	MDR_yhdh Yhdh putative quinone oxidoreductases. Yh	100.0
cd05276		323	p53_inducible_oxidoreductase PIG3 p53-inducible qu	100.0
cd08253		325	zeta_crystallin Zeta-crystallin with NADP-dependen	100.0
cd08271		325	MDR5 Medium chain dehydrogenases/reductase (MDR)/z	100.0
cd08247		352	AST1_like AST1 is a cytoplasmic protein associated	100.0
cd08272		326	MDR6 Medium chain dehydrogenases/reductase (MDR)/z	100.0
cd08273		331	MDR8 Medium chain dehydrogenases/reductase (MDR)/z	100.0
TIGR02824		325	quinone_pig3 putative NAD(P)H quinone oxidoreducta	100.0
cd08268		328	MDR2 Medium chain dehydrogenases/reductase (MDR)/z	100.0
cd05288		329	PGDH Prostaglandin dehydrogenases. Prostaglandins	100.0
cd05188		271	MDR Medium chain reductase/dehydrogenase (MDR)/zin	100.0
cd08251		303	polyketide_synthase polyketide synthase. Polyketid	100.0
cd05289		309	MDR_like_2 alcohol dehydrogenase and quinone reduc	100.0
cd08241		323	QOR1 Quinone oxidoreductase (QOR). QOR catalyzes t	100.0
cd08275		337	MDR3 Medium chain dehydrogenases/reductase (MDR)/z	100.0
cd08267		319	MDR1 Medium chain dehydrogenases/reductase (MDR)/z	100.0
cd05195		293	enoyl_red enoyl reductase of polyketide synthase.	99.97
smart00829		288	PKS_ER Enoylreductase. Enoylreductase in Polyketid	99.97
KOG1202		2376	consensus Animal-type fatty acid synthase and rela	99.96
cd08255		277	2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_	99.96
KOG1196		343	consensus Predicted NAD-dependent oxidoreductase [	99.94
PF08240		109	ADH_N: Alcohol dehydrogenase GroES-like domain; In	99.87
PF00107		130	ADH_zinc_N: Zinc-binding dehydrogenase; InterPro:	99.72
cd00401		413	AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado	99.44
PRK09424		509	pntA NAD(P) transhydrogenase subunit alpha; Provis	99.32
PF13602		127	ADH_zinc_N_2: Zinc-binding dehydrogenase; PDB: 3TQ	99.17
PRK11873		272	arsM arsenite S-adenosylmethyltransferase; Reviewe	98.53
TIGR00561		511	pntA NAD(P) transhydrogenase, alpha subunit. In so	98.53
PRK05476		425	S-adenosyl-L-homocysteine hydrolase; Provisional	98.29
PRK08306		296	dipicolinate synthase subunit A; Reviewed	98.21
TIGR00936		406	ahcY adenosylhomocysteinase. This enzyme hydrolyze	98.19
TIGR01035		417	hemA glutamyl-tRNA reductase. This enzyme, togethe	98.11
PLN02494		477	adenosylhomocysteinase	98.06
PRK00517		250	prmA ribosomal protein L11 methyltransferase; Revi	98.05
cd05213		311	NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain	98.02
TIGR00518		370	alaDH alanine dehydrogenase. The family of known L	97.88
PRK08324		681	short chain dehydrogenase; Validated	97.75
PTZ00075		476	Adenosylhomocysteinase; Provisional	97.72
PF01488		135	Shikimate_DH: Shikimate / quinate 5-dehydrogenase;	97.66
TIGR02853		287	spore_dpaA dipicolinic acid synthetase, A subunit.	97.65
COG2518		209	Pcm Protein-L-isoaspartate carboxylmethyltransfera	97.62
TIGR00406		288	prmA ribosomal protein L11 methyltransferase. Ribo	97.53
COG4221		246	Short-chain alcohol dehydrogenase of unknown speci	97.52
PRK12771		564	putative glutamate synthase (NADPH) small subunit;	97.52
PRK00045		423	hemA glutamyl-tRNA reductase; Reviewed	97.47
PRK05693		274	short chain dehydrogenase; Provisional	97.21
PRK05786		238	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	97.2
PRK06182		273	short chain dehydrogenase; Validated	97.19
PRK00377		198	cbiT cobalt-precorrin-6Y C(15)-methyltransferase;	97.05
KOG1209		289	consensus 1-Acyl dihydroxyacetone phosphate reduct	97.05
TIGR00438		188	rrmJ cell division protein FtsJ.	97.01
KOG1205		282	consensus Predicted dehydrogenase [Secondary metab	97.01
PF02826		178	2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy	96.99
PRK13943		322	protein-L-isoaspartate O-methyltransferase; Provis	96.96
PRK05993		277	short chain dehydrogenase; Provisional	96.94
COG2264		300	PrmA Ribosomal protein L11 methylase [Translation,	96.94
PRK04148		134	hypothetical protein; Provisional	96.94
PRK12742		237	oxidoreductase; Provisional	96.93
PRK11705		383	cyclopropane fatty acyl phospholipid synthase; Pro	96.93
PF00670		162	AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase	96.84
PRK07326		237	short chain dehydrogenase; Provisional	96.84
PF01262		168	AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal	96.8
COG2242		187	CobL Precorrin-6B methylase 2 [Coenzyme metabolism	96.78
PRK14967		223	putative methyltransferase; Provisional	96.75
cd01080		168	NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of	96.72
PRK12828		239	short chain dehydrogenase; Provisional	96.72
PRK13940		414	glutamyl-tRNA reductase; Provisional	96.71
PRK05872		296	short chain dehydrogenase; Provisional	96.71
PF11017		314	DUF2855: Protein of unknown function (DUF2855); In	96.71
COG0300		265	DltE Short-chain dehydrogenases of various substra	96.71
PF13241		103	NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_	96.67
PF13460		183	NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X	96.66
PRK08261		450	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	96.66
COG4122		219	Predicted O-methyltransferase [General function pr	96.65
PRK08017		256	oxidoreductase; Provisional	96.63
PRK07806		248	short chain dehydrogenase; Provisional	96.63
COG3967		245	DltE Short-chain dehydrogenase involved in D-alani	96.63
PRK08628		258	short chain dehydrogenase; Provisional	96.62
TIGR02469		124	CbiT precorrin-6Y C5,15-methyltransferase (decarbo	96.62
TIGR01809		282	Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO	96.59
PRK08265		261	short chain dehydrogenase; Provisional	96.57
PRK06139		330	short chain dehydrogenase; Provisional	96.57
PF02353		273	CMAS: Mycolic acid cyclopropane synthetase; InterP	96.55
PRK07576		264	short chain dehydrogenase; Provisional	96.54
PRK07231		251	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	96.54
PF01135		209	PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl	96.52
COG1748		389	LYS9 Saccharopine dehydrogenase and related protei	96.52
PRK13942		212	protein-L-isoaspartate O-methyltransferase; Provis	96.51
PRK08177		225	short chain dehydrogenase; Provisional	96.51
PRK07109		334	short chain dehydrogenase; Provisional	96.46
PRK06057		255	short chain dehydrogenase; Provisional	96.46
PRK07060		245	short chain dehydrogenase; Provisional	96.45
PRK12549		284	shikimate 5-dehydrogenase; Reviewed	96.45
cd05311		226	NAD_bind_2_malic_enz NAD(P) binding domain of mali	96.45
PF12847		112	Methyltransf_18: Methyltransferase domain; PDB: 3G	96.44
PLN03209		576	translocon at the inner envelope of chloroplast su	96.41
PRK00811		283	spermidine synthase; Provisional	96.38
PRK14175		286	bifunctional 5,10-methylene-tetrahydrofolate dehyd	96.35
PRK13944		205	protein-L-isoaspartate O-methyltransferase; Provis	96.32
PRK12939		250	short chain dehydrogenase; Provisional	96.32
PRK03369		488	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	96.32
TIGR01470		205	cysG_Nterm siroheme synthase, N-terminal domain. T	96.3
PRK06500		249	short chain dehydrogenase; Provisional	96.29
COG0169		283	AroE Shikimate 5-dehydrogenase [Amino acid transpo	96.29
PF06325		295	PrmA: Ribosomal protein L11 methyltransferase (Prm	96.25
COG0373		414	HemA Glutamyl-tRNA reductase [Coenzyme metabolism]	96.23
TIGR02356		202	adenyl_thiF thiazole biosynthesis adenylyltransfer	96.2
PRK08267		260	short chain dehydrogenase; Provisional	96.19
PRK06841		255	short chain dehydrogenase; Provisional	96.18
PRK06718		202	precorrin-2 dehydrogenase; Reviewed	96.18
PRK06128		300	oxidoreductase; Provisional	96.18
PRK08261		450	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	96.17
PRK06953		222	short chain dehydrogenase; Provisional	96.17
COG0686		371	Ald Alanine dehydrogenase [Amino acid transport an	96.16
PRK06949		258	short chain dehydrogenase; Provisional	96.16
PRK12550		272	shikimate 5-dehydrogenase; Reviewed	96.15
PRK07831		262	short chain dehydrogenase; Provisional	96.13
PRK00536		262	speE spermidine synthase; Provisional	96.13
PRK12829		264	short chain dehydrogenase; Provisional	96.1
PLN02366		308	spermidine synthase	96.1
PRK07814		263	short chain dehydrogenase; Provisional	96.09
TIGR03325		262	BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro	96.09
PRK05653		246	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	96.06
PRK07825		273	short chain dehydrogenase; Provisional	96.05
PRK06200		263	2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog	96.05
PRK06484		520	short chain dehydrogenase; Validated	96.05
TIGR00080		215	pimt protein-L-isoaspartate(D-aspartate) O-methylt	96.03
PRK14027		283	quinate/shikimate dehydrogenase; Provisional	96.03
PRK06398		258	aldose dehydrogenase; Validated	96.01
PRK07832		272	short chain dehydrogenase; Provisional	96.01
PRK00107		187	gidB 16S rRNA methyltransferase GidB; Reviewed	96.01
TIGR01832		248	kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod	95.96
PRK09186		256	flagellin modification protein A; Provisional	95.94
PRK09291		257	short chain dehydrogenase; Provisional	95.94
PRK06101		240	short chain dehydrogenase; Provisional	95.93
PLN02780		320	ketoreductase/ oxidoreductase	95.93
PRK06719		157	precorrin-2 dehydrogenase; Validated	95.92
PRK08339		263	short chain dehydrogenase; Provisional	95.91
PRK07502		307	cyclohexadienyl dehydrogenase; Validated	95.89
COG2519		256	GCD14 tRNA(1-methyladenosine) methyltransferase an	95.88
PRK06180		277	short chain dehydrogenase; Provisional	95.88
PRK08618		325	ornithine cyclodeaminase; Validated	95.86
PRK12548		289	shikimate 5-dehydrogenase; Provisional	95.86
PRK07774		250	short chain dehydrogenase; Provisional	95.86
PRK00258		278	aroE shikimate 5-dehydrogenase; Reviewed	95.86
PRK09242		257	tropinone reductase; Provisional	95.85
PRK05867		253	short chain dehydrogenase; Provisional	95.84
PRK12429		258	3-hydroxybutyrate dehydrogenase; Provisional	95.79
CHL00194		317	ycf39 Ycf39; Provisional	95.77
PRK08217		253	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	95.72
PRK06701		290	short chain dehydrogenase; Provisional	95.7
PRK06484		520	short chain dehydrogenase; Validated	95.69
PRK05866		293	short chain dehydrogenase; Provisional	95.66
TIGR01318		467	gltD_gamma_fam glutamate synthase small subunit fa	95.66
PRK08263		275	short chain dehydrogenase; Provisional	95.64
PRK14192		283	bifunctional 5,10-methylene-tetrahydrofolate dehyd	95.63
PRK06196		315	oxidoreductase; Provisional	95.62
PRK07904		253	short chain dehydrogenase; Provisional	95.61
PRK06198		260	short chain dehydrogenase; Provisional	95.6
PRK12749		288	quinate/shikimate dehydrogenase; Reviewed	95.59
PRK09072		263	short chain dehydrogenase; Provisional	95.59
PRK07985		294	oxidoreductase; Provisional	95.58
PRK12809		639	putative oxidoreductase Fe-S binding subunit; Revi	95.55
PRK07402		196	precorrin-6B methylase; Provisional	95.55
PRK06463		255	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	95.54
PRK12937		245	short chain dehydrogenase; Provisional	95.54
PRK06483		236	dihydromonapterin reductase; Provisional	95.54
PRK07533		258	enoyl-(acyl carrier protein) reductase; Provisiona	95.54
PRK07523		255	gluconate 5-dehydrogenase; Provisional	95.54
PRK07062		265	short chain dehydrogenase; Provisional	95.53
COG2227		243	UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-	95.52
cd01075		200	NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l	95.52
PRK08589		272	short chain dehydrogenase; Validated	95.5
PF03435		386	Saccharop_dh: Saccharopine dehydrogenase ; InterPr	95.5
PRK07024		257	short chain dehydrogenase; Provisional	95.5
PRK13394		262	3-hydroxybutyrate dehydrogenase; Provisional	95.49
PRK07478		254	short chain dehydrogenase; Provisional	95.49
PRK08703		239	short chain dehydrogenase; Provisional	95.48
cd00755		231	YgdL_like Family of activating enzymes (E1) of ubi	95.47
PRK11207		197	tellurite resistance protein TehB; Provisional	95.47
PRK15116		268	sulfur acceptor protein CsdL; Provisional	95.46
PRK06194		287	hypothetical protein; Provisional	95.45
PRK07890		258	short chain dehydrogenase; Provisional	95.45
PRK08594		257	enoyl-(acyl carrier protein) reductase; Provisiona	95.43
PLN02476		278	O-methyltransferase	95.43
PRK06179		270	short chain dehydrogenase; Provisional	95.41
PRK05717		255	oxidoreductase; Validated	95.41
PRK12475		338	thiamine/molybdopterin biosynthesis MoeB-like prot	95.41
PLN02781		234	Probable caffeoyl-CoA O-methyltransferase	95.39
PRK12481		251	2-deoxy-D-gluconate 3-dehydrogenase; Provisional	95.38
PRK06849		389	hypothetical protein; Provisional	95.38
PRK04457		262	spermidine synthase; Provisional	95.38
PRK06172		253	short chain dehydrogenase; Provisional	95.37
PRK12823		260	benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat	95.36
PRK05876		275	short chain dehydrogenase; Provisional	95.35
PRK07454		241	short chain dehydrogenase; Provisional	95.35
PRK06505		271	enoyl-(acyl carrier protein) reductase; Provisiona	95.34
PRK08213		259	gluconate 5-dehydrogenase; Provisional	95.32
PRK07677		252	short chain dehydrogenase; Provisional	95.31
PRK12367		245	short chain dehydrogenase; Provisional	95.31
PRK08264		238	short chain dehydrogenase; Validated	95.31
PRK06079		252	enoyl-(acyl carrier protein) reductase; Provisiona	95.29
PRK05884		223	short chain dehydrogenase; Provisional	95.27
PLN03075		296	nicotianamine synthase; Provisional	95.26
KOG1014		312	consensus 17 beta-hydroxysteroid dehydrogenase typ	95.26
PF00106		167	adh_short: short chain dehydrogenase alcohol dehyd	95.25
PRK07856		252	short chain dehydrogenase; Provisional	95.25
TIGR02355		240	moeB molybdopterin synthase sulfurylase MoeB. This	95.24
PRK08219		227	short chain dehydrogenase; Provisional	95.24
PRK06138		252	short chain dehydrogenase; Provisional	95.23
PRK06125		259	short chain dehydrogenase; Provisional	95.23
PRK06482		276	short chain dehydrogenase; Provisional	95.22
PRK08862		227	short chain dehydrogenase; Provisional	95.22
PRK07063		260	short chain dehydrogenase; Provisional	95.22
PRK07035		252	short chain dehydrogenase; Provisional	95.21
PRK06181		263	short chain dehydrogenase; Provisional	95.21
PRK06940		275	short chain dehydrogenase; Provisional	95.19
PRK07688		339	thiamine/molybdopterin biosynthesis ThiF/MoeB-like	95.19
PRK08644		212	thiamine biosynthesis protein ThiF; Provisional	95.18
PRK05854		313	short chain dehydrogenase; Provisional	95.18
PRK08226		263	short chain dehydrogenase; Provisional	95.17
PF01596		205	Methyltransf_3: O-methyltransferase; InterPro: IPR	95.17
TIGR02354		200	thiF_fam2 thiamine biosynthesis protein ThiF, fami	95.16
PRK08317		241	hypothetical protein; Provisional	95.16
PRK06114		254	short chain dehydrogenase; Provisional	95.15
PLN00203		519	glutamyl-tRNA reductase	95.15
cd01078		194	NAD_bind_H4MPT_DH NADP binding domain of methylene	95.14
COG2230		283	Cfa Cyclopropane fatty acid synthase and related m	95.13
COG1179		263	Dinucleotide-utilizing enzymes involved in molybdo	95.13
PRK01581		374	speE spermidine synthase; Validated	95.13
PRK08643		256	acetoin reductase; Validated	95.11
PRK08993		253	2-deoxy-D-gluconate 3-dehydrogenase; Validated	95.11
PF03446		163	NAD_binding_2: NAD binding domain of 6-phosphogluc	95.11
TIGR00507		270	aroE shikimate 5-dehydrogenase. This model finds p	95.09
PRK12769		654	putative oxidoreductase Fe-S binding subunit; Revi	95.08
PRK06935		258	2-deoxy-D-gluconate 3-dehydrogenase; Provisional	95.08
PRK14188		296	bifunctional 5,10-methylene-tetrahydrofolate dehyd	95.07
PRK06914		280	short chain dehydrogenase; Provisional	95.07
PLN02253		280	xanthoxin dehydrogenase	95.04
PRK07574		385	formate dehydrogenase; Provisional	95.04
PRK06077		252	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	95.04
COG3288		356	PntA NAD/NADP transhydrogenase alpha subunit [Ener	95.04
PRK07577		234	short chain dehydrogenase; Provisional	95.02
PRK07453		322	protochlorophyllide oxidoreductase; Validated	95.01
PRK06197		306	short chain dehydrogenase; Provisional	95.0
PF02254		116	TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg	95.0
PRK05690		245	molybdopterin biosynthesis protein MoeB; Provision	95.0
cd01065		155	NAD_bind_Shikimate_DH NAD(P) binding domain of Shi	94.99
KOG0725		270	consensus Reductases with broad range of substrate	94.99
COG2226		238	UbiE Methylase involved in ubiquinone/menaquinone	94.96
PRK12826		251	3-ketoacyl-(acyl-carrier-protein) reductase; Revie	94.95
PRK06124		256	gluconate 5-dehydrogenase; Provisional	94.94
PRK05875		276	short chain dehydrogenase; Provisional	94.94
PRK07074		257	short chain dehydrogenase; Provisional	94.93
PRK08220		252	2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated	94.92
PRK14191		285	bifunctional 5,10-methylene-tetrahydrofolate dehyd	94.92
PRK08277		278	D-mannonate oxidoreductase; Provisional	94.92
PF03807		96	F420_oxidored: NADP oxidoreductase coenzyme F420-d	94.91
PLN02823		336	spermine synthase	94.91
PRK06720		169	hypothetical protein; Provisional	94.9
COG0421		282	SpeE Spermidine synthase [Amino acid transport and	94.88
PRK10538		248	malonic semialdehyde reductase; Provisional	94.88
PRK07067		257	sorbitol dehydrogenase; Provisional	94.87
PRK08251		248	short chain dehydrogenase; Provisional	94.86
PLN02589		247	caffeoyl-CoA O-methyltransferase	94.86
PRK13243		333	glyoxylate reductase; Reviewed	94.82
PRK08085		254	gluconate 5-dehydrogenase; Provisional	94.81
COG0031		300	CysK Cysteine synthase [Amino acid transport and m	94.8
TIGR03840		213	TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d	94.8
PRK10792		285	bifunctional 5,10-methylene-tetrahydrofolate dehyd	94.79
PF02558		151	ApbA: Ketopantoate reductase PanE/ApbA; InterPro:	94.79
PRK14194		301	bifunctional 5,10-methylene-tetrahydrofolate dehyd	94.77
PLN03139		386	formate dehydrogenase; Provisional	94.77
PRK06603		260	enoyl-(acyl carrier protein) reductase; Provisiona	94.75
cd01483		143	E1_enzyme_family Superfamily of activating enzymes	94.75
PRK01683		258	trans-aconitate 2-methyltransferase; Provisional	94.75
PRK12936		245	3-ketoacyl-(acyl-carrier-protein) reductase NodG;	94.74
PRK08340		259	glucose-1-dehydrogenase; Provisional	94.71
PRK08415		274	enoyl-(acyl carrier protein) reductase; Provisiona	94.7
PRK07666		239	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	94.7
KOG1201		300	consensus Hydroxysteroid 17-beta dehydrogenase 11	94.69
PRK12384		259	sorbitol-6-phosphate dehydrogenase; Provisional	94.68
PLN02657		390	3,8-divinyl protochlorophyllide a 8-vinyl reductas	94.68
TIGR01963		255	PHB_DH 3-hydroxybutyrate dehydrogenase. This model	94.66
PRK08303		305	short chain dehydrogenase; Provisional	94.66
TIGR02622		349	CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member	94.66
PRK05562		223	precorrin-2 dehydrogenase; Provisional	94.62
PRK12746		254	short chain dehydrogenase; Provisional	94.58
PRK08328		231	hypothetical protein; Provisional	94.58
PRK15469		312	ghrA bifunctional glyoxylate/hydroxypyruvate reduc	94.56
TIGR00417		270	speE spermidine synthase. the SpeE subunit of sper	94.54
TIGR03206		250	benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr	94.53
cd01492		197	Aos1_SUMO Ubiquitin activating enzyme (E1) subunit	94.53
TIGR00477		195	tehB tellurite resistance protein TehB. Part of a	94.52
PRK07340		304	ornithine cyclodeaminase; Validated	94.51
PRK08762		376	molybdopterin biosynthesis protein MoeB; Validated	94.51
PRK14103		255	trans-aconitate 2-methyltransferase; Provisional	94.5
PRK08300		302	acetaldehyde dehydrogenase; Validated	94.5
PRK12743		256	oxidoreductase; Provisional	94.49
PRK12747		252	short chain dehydrogenase; Provisional	94.43
TIGR02632		676	RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc	94.43
cd01487		174	E1_ThiF_like E1_ThiF_like. Member of superfamily o	94.41
PRK13656		398	trans-2-enoyl-CoA reductase; Provisional	94.41
PRK07791		286	short chain dehydrogenase; Provisional	94.4
PRK08159		272	enoyl-(acyl carrier protein) reductase; Provisiona	94.39
PRK08690		261	enoyl-(acyl carrier protein) reductase; Provisiona	94.38
TIGR03215		285	ac_ald_DH_ac acetaldehyde dehydrogenase (acetylati	94.36
PRK00312		212	pcm protein-L-isoaspartate O-methyltransferase; Re	94.35
PRK08278		273	short chain dehydrogenase; Provisional	94.33
PF08704		247	GCD14: tRNA methyltransferase complex GCD14 subuni	94.32
PLN00141		251	Tic62-NAD(P)-related group II protein; Provisional	94.32
PRK07102		243	short chain dehydrogenase; Provisional	94.31
PRK07097		265	gluconate 5-dehydrogenase; Provisional	94.3
PF00899		135	ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a	94.27
PRK13255		218	thiopurine S-methyltransferase; Reviewed	94.27
cd00757		228	ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1	94.23
PRK06523		260	short chain dehydrogenase; Provisional	94.23
PRK07417		279	arogenate dehydrogenase; Reviewed	94.21
PRK05650		270	short chain dehydrogenase; Provisional	94.2
PLN02928		347	oxidoreductase family protein	94.19
PRK08945		247	putative oxoacyl-(acyl carrier protein) reductase;	94.14
PRK06113		255	7-alpha-hydroxysteroid dehydrogenase; Validated	94.09
PRK07424		406	bifunctional sterol desaturase/short chain dehydro	94.06
PRK05597		355	molybdopterin biosynthesis protein MoeB; Validated	94.06
COG2910		211	Putative NADH-flavin reductase [General function p	94.03
PRK14189		285	bifunctional 5,10-methylene-tetrahydrofolate dehyd	94.0
PRK07984		262	enoyl-(acyl carrier protein) reductase; Provisiona	94.0
PRK14982		340	acyl-ACP reductase; Provisional	93.99
PRK08063		250	enoyl-(acyl carrier protein) reductase; Provisiona	93.96
KOG1252		362	consensus Cystathionine beta-synthase and related	93.96
PRK13403		335	ketol-acid reductoisomerase; Provisional	93.93
PRK05557		248	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	93.92
PRK05600		370	thiamine biosynthesis protein ThiF; Validated	93.91
PRK06171		266	sorbitol-6-phosphate 2-dehydrogenase; Provisional	93.9
PLN02520		529	bifunctional 3-dehydroquinate dehydratase/shikimat	93.87
PRK08287		187	cobalt-precorrin-6Y C(15)-methyltransferase; Valid	93.86
PTZ00098		263	phosphoethanolamine N-methyltransferase; Provision	93.83
COG0334		411	GdhA Glutamate dehydrogenase/leucine dehydrogenase	93.83
PRK12938		246	acetyacetyl-CoA reductase; Provisional	93.81
PF01210		157	NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate	93.77
PF02670		129	DXP_reductoisom: 1-deoxy-D-xylulose 5-phosphate re	93.76
PRK04266		226	fibrillarin; Provisional	93.75
PLN02244		340	tocopherol O-methyltransferase	93.74
PRK07370		258	enoyl-(acyl carrier protein) reductase; Validated	93.73
PRK01438		480	murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn	93.73
PRK07792		306	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	93.7
PRK14618		328	NAD(P)H-dependent glycerol-3-phosphate dehydrogena	93.66
PF13823		23	ADH_N_assoc: Alcohol dehydrogenase GroES-associate	93.65
COG1648		210	CysG Siroheme synthase (precorrin-2 oxidase/ferroc	93.62
TIGR00138		181	gidB 16S rRNA methyltransferase GidB. GidB (glucos	93.61
PRK03562		621	glutathione-regulated potassium-efflux system prot	93.6
TIGR01505		291	tartro_sem_red 2-hydroxy-3-oxopropionate reductase	93.6
PRK09135		249	pteridine reductase; Provisional	93.59
PRK08416		260	7-alpha-hydroxysteroid dehydrogenase; Provisional	93.59
PRK10669		558	putative cation:proton antiport protein; Provision	93.55
COG0569		225	TrkA K+ transport systems, NAD-binding component [	93.55
PF01564		246	Spermine_synth: Spermine/spermidine synthase; Inte	93.53
TIGR02415		254	23BDH acetoin reductases. One member of this famil	93.5
KOG1199		260	consensus Short-chain alcohol dehydrogenase/3-hydr	93.5
COG1052		324	LdhA Lactate dehydrogenase and related dehydrogena	93.48
cd05211		217	NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of	93.46
cd05191		86	NAD_bind_amino_acid_DH NAD(P) binding domain of am	93.46
PLN02735		1102	carbamoyl-phosphate synthase	93.43
PRK06522		304	2-dehydropantoate 2-reductase; Reviewed	93.43
PF07991		165	IlvN: Acetohydroxy acid isomeroreductase, catalyti	93.42
PRK12480		330	D-lactate dehydrogenase; Provisional	93.39
cd05212		140	NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom	93.39
PF02737		180	3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind	93.37
PRK12825		249	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	93.37
PRK12745		256	3-ketoacyl-(acyl-carrier-protein) reductase; Provi	93.36
PRK05708		305	2-dehydropantoate 2-reductase; Provisional	93.36
PF02719		293	Polysacc_synt_2: Polysaccharide biosynthesis prote	93.33
PRK06141		314	ornithine cyclodeaminase; Validated	93.32
PRK11036		255	putative S-adenosyl-L-methionine-dependent methylt	93.3
PRK03659		601	glutathione-regulated potassium-efflux system prot	93.24
PRK08936		261	glucose-1-dehydrogenase; Provisional	93.24
PLN02986		322	cinnamyl-alcohol dehydrogenase family protein	93.23
PRK07775		274	short chain dehydrogenase; Provisional	93.22
PRK07066		321	3-hydroxybutyryl-CoA dehydrogenase; Validated	93.19
PRK07889		256	enoyl-(acyl carrier protein) reductase; Provisiona	93.19
PRK05565		247	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	93.1
TIGR00452		314	methyltransferase, putative. Known examples to dat	93.07
COG0673		342	MviM Predicted dehydrogenases and related proteins	93.01
PF01408		120	GFO_IDH_MocA: Oxidoreductase family, NAD-binding R	92.99
PRK07578		199	short chain dehydrogenase; Provisional	92.98
PRK11559		296	garR tartronate semialdehyde reductase; Provisiona	92.97
PRK06947		248	glucose-1-dehydrogenase; Provisional	92.93
PRK07819		286	3-hydroxybutyryl-CoA dehydrogenase; Validated	92.91
PRK09134		258	short chain dehydrogenase; Provisional	92.9
PRK12935		247	acetoacetyl-CoA reductase; Provisional	92.87
PRK06436		303	glycerate dehydrogenase; Provisional	92.85
PLN02256		304	arogenate dehydrogenase	92.84
KOG1207		245	consensus Diacetyl reductase/L-xylulose reductase	92.84
PF10727		127	Rossmann-like: Rossmann-like domain; InterPro: IPR	92.84
TIGR01472		343	gmd GDP-mannose 4,6-dehydratase. Excluded from thi	92.83

>KOG0022 consensus Alcohol dehydrogenase, class III [Secondary metabolites biosynthesis, transport and catabolism]	Back alignment and domain information

Probab=100.00  E-value=9.9e-69  Score=463.76  Aligned_cols=369  Identities=74%  Similarity=1.264  Sum_probs=358.5

Q ss_pred             CcceEEeecCCCCeEEEEeeCCCCCCCeEEEEEeeeecCccccccccCCCCCCCCCcccccceeEEEEEeCCCCCCCCCC
Q 017431            1 MCKAAVAWEPNKPLVIEDVQVAPPQAGEVRIKILFTALCHTDAYTWSGKDPEGLFPCILGHEAAGIVESVGEGVTEVQPG   80 (371)
Q Consensus         1 ~~~a~~~~~~~~~~~~~~~~~~~~~~~eVlV~v~~~~i~~~D~~~~~g~~~~~~~p~v~G~e~~G~V~~~G~~v~~~~~G   80 (371)
                      +|||++.|++++||.++++.+++|+..||+||+.++++|++|.+.|+|..+...+|.++|||.+|+|+++|..|+++++|
T Consensus         7 ~CKAAV~w~a~~PL~IEei~V~pPka~EVRIKI~~t~vCHTD~~~~~g~~~~~~fP~IlGHEaaGIVESvGegV~~vk~G   86 (375)
T KOG0022|consen    7 TCKAAVAWEAGKPLVIEEIEVAPPKAHEVRIKILATGVCHTDAYVWSGKDPEGLFPVILGHEAAGIVESVGEGVTTVKPG   86 (375)
T ss_pred             EEeEeeeccCCCCeeEEEEEeCCCCCceEEEEEEEEeeccccceeecCCCccccCceEecccceeEEEEecCCccccCCC
Confidence            58999999999999999999999999999999999999999999999998877899999999999999999999999999


Q ss_pred             CEEeecCCCCCCCCccccCCCCcccccccCCCccceecCCCccccccCCcceeeccCCcceeeeEEecccceEecCCCCC
Q 017431           81 DHVIPCYQAECRECKFCKSGKTNLCGKVRGATGAGVMMNDRKSRFSINGKPIYHFMGTSTFSQYTVVHDVSVAKIDPQAP  160 (371)
Q Consensus        81 d~V~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~g~~~~~~~~~~~~~~~~~g~~a~~~~v~~~~v~~lP~~~~  160 (371)
                      |+|+......|+.|.+|+++..|+|.+++..+..+..+.||++|+.-+|+.+||++++.+|+||.+++...+++|++..+
T Consensus        87 D~Viplf~p~CgeCk~C~s~ktNlC~~~~~~~~~~~~~~DgtSRF~~~gk~iyHfmg~StFsEYTVv~~~~v~kId~~aP  166 (375)
T KOG0022|consen   87 DHVIPLFTPQCGECKFCKSPKTNLCEKFRADNGKGGMPYDGTSRFTCKGKPIYHFMGTSTFSEYTVVDDISVAKIDPSAP  166 (375)
T ss_pred             CEEeeccccCCCCcccccCCCCChhhhhcccccccccccCCceeeeeCCCceEEecccccceeEEEeecceeEecCCCCC
Confidence            99999999999999999999999999999998888887899999999999999999999999999999999999999999


Q ss_pred             cchhhhccccchhhhhhhhhcCCCCCCCEEEEEcCChHHHHHHHHHHHcCCCeEEEEcCChhhHHHHHhcCCcEEecCCC
Q 017431          161 LDKVCLLGCGVPTGLGAVWNTAKVEPGSIVAVFGLGTVGLAVAEGAKAAGASRVIGIDIDPKKFDRAKNFGVTEFVNPKD  240 (371)
Q Consensus       161 ~~~aa~~~~~~~ta~~~l~~~~~~~~g~~VlI~Gag~vG~~ai~la~~~g~~~v~~v~~~~~~~~~~~~~g~~~vi~~~~  240 (371)
                      ++.++++.|...|+|.|.+..+.+++|++|.|.|-|++|+++++-||+.||.++++++.+++|.+.+++||+.+++|+.+
T Consensus       167 l~kvcLLgCGvsTG~GAa~~~Akv~~GstvAVfGLG~VGLav~~Gaka~GAsrIIgvDiN~~Kf~~ak~fGaTe~iNp~d  246 (375)
T KOG0022|consen  167 LEKVCLLGCGVSTGYGAAWNTAKVEPGSTVAVFGLGGVGLAVAMGAKAAGASRIIGVDINPDKFEKAKEFGATEFINPKD  246 (375)
T ss_pred             hhheeEeeccccccchhhhhhcccCCCCEEEEEecchHHHHHHHhHHhcCcccEEEEecCHHHHHHHHhcCcceecChhh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999987


Q ss_pred             CCchHHHHHHhhcCCCccEEEEccCCHHHHHHHHHHhccCCceEEEEccCCCCCcccccchheeeceEEEeeecCCCccc
Q 017431          241 HDKPIQQVLVDLTDGGVDYSFECIGNVSVMRAALECCHKGWGTSVIVGVAASGQEISTRPFQLVTGRVWKGTAFGGFKSR  320 (371)
Q Consensus       241 ~~~~~~~~~~~~~~gg~dvvid~~g~~~~~~~~~~~l~~~~G~iv~~g~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~  320 (371)
                      .....++.+.+.|++|+|+.|+|+|+.+++++++.+...+||+-|.+|....++.+++.++.++.++++.|+.++.++.+
T Consensus       247 ~~~~i~evi~EmTdgGvDysfEc~G~~~~m~~al~s~h~GwG~sv~iGv~~~~~~i~~~p~~l~~GR~~~Gs~FGG~K~~  326 (375)
T KOG0022|consen  247 LKKPIQEVIIEMTDGGVDYSFECIGNVSTMRAALESCHKGWGKSVVIGVAAAGQEISTRPFQLVTGRTWKGSAFGGFKSK  326 (375)
T ss_pred             ccccHHHHHHHHhcCCceEEEEecCCHHHHHHHHHHhhcCCCeEEEEEecCCCcccccchhhhccccEEEEEecccccch
Confidence            65678899999999999999999999999999999999999999999999889999999999999999999999999999


Q ss_pred             CcHHHHHHHHHcCCCCCCCceeeeeecccHHHHHHHHhCCCeeEEEEec
Q 017431          321 SQVPWLVDKYMKKEIKVDEYVTHNMTLGEINEAFRYMHGGDCLRCVLKM  369 (371)
Q Consensus       321 ~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~A~~~~~~~~~~kvvl~~  369 (371)
                      .+++.+++.+.++++++.++|+|++||+++++||+.|.+++.+|.||.+
T Consensus       327 ~~iP~lV~~y~~~~l~ld~~ITh~l~f~~In~AF~ll~~GksiR~vl~~  375 (375)
T KOG0022|consen  327 SDIPKLVKDYMKKKLNLDEFITHELPFEEINKAFDLLHEGKSIRCVLWM  375 (375)
T ss_pred             hhhhHHHHHHHhCccchhhhhhcccCHHHHHHHHHHHhCCceEEEEEeC
Confidence            9999999999999999999999999999999999999999999999864

>COG1062 AdhC Zn-dependent alcohol dehydrogenases, class III [Energy production and conversion]	Back alignment and domain information

>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only]	Back alignment and domain information

>KOG0024 consensus Sorbitol dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism]	Back alignment and domain information

>KOG0023 consensus Alcohol dehydrogenase, class V [Secondary metabolites biosynthesis, transport and catabolism]	Back alignment and domain information

>TIGR02818 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase	Back alignment and domain information

>cd08300 alcohol_DH_class_III class III alcohol dehydrogenases	Back alignment and domain information

>PLN02740 Alcohol dehydrogenase-like	Back alignment and domain information

>cd08281 liver_ADH_like1 Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase)	Back alignment and domain information

>cd08301 alcohol_DH_plants Plant alcohol dehydrogenase	Back alignment and domain information

>TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase	Back alignment and domain information

>PLN02827 Alcohol dehydrogenase-like	Back alignment and domain information

>cd08277 liver_alcohol_DH_like Liver alcohol dehydrogenase	Back alignment and domain information

>cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like	Back alignment and domain information

>PRK09880 L-idonate 5-dehydrogenase; Provisional	Back alignment and domain information

>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only]	Back alignment and domain information

>COG0604 Qor NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only]	Back alignment and domain information

>TIGR02819 fdhA_non_GSH formaldehyde dehydrogenase, glutathione-independent	Back alignment and domain information

>cd08299 alcohol_DH_class_I_II_IV class I, II, IV alcohol dehydrogenases	Back alignment and domain information

>PRK10309 galactitol-1-phosphate dehydrogenase; Provisional	Back alignment and domain information

>PLN02586 probable cinnamyl alcohol dehydrogenase	Back alignment and domain information

>cd05279 Zn_ADH1 Liver alcohol dehydrogenase and related zinc-dependent alcohol dehydrogenases	Back alignment and domain information

>cd08230 glucose_DH Glucose dehydrogenase	Back alignment and domain information

>PLN02178 cinnamyl-alcohol dehydrogenase	Back alignment and domain information

>TIGR03201 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase	Back alignment and domain information

>cd08231 MDR_TM0436_like Hypothetical enzyme TM0436 resembles the zinc-dependent alcohol dehydrogenases (ADH)	Back alignment and domain information

>TIGR02822 adh_fam_2 zinc-binding alcohol dehydrogenase family protein	Back alignment and domain information

>cd08233 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrogenase	Back alignment and domain information

>PLN02514 cinnamyl-alcohol dehydrogenase	Back alignment and domain information

>KOG1197 consensus Predicted quinone oxidoreductase [Energy production and conversion; General function prediction only]	Back alignment and domain information

>cd08278 benzyl_alcohol_DH Benzyl alcohol dehydrogenase	Back alignment and domain information

>cd08285 NADP_ADH NADP(H)-dependent alcohol dehydrogenases	Back alignment and domain information

>cd08279 Zn_ADH_class_III Class III alcohol dehydrogenase	Back alignment and domain information

>PRK10083 putative oxidoreductase; Provisional	Back alignment and domain information

>cd08237 ribitol-5-phosphate_DH ribitol-5-phosphate dehydrogenase	Back alignment and domain information

>cd05278 FDH_like Formaldehyde dehydrogenases	Back alignment and domain information

>cd08238 sorbose_phosphate_red L-sorbose-1-phosphate reductase	Back alignment and domain information

>cd08296 CAD_like Cinnamyl alcohol dehydrogenases (CAD)	Back alignment and domain information

>cd08256 Zn_ADH2 Alcohol dehydrogenases of the MDR family	Back alignment and domain information

>cd08286 FDH_like_ADH2 formaldehyde dehydrogenase (FDH)-like	Back alignment and domain information

>cd08283 FDH_like_1 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 1	Back alignment and domain information

>TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase	Back alignment and domain information

>cd05284 arabinose_DH_like D-arabinose dehydrogenase	Back alignment and domain information

>cd08263 Zn_ADH10 Alcohol dehydrogenases of the MDR family	Back alignment and domain information

>cd08240 6_hydroxyhexanoate_dh_like 6-hydroxyhexanoate dehydrogenase	Back alignment and domain information

>cd08260 Zn_ADH6 Alcohol dehydrogenases of the MDR family	Back alignment and domain information

>cd08284 FDH_like_2 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 2	Back alignment and domain information

>cd08291 ETR_like_1 2-enoyl thioester reductase (ETR) like proteins, child 1	Back alignment and domain information

>cd08246 crotonyl_coA_red crotonyl-CoA reductase	Back alignment and domain information

>cd08282 PFDH_like Pseudomonas putida aldehyde-dismutating formaldehyde dehydrogenase (PFDH)	Back alignment and domain information

>PRK05396 tdh L-threonine 3-dehydrogenase; Validated	Back alignment and domain information

>cd08287 FDH_like_ADH3 formaldehyde dehydrogenase (FDH)-like	Back alignment and domain information

>cd08262 Zn_ADH8 Alcohol dehydrogenases of the MDR family	Back alignment and domain information

>PLN02702 L-idonate 5-dehydrogenase	Back alignment and domain information

>cd08261 Zn_ADH7 Alcohol dehydrogenases of the MDR family	Back alignment and domain information

>cd08242 MDR_like Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family	Back alignment and domain information

>cd08235 iditol_2_DH_like L-iditol 2-dehydrogenase	Back alignment and domain information

>cd08254 hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase, N-benzyl-3-pyrrolidinol dehydrogenase, and other MDR family members	Back alignment and domain information

>TIGR01751 crot-CoA-red crotonyl-CoA reductase	Back alignment and domain information

>cd08265 Zn_ADH3 Alcohol dehydrogenases of the MDR family	Back alignment and domain information

>PRK13771 putative alcohol dehydrogenase; Provisional	Back alignment and domain information

>cd05285 sorbitol_DH Sorbitol dehydrogenase	Back alignment and domain information

>PRK09422 ethanol-active dehydrogenase/acetaldehyde-active reductase; Provisional	Back alignment and domain information

>cd08292 ETR_like_2 2-enoyl thioester reductase (ETR) like proteins, child 2	Back alignment and domain information

>cd05283 CAD1 Cinnamyl alcohol dehydrogenases (CAD)	Back alignment and domain information

>cd08236 sugar_DH NAD(P)-dependent sugar dehydrogenases	Back alignment and domain information

>cd05281 TDH Threonine dehydrogenase	Back alignment and domain information

>cd08297 CAD3 Cinnamyl alcohol dehydrogenases (CAD)	Back alignment and domain information

>cd08232 idonate-5-DH L-idonate 5-dehydrogenase	Back alignment and domain information

>cd08259 Zn_ADH5 Alcohol dehydrogenases of the MDR family	Back alignment and domain information

>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase	Back alignment and domain information

>PLN03154 putative allyl alcohol dehydrogenase; Provisional	Back alignment and domain information

>TIGR00692 tdh L-threonine 3-dehydrogenase	Back alignment and domain information

>cd08234 threonine_DH_like L-threonine dehydrogenase	Back alignment and domain information

>cd08266 Zn_ADH_like1 Alcohol dehydrogenases of the MDR family	Back alignment and domain information

>cd08293 PTGR2 Prostaglandin reductase	Back alignment and domain information

>KOG0025 consensus Zn2+-binding dehydrogenase (nuclear receptor binding factor-1) [Transcription; Energy production and conversion]	Back alignment and domain information

>cd08274 MDR9 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family	Back alignment and domain information

>cd08264 Zn_ADH_like2 Alcohol dehydrogenases of the MDR family	Back alignment and domain information

>cd08295 double_bond_reductase_like Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase	Back alignment and domain information

>cd08294 leukotriene_B4_DH_like 13-PGR is a bifunctional enzyme with delta-13 15-prostaglandin reductase and leukotriene B4 12 hydroxydehydrogenase activity	Back alignment and domain information

>cd08298 CAD2 Cinnamyl alcohol dehydrogenases (CAD)	Back alignment and domain information

>TIGR02825 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase	Back alignment and domain information

>PRK10754 quinone oxidoreductase, NADPH-dependent; Provisional	Back alignment and domain information

>cd08245 CAD Cinnamyl alcohol dehydrogenases (CAD) and related proteins	Back alignment and domain information

>cd08290 ETR 2-enoyl thioester reductase (ETR)	Back alignment and domain information

>cd08258 Zn_ADH4 Alcohol dehydrogenases of the MDR family	Back alignment and domain information

>TIGR02817 adh_fam_1 zinc-binding alcohol dehydrogenase family protein	Back alignment and domain information

>cd08244 MDR_enoyl_red Possible enoyl reductase	Back alignment and domain information

>cd08276 MDR7 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family	Back alignment and domain information

>PTZ00354 alcohol dehydrogenase; Provisional	Back alignment and domain information

>cd08249 enoyl_reductase_like enoyl_reductase_like	Back alignment and domain information

>cd08250 Mgc45594_like Mgc45594 gene product and other MDR family members	Back alignment and domain information

>cd05280 MDR_yhdh_yhfp Yhdh and yhfp-like putative quinone oxidoreductases	Back alignment and domain information

>cd08270 MDR4 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family	Back alignment and domain information

>cd08243 quinone_oxidoreductase_like_1 Quinone oxidoreductase (QOR)	Back alignment and domain information

>KOG1198 consensus Zinc-binding oxidoreductase [Energy production and conversion; General function prediction only]	Back alignment and domain information

>cd05282 ETR_like 2-enoyl thioester reductase-like	Back alignment and domain information

>cd08269 Zn_ADH9 Alcohol dehydrogenases of the MDR family	Back alignment and domain information

>TIGR02823 oxido_YhdH putative quinone oxidoreductase, YhdH/YhfP family	Back alignment and domain information

>cd08289 MDR_yhfp_like Yhfp putative quinone oxidoreductases	Back alignment and domain information

>cd08252 AL_MDR Arginate lyase and other MDR family members	Back alignment and domain information

>cd08248 RTN4I1 Human Reticulon 4 Interacting Protein 1	Back alignment and domain information

>COG2130 Putative NADP-dependent oxidoreductases [General function prediction only]	Back alignment and domain information

>cd05286 QOR2 Quinone oxidoreductase (QOR)	Back alignment and domain information

>cd08288 MDR_yhdh Yhdh putative quinone oxidoreductases	Back alignment and domain information

>cd05276 p53_inducible_oxidoreductase PIG3 p53-inducible quinone oxidoreductase	Back alignment and domain information

>cd08253 zeta_crystallin Zeta-crystallin with NADP-dependent quinone reductase activity (QOR)	Back alignment and domain information

>cd08271 MDR5 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family	Back alignment and domain information

>cd08247 AST1_like AST1 is a cytoplasmic protein associated with the periplasmic membrane in yeast	Back alignment and domain information

>cd08272 MDR6 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family	Back alignment and domain information

>cd08273 MDR8 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family	Back alignment and domain information

>TIGR02824 quinone_pig3 putative NAD(P)H quinone oxidoreductase, PIG3 family	Back alignment and domain information

>cd08268 MDR2 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family	Back alignment and domain information

>cd05288 PGDH Prostaglandin dehydrogenases	Back alignment and domain information

>cd05188 MDR Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family	Back alignment and domain information

>cd08251 polyketide_synthase polyketide synthase	Back alignment and domain information

>cd05289 MDR_like_2 alcohol dehydrogenase and quinone reductase-like medium chain degydrogenases/reductases	Back alignment and domain information

>cd08241 QOR1 Quinone oxidoreductase (QOR)	Back alignment and domain information

>cd08275 MDR3 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family	Back alignment and domain information

>cd08267 MDR1 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family	Back alignment and domain information

>cd05195 enoyl_red enoyl reductase of polyketide synthase	Back alignment and domain information

>smart00829 PKS_ER Enoylreductase	Back alignment and domain information

>KOG1202 consensus Animal-type fatty acid synthase and related proteins [Lipid transport and metabolism]	Back alignment and domain information

>cd08255 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_like 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide and other MDR family members	Back alignment and domain information

>KOG1196 consensus Predicted NAD-dependent oxidoreductase [General function prediction only]	Back alignment and domain information

>PF08240 ADH_N: Alcohol dehydrogenase GroES-like domain; InterPro: IPR013154 This is the catalytic domain of alcohol dehydrogenases (1	Back alignment and domain information

>PF00107 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: IPR013149 Alcohol dehydrogenase (1	Back alignment and domain information

>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy)	Back alignment and domain information

>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional	Back alignment and domain information

>PF13602 ADH_zinc_N_2: Zinc-binding dehydrogenase; PDB: 3TQH_A 2VN8_A 3GOH_A 4A27_A	Back alignment and domain information

>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed	Back alignment and domain information

>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit	Back alignment and domain information

>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional	Back alignment and domain information

>PRK08306 dipicolinate synthase subunit A; Reviewed	Back alignment and domain information

>TIGR00936 ahcY adenosylhomocysteinase	Back alignment and domain information

>TIGR01035 hemA glutamyl-tRNA reductase	Back alignment and domain information

>PLN02494 adenosylhomocysteinase	Back alignment and domain information

>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed	Back alignment and domain information

>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase	Back alignment and domain information

>TIGR00518 alaDH alanine dehydrogenase	Back alignment and domain information

>PRK08324 short chain dehydrogenase; Validated	Back alignment and domain information

>PTZ00075 Adenosylhomocysteinase; Provisional	Back alignment and domain information

>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases	Back alignment and domain information

>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit	Back alignment and domain information

>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR00406 prmA ribosomal protein L11 methyltransferase	Back alignment and domain information

>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only]	Back alignment and domain information

>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional	Back alignment and domain information

>PRK00045 hemA glutamyl-tRNA reductase; Reviewed	Back alignment and domain information

>PRK05693 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PRK06182 short chain dehydrogenase; Validated	Back alignment and domain information

>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional	Back alignment and domain information

>KOG1209 consensus 1-Acyl dihydroxyacetone phosphate reductase and related dehydrogenases [Secondary metabolites biosynthesis, transport and catabolism]	Back alignment and domain information

>TIGR00438 rrmJ cell division protein FtsJ	Back alignment and domain information

>KOG1205 consensus Predicted dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism]	Back alignment and domain information

>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related	Back alignment and domain information

>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional	Back alignment and domain information

>PRK05993 short chain dehydrogenase; Provisional	Back alignment and domain information

>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK04148 hypothetical protein; Provisional	Back alignment and domain information

>PRK12742 oxidoreductase; Provisional	Back alignment and domain information

>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional	Back alignment and domain information

>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3	Back alignment and domain information

>PRK07326 short chain dehydrogenase; Provisional	Back alignment and domain information

>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1	Back alignment and domain information

>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism]	Back alignment and domain information

>PRK14967 putative methyltransferase; Provisional	Back alignment and domain information

>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase	Back alignment and domain information

>PRK12828 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK13940 glutamyl-tRNA reductase; Provisional	Back alignment and domain information

>PRK05872 short chain dehydrogenase; Provisional	Back alignment and domain information

>PF11017 DUF2855: Protein of unknown function (DUF2855); InterPro: IPR021276 This family of proteins has no known function	Back alignment and domain information

>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only]	Back alignment and domain information

>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B	Back alignment and domain information

>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B	Back alignment and domain information

>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>COG4122 Predicted O-methyltransferase [General function prediction only]	Back alignment and domain information

>PRK08017 oxidoreductase; Provisional	Back alignment and domain information

>PRK07806 short chain dehydrogenase; Provisional	Back alignment and domain information

>COG3967 DltE Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PRK08628 short chain dehydrogenase; Provisional	Back alignment and domain information

>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit	Back alignment and domain information

>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type	Back alignment and domain information

>PRK08265 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06139 short chain dehydrogenase; Provisional	Back alignment and domain information

>PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4)	Back alignment and domain information

>PRK07576 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2	Back alignment and domain information

>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism]	Back alignment and domain information

>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional	Back alignment and domain information

>PRK08177 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07109 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06057 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07060 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK12549 shikimate 5-dehydrogenase; Reviewed	Back alignment and domain information

>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2	Back alignment and domain information

>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A	Back alignment and domain information

>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional	Back alignment and domain information

>PRK00811 spermidine synthase; Provisional	Back alignment and domain information

>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional	Back alignment and domain information

>PRK12939 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain	Back alignment and domain information

>PRK06500 short chain dehydrogenase; Provisional	Back alignment and domain information

>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism]	Back alignment and domain information

>PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences	Back alignment and domain information

>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism]	Back alignment and domain information

>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E	Back alignment and domain information

>PRK08267 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06841 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06718 precorrin-2 dehydrogenase; Reviewed	Back alignment and domain information

>PRK06128 oxidoreductase; Provisional	Back alignment and domain information

>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PRK06953 short chain dehydrogenase; Provisional	Back alignment and domain information

>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism]	Back alignment and domain information

>PRK06949 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK12550 shikimate 5-dehydrogenase; Reviewed	Back alignment and domain information

>PRK07831 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK00536 speE spermidine synthase; Provisional	Back alignment and domain information

>PRK12829 short chain dehydrogenase; Provisional	Back alignment and domain information

>PLN02366 spermidine synthase	Back alignment and domain information

>PRK07814 short chain dehydrogenase; Provisional	Back alignment and domain information

>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase	Back alignment and domain information

>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated	Back alignment and domain information

>PRK07825 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional	Back alignment and domain information

>PRK06484 short chain dehydrogenase; Validated	Back alignment and domain information

>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase	Back alignment and domain information

>PRK14027 quinate/shikimate dehydrogenase; Provisional	Back alignment and domain information

>PRK06398 aldose dehydrogenase; Validated	Back alignment and domain information

>PRK07832 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed	Back alignment and domain information

>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase	Back alignment and domain information

>PRK09186 flagellin modification protein A; Provisional	Back alignment and domain information

>PRK09291 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06101 short chain dehydrogenase; Provisional	Back alignment and domain information

>PLN02780 ketoreductase/ oxidoreductase	Back alignment and domain information

>PRK06719 precorrin-2 dehydrogenase; Validated	Back alignment and domain information

>PRK08339 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07502 cyclohexadienyl dehydrogenase; Validated	Back alignment and domain information

>COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK06180 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK08618 ornithine cyclodeaminase; Validated	Back alignment and domain information

>PRK12548 shikimate 5-dehydrogenase; Provisional	Back alignment and domain information

>PRK07774 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed	Back alignment and domain information

>PRK09242 tropinone reductase; Provisional	Back alignment and domain information

>PRK05867 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional	Back alignment and domain information

>CHL00194 ycf39 Ycf39; Provisional	Back alignment and domain information

>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PRK06701 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06484 short chain dehydrogenase; Validated	Back alignment and domain information

>PRK05866 short chain dehydrogenase; Provisional	Back alignment and domain information

>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial	Back alignment and domain information

>PRK08263 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PRK06196 oxidoreductase; Provisional	Back alignment and domain information

>PRK07904 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06198 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK12749 quinate/shikimate dehydrogenase; Reviewed	Back alignment and domain information

>PRK09072 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07985 oxidoreductase; Provisional	Back alignment and domain information

>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed	Back alignment and domain information

>PRK07402 precorrin-6B methylase; Provisional	Back alignment and domain information

>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PRK12937 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06483 dihydromonapterin reductase; Provisional	Back alignment and domain information

>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional	Back alignment and domain information

>PRK07523 gluconate 5-dehydrogenase; Provisional	Back alignment and domain information

>PRK07062 short chain dehydrogenase; Provisional	Back alignment and domain information

>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism]	Back alignment and domain information

>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase	Back alignment and domain information

>PRK08589 short chain dehydrogenase; Validated	Back alignment and domain information

>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase	Back alignment and domain information

>PRK07024 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional	Back alignment and domain information

>PRK07478 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK08703 short chain dehydrogenase; Provisional	Back alignment and domain information

>cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E	Back alignment and domain information

>PRK11207 tellurite resistance protein TehB; Provisional	Back alignment and domain information

>PRK15116 sulfur acceptor protein CsdL; Provisional	Back alignment and domain information

>PRK06194 hypothetical protein; Provisional	Back alignment and domain information

>PRK07890 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional	Back alignment and domain information

>PLN02476 O-methyltransferase	Back alignment and domain information

>PRK06179 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK05717 oxidoreductase; Validated	Back alignment and domain information

>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional	Back alignment and domain information

>PLN02781 Probable caffeoyl-CoA O-methyltransferase	Back alignment and domain information

>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional	Back alignment and domain information

>PRK06849 hypothetical protein; Provisional	Back alignment and domain information

>PRK04457 spermidine synthase; Provisional	Back alignment and domain information

>PRK06172 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional	Back alignment and domain information

>PRK05876 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07454 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional	Back alignment and domain information

>PRK08213 gluconate 5-dehydrogenase; Provisional	Back alignment and domain information

>PRK07677 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK12367 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK08264 short chain dehydrogenase; Validated	Back alignment and domain information

>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional	Back alignment and domain information

>PRK05884 short chain dehydrogenase; Provisional	Back alignment and domain information

>PLN03075 nicotianamine synthase; Provisional	Back alignment and domain information

>KOG1014 consensus 17 beta-hydroxysteroid dehydrogenase type 3, HSD17B3 [Lipid transport and metabolism]	Back alignment and domain information

>PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases	Back alignment and domain information

>PRK07856 short chain dehydrogenase; Provisional	Back alignment and domain information

>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB	Back alignment and domain information

>PRK08219 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06138 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06125 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06482 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK08862 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07063 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07035 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06181 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06940 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated	Back alignment and domain information

>PRK08644 thiamine biosynthesis protein ThiF; Provisional	Back alignment and domain information

>PRK05854 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK08226 short chain dehydrogenase; Provisional	Back alignment and domain information

>PF01596 Methyltransf_3: O-methyltransferase; InterPro: IPR002935 Members of this family are O-methyltransferases	Back alignment and domain information

>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2	Back alignment and domain information

>PRK08317 hypothetical protein; Provisional	Back alignment and domain information

>PRK06114 short chain dehydrogenase; Provisional	Back alignment and domain information

>PLN00203 glutamyl-tRNA reductase	Back alignment and domain information

>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase	Back alignment and domain information

>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>COG1179 Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 1 [Coenzyme metabolism]	Back alignment and domain information

>PRK01581 speE spermidine synthase; Validated	Back alignment and domain information

>PRK08643 acetoin reductase; Validated	Back alignment and domain information

>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated	Back alignment and domain information

>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1	Back alignment and domain information

>TIGR00507 aroE shikimate 5-dehydrogenase	Back alignment and domain information

>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed	Back alignment and domain information

>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional	Back alignment and domain information

>PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PRK06914 short chain dehydrogenase; Provisional	Back alignment and domain information

>PLN02253 xanthoxin dehydrogenase	Back alignment and domain information

>PRK07574 formate dehydrogenase; Provisional	Back alignment and domain information

>PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>COG3288 PntA NAD/NADP transhydrogenase alpha subunit [Energy production and conversion]	Back alignment and domain information

>PRK07577 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07453 protochlorophyllide oxidoreductase; Validated	Back alignment and domain information

>PRK06197 short chain dehydrogenase; Provisional	Back alignment and domain information

>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus	Back alignment and domain information

>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional	Back alignment and domain information

>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase	Back alignment and domain information

>KOG0725 consensus Reductases with broad range of substrate specificities [General function prediction only]	Back alignment and domain information

>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism]	Back alignment and domain information

>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed	Back alignment and domain information

>PRK06124 gluconate 5-dehydrogenase; Provisional	Back alignment and domain information

>PRK05875 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07074 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated	Back alignment and domain information

>PRK14191 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PRK08277 D-mannonate oxidoreductase; Provisional	Back alignment and domain information

>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain	Back alignment and domain information

>PLN02823 spermine synthase	Back alignment and domain information

>PRK06720 hypothetical protein; Provisional	Back alignment and domain information

>COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism]	Back alignment and domain information

>PRK10538 malonic semialdehyde reductase; Provisional	Back alignment and domain information

>PRK07067 sorbitol dehydrogenase; Provisional	Back alignment and domain information

>PRK08251 short chain dehydrogenase; Provisional	Back alignment and domain information

>PLN02589 caffeoyl-CoA O-methyltransferase	Back alignment and domain information

>PRK13243 glyoxylate reductase; Reviewed	Back alignment and domain information

>PRK08085 gluconate 5-dehydrogenase; Provisional	Back alignment and domain information

>COG0031 CysK Cysteine synthase [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family	Back alignment and domain information

>PRK10792 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1	Back alignment and domain information

>PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PLN03139 formate dehydrogenase; Provisional	Back alignment and domain information

>PRK06603 enoyl-(acyl carrier protein) reductase; Provisional	Back alignment and domain information

>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins	Back alignment and domain information

>PRK01683 trans-aconitate 2-methyltransferase; Provisional	Back alignment and domain information

>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed	Back alignment and domain information

>PRK08340 glucose-1-dehydrogenase; Provisional	Back alignment and domain information

>PRK08415 enoyl-(acyl carrier protein) reductase; Provisional	Back alignment and domain information

>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>KOG1201 consensus Hydroxysteroid 17-beta dehydrogenase 11 [Secondary metabolites biosynthesis, transport and catabolism]	Back alignment and domain information

>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional	Back alignment and domain information

>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase	Back alignment and domain information

>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase	Back alignment and domain information

>PRK08303 short chain dehydrogenase; Provisional	Back alignment and domain information

>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase	Back alignment and domain information

>PRK05562 precorrin-2 dehydrogenase; Provisional	Back alignment and domain information

>PRK12746 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK08328 hypothetical protein; Provisional	Back alignment and domain information

>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional	Back alignment and domain information

>TIGR00417 speE spermidine synthase	Back alignment and domain information

>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase	Back alignment and domain information

>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1	Back alignment and domain information

>TIGR00477 tehB tellurite resistance protein TehB	Back alignment and domain information

>PRK07340 ornithine cyclodeaminase; Validated	Back alignment and domain information

>PRK08762 molybdopterin biosynthesis protein MoeB; Validated	Back alignment and domain information

>PRK14103 trans-aconitate 2-methyltransferase; Provisional	Back alignment and domain information

>PRK08300 acetaldehyde dehydrogenase; Validated	Back alignment and domain information

>PRK12743 oxidoreductase; Provisional	Back alignment and domain information

>PRK12747 short chain dehydrogenase; Provisional	Back alignment and domain information

>TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase	Back alignment and domain information

>cd01487 E1_ThiF_like E1_ThiF_like	Back alignment and domain information

>PRK13656 trans-2-enoyl-CoA reductase; Provisional	Back alignment and domain information

>PRK07791 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK08159 enoyl-(acyl carrier protein) reductase; Provisional	Back alignment and domain information

>PRK08690 enoyl-(acyl carrier protein) reductase; Provisional	Back alignment and domain information

>TIGR03215 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylating)	Back alignment and domain information

>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed	Back alignment and domain information

>PRK08278 short chain dehydrogenase; Provisional	Back alignment and domain information

>PF08704 GCD14: tRNA methyltransferase complex GCD14 subunit; InterPro: IPR014816 GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA []	Back alignment and domain information

>PLN00141 Tic62-NAD(P)-related group II protein; Provisional	Back alignment and domain information

>PRK07102 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07097 gluconate 5-dehydrogenase; Provisional	Back alignment and domain information

>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP	Back alignment and domain information

>PRK13255 thiopurine S-methyltransferase; Reviewed	Back alignment and domain information

>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA	Back alignment and domain information

>PRK06523 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07417 arogenate dehydrogenase; Reviewed	Back alignment and domain information

>PRK05650 short chain dehydrogenase; Provisional	Back alignment and domain information

>PLN02928 oxidoreductase family protein	Back alignment and domain information

>PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional	Back alignment and domain information

>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated	Back alignment and domain information

>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated	Back alignment and domain information

>PRK05597 molybdopterin biosynthesis protein MoeB; Validated	Back alignment and domain information

>COG2910 Putative NADH-flavin reductase [General function prediction only]	Back alignment and domain information

>PRK14189 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional	Back alignment and domain information

>PRK07984 enoyl-(acyl carrier protein) reductase; Provisional	Back alignment and domain information

>PRK14982 acyl-ACP reductase; Provisional	Back alignment and domain information

>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional	Back alignment and domain information

>KOG1252 consensus Cystathionine beta-synthase and related enzymes [Amino acid transport and metabolism]	Back alignment and domain information

>PRK13403 ketol-acid reductoisomerase; Provisional	Back alignment and domain information

>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated	Back alignment and domain information

>PRK05600 thiamine biosynthesis protein ThiF; Validated	Back alignment and domain information

>PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional	Back alignment and domain information

>PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase	Back alignment and domain information

>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated	Back alignment and domain information

>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional	Back alignment and domain information

>COG0334 GdhA Glutamate dehydrogenase/leucine dehydrogenase [Amino acid transport and metabolism]	Back alignment and domain information

>PRK12938 acetyacetyl-CoA reductase; Provisional	Back alignment and domain information

>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate	Back alignment and domain information

>PF02670 DXP_reductoisom: 1-deoxy-D-xylulose 5-phosphate reductoisomerase; InterPro: IPR013512 1-deoxy-D-xylulose 5-phosphate reductoisomerase synthesises 2-C-methyl-D-erythritol 4-phosphate from 1-deoxy-D-xylulose 5-phosphate in a single step by intramolecular rearrangement and reduction and is responsible for terpenoid biosynthesis in some organisms []	Back alignment and domain information

>PRK04266 fibrillarin; Provisional	Back alignment and domain information

>PLN02244 tocopherol O-methyltransferase	Back alignment and domain information

>PRK07370 enoyl-(acyl carrier protein) reductase; Validated	Back alignment and domain information

>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional	Back alignment and domain information

>PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional	Back alignment and domain information

>PF13823 ADH_N_assoc: Alcohol dehydrogenase GroES-associated; PDB: 2DPH_B	Back alignment and domain information

>COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism]	Back alignment and domain information

>TIGR00138 gidB 16S rRNA methyltransferase GidB	Back alignment and domain information

>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional	Back alignment and domain information

>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase	Back alignment and domain information

>PRK09135 pteridine reductase; Provisional	Back alignment and domain information

>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional	Back alignment and domain information

>PRK10669 putative cation:proton antiport protein; Provisional	Back alignment and domain information

>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism]	Back alignment and domain information

>PF01564 Spermine_synth: Spermine/spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (2	Back alignment and domain information

>TIGR02415 23BDH acetoin reductases	Back alignment and domain information

>KOG1199 consensus Short-chain alcohol dehydrogenase/3-hydroxyacyl-CoA dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism]	Back alignment and domain information

>COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only]	Back alignment and domain information

>cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase	Back alignment and domain information

>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins	Back alignment and domain information

>PLN02735 carbamoyl-phosphate synthase	Back alignment and domain information

>PRK06522 2-dehydropantoate 2-reductase; Reviewed	Back alignment and domain information

>PF07991 IlvN: Acetohydroxy acid isomeroreductase, catalytic domain; InterPro: IPR013116 Acetohydroxy acid isomeroreductase catalyses the conversion of acetohydroxy acids into dihydroxy valerates	Back alignment and domain information

>PRK12480 D-lactate dehydrogenase; Provisional	Back alignment and domain information

>cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase	Back alignment and domain information

>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1	Back alignment and domain information

>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PRK05708 2-dehydropantoate 2-reductase; Provisional	Back alignment and domain information

>PF02719 Polysacc_synt_2: Polysaccharide biosynthesis protein; InterPro: IPR003869 This domain is found in diverse bacterial polysaccharide biosynthesis proteins including the CapD protein from Staphylococcus aureus [], the WalL protein, mannosyl-transferase [], and several putative epimerases	Back alignment and domain information

>PRK06141 ornithine cyclodeaminase; Validated	Back alignment and domain information

>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional	Back alignment and domain information

>PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional	Back alignment and domain information

>PRK08936 glucose-1-dehydrogenase; Provisional	Back alignment and domain information

>PLN02986 cinnamyl-alcohol dehydrogenase family protein	Back alignment and domain information

>PRK07775 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>PRK07889 enoyl-(acyl carrier protein) reductase; Provisional	Back alignment and domain information

>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>TIGR00452 methyltransferase, putative	Back alignment and domain information

>COG0673 MviM Predicted dehydrogenases and related proteins [General function prediction only]	Back alignment and domain information

>PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot	Back alignment and domain information

>PRK07578 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK11559 garR tartronate semialdehyde reductase; Provisional	Back alignment and domain information

>PRK06947 glucose-1-dehydrogenase; Provisional	Back alignment and domain information

>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated	Back alignment and domain information

>PRK09134 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK12935 acetoacetyl-CoA reductase; Provisional	Back alignment and domain information

>PRK06436 glycerate dehydrogenase; Provisional	Back alignment and domain information

>PLN02256 arogenate dehydrogenase	Back alignment and domain information

>KOG1207 consensus Diacetyl reductase/L-xylulose reductase [Secondary metabolites biosynthesis, transport and catabolism]	Back alignment and domain information

>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins	Back alignment and domain information

>TIGR01472 gmd GDP-mannose 4,6-dehydratase	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		371
4dl9_A		396	Crystal Structure Of S-nitrosoglutathione Reductase		0.0
3uko_A		378	Crystal Structure Of S-Nitrosoglutathione Reductase		0.0
3qj5_A		374	S-Nitrosoglutathione Reductase (Gsnor) In Complex W		1e-138
1mc5_A		374	Ternary Complex Of Human Glutathione-Dependent Form		1e-138
1teh_A		373	Structure Of Human Liver Chichi Alcohol Dehydrogena		1e-138
2fzw_A		373	Structure Of The Binary Complex Of The E67l Mutant		1e-137
1cdo_A		374	Alcohol Dehydrogenase (E.C.1.1.1.1) (Ee Isozyme) Co		1e-117
3cos_A		381	Crystal Structure Of Human Class Ii Alcohol Dehydro		1e-108
1hdy_A		374	Three-Dimensional Structures Of Three Human Alcohol		1e-107
1hdx_A		374	Three-Dimensional Structures Of Three Human Alcohol		1e-106
1hdz_A		374	Three-Dimensional Structures Of Three Human Alcohol		1e-105
1htb_A		374	Crystallization Of Human Beta3 Alcohol Dehydrogenas		1e-105
1hso_A		374	Human Alpha Alcohol Dehydrogenase (Adh1a) Length =		1e-103
6adh_A		374	Structure Of Triclinic Ternary Complex Of Horse Liv		1e-103
3oq6_A		374	Horse Liver Alcohol Dehydrogenase A317c Mutant Comp		1e-103
1ht0_A		374	Human Gamma-2 Alcohol Dehydrogense Length = 374		1e-103
1axe_A		374	Crystal Structure Of The Active-Site Mutant Phe93->		1e-103
1qlh_A		374	Horse Liver Alcohol Dehydrogenase Complexed To Nad		1e-103
1n8k_A		374	Horse Liver Alcohol Dehydrogenase Val292thr Mutant		1e-102
1axg_A		374	Crystal Structure Of The Val203->ala Mutant Of Live		1e-102
1mgo_A		374	Horse Liver Alcohol Dehydrogenase Phe93ala Mutant L		1e-102
1qv6_A		374	Horse Liver Alcohol Dehydrogenase His51glnLYS228ARG		1e-102
1ju9_A		374	Horse Liver Alcohol Dehydrogenase Val292ser Mutant		1e-102
1a71_A		374	Ternary Complex Of An Active Site Double Mutant Of		1e-102
1ee2_B		373	The Structure Of Steroid-Active Alcohol Dehydrogena		1e-102
1ee2_A		373	The Structure Of Steroid-Active Alcohol Dehydrogena		1e-102
1agn_A		373	X-Ray Structure Of Human Sigma Alcohol Dehydrogenas		1e-97
1d1t_A		373	Mutant Of Human Sigma Alcohol Dehydrogenase With Le		3e-97
1e3l_A		376	P47h Mutant Of Mouse Class Ii Alcohol Dehydrogenase		7e-96
1p0c_A		373	Crystal Structure Of The Nadp(H)-Dependent Vertebra		2e-95
1e3e_A		376	Mouse Class Ii Alcohol Dehydrogenase Complex With N		9e-95
1f8f_A		371	Crystal Structure Of Benzyl Alcohol Dehydrogenase F		2e-37
1rjw_A		339	Crystal Structure Of Nad(+)-Dependent Alcohol Dehyd		8e-19
1vj0_A		380	Crystal Structure Of Alcohol Dehydrogenase (Tm0436)		1e-18
1llu_A		342	The Ternary Complex Of Pseudomonas Aeruginosa Alcoh		1e-18
3pii_A		339	Crystal Structure Of Mutant Of Ht- Alcohol Dehydrog		1e-18
1h2b_A		359	Crystal Structure Of The Alcohol Dehydrogenase From		2e-18
3s1l_A		340	Crystal Structure Of Apo-Form Furx Length = 340		1e-17
2hcy_A		347	Yeast Alcohol Dehydrogenase I, Saccharomyces Cerevi		2e-17
3meq_A		365	Crystal Structure Of Alcohol Dehydrogenase From Bru		3e-17
2h6e_A		344	Crystal Structure Of The D-Arabinose Dehydrogenase		2e-16
2dq4_A		343	Crystal Structure Of Threonine 3-Dehydrogenase Leng		3e-16
3two_A		348	The Crystal Structure Of Cad From Helicobacter Pylo		7e-16
2nvb_A		352	Contribution Of Pro275 To The Thermostability Of Th		5e-15
3fpl_A		351	Chimera Of Alcohol Dehydrogenase By Exchange Of The		6e-15
1ykf_A		352	Nadp-Dependent Alcohol Dehydrogenase From Thermoana		7e-15
3qe3_A		355	Sheep Liver Sorbitol Dehydrogenase Length = 355		9e-15
4ej6_A		370	Crystal Structure Of A Putative Zinc-Binding Dehydr		1e-14
2eih_A		343	Crystal Structure Of Nad-Dependent Alcohol Dehydrog		1e-14
1uuf_A		369	Crystal Structure Of A Zinc-Type Alcohol Dehydrogen		7e-14
4ilk_A		359	Crystal Structure Of Short Chain Alcohol Dehydrogen		2e-13
1pl7_A		356	Human Sorbitol Dehydrogenase (Apo) Length = 356		3e-13
1e3j_A		352	Ketose Reductase (Sorbitol Dehydrogenase) From Silv		3e-13
4eex_A		348	Crystal Structure Of Lactococcus Lactis Alcohol Deh		9e-13
1pl6_A		356	Human SdhNADHINHIBITOR COMPLEX Length = 356		2e-12
4eez_A		348	Crystal Structure Of Lactococcus Lactis Alcohol Deh		2e-12
2eer_A		347	Structural Study Of Project Id St2577 From Sulfolob		5e-12
1yqd_A		366	Sinapyl Alcohol Dehydrogenase Complexed With Nadp+		5e-12
4a2c_A		346	Crystal Structure Of Galactitol-1-Phosphate Dehydro		1e-11
2xaa_A		345	Alcohol Dehydrogenase Adh-'a' From Rhodococcus Rube		3e-11
3gfb_A		350	L-Threonine Dehydrogenase (Tktdh) From The Hyperthe		3e-11
2dfv_A		347	Hyperthermophilic Threonine Dehydrogenase From Pyro		2e-10
2d8a_A		348	Crystal Structure Of Ph0655 From Pyrococcus Horikos		2e-10
1jqb_A		351	Alcohol Dehydrogenase From Clostridium Beijerinckii		2e-09
3ftn_A		352	Q165eS254K DOUBLE MUTANT CHIMERA OF ALCOHOL DEHYDRO		3e-09
3fsr_A		352	Chimera Of Alcohol Dehydrogenase By Exchange Of The		9e-09
1ped_A		351	Bacterial Secondary Alcohol Dehydrogenase (Apo-Form		1e-08
1r37_A		347	Alcohol Dehydrogenase From Sulfolobus Solfataricus		2e-08
2b83_A		351	A Single Amino Acid Substitution In The Clostridium		2e-08
1nto_A		347	N249y Mutant Of Alcohol Dehydrogenase From The Arch		3e-08
3i4c_A		347	Crystal Structure Of Sulfolobus Solfataricus Adh(Ss		7e-08
1kol_A		398	Crystal Structure Of Formaldehyde Dehydrogenase Len		1e-07
2cd9_A		366	Sulfolobus Solfataricus Glucose Dehydrogenase 1 - A		4e-07
1jvb_A		347	Alcohol Dehydrogenase From The Archaeon Sulfolobus		6e-07
2cdb_A		366	Sulfolobus Solfataricus Glucose Dehydrogenase 1 In		2e-06
3fpc_A		352	Chimera Of Alcohol Dehydrogenase By Exchange Of The		2e-06
1qor_A		327	Crystal Structure Of Escherichia Coli Quinone Oxido		2e-05
3m6i_A		363	L-Arabinitol 4-Dehydrogenase Length = 363		5e-05
3jyl_A		325	Crystal Structures Of Pseudomonas Syringae Pv. Toma		6e-05
1wly_A		333	Crystal Structure Of 2-haloacrylate Reductase Lengt		9e-05
2b5w_A		357	Crystal Structure Of D38c Glucose Dehydrogenase Mut		1e-04
3qwa_A		334	Crystal Structure Of Saccharomyces Cerevisiae Zeta-		2e-04
3uog_A		363	Crystal Structure Of Putative Alcohol Dehydrogenase		6e-04
2dph_A		398	Crystal Structure Of Formaldehyde Dismutase Length		7e-04

>pdb|4DL9|A Chain A, Crystal Structure Of S-nitrosoglutathione Reductase From Tomato (solanum Lycopersicum) In Complex With Nad+ Length = 396