Citrus Sinensis ID: 017447


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-
MFAKIVPYCKNGAQKLLGIIIAIGEAVAYVLSGMYGSVNQLGVGNAILIIVQLCFAGIIVICLDELLQKGYGLGSGISLFIATNICENIIWKAFSPTTINSGRGAEFEGAVIALFHLLITRNDKVRALREAFYRQNLPNVTNLLATVLIFLIVIYFQGFRVVLPVRSKNARGQQGSYPIKLFYTSNMPIILQSALVSNLYFISQLMYRRYSGNFFVNLLGKWKESEYSGGQYVPVGGIAYYITAPSSLADMAANPFHALFYLVFMLSACALFSKTWIEVSGSSARDVAKQLKEQQMVMPGHREANLQKELNRYIPTAAAFGGMCIGALTVLADFMGAIGSGTGILLAVTIIYQYFETFEKERASELGFFGF
ccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHccccCCccccccccHHHHHHHHHHHHHccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccEEEEEccccccccccccccCEEEcccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccECccccccccccccccEEEEEcccccHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHcccEEccccccHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccc
**AKIVPYCKNGAQKLLGIIIAIGEAVAYVLSGMYGSVNQLGVGNAILIIVQLCFAGIIVICLDELLQKGYGLGSGISLFIATNICENIIWKAFSPTTINSGRGAEFEGAVIALFHLLITRNDKVRALREAFYRQNLPNVTNLLATVLIFLIVIYFQGFRVVLPVRSKNARGQQGSYPIKLFYTSNMPIILQSALVSNLYFISQLMYRRYSGNFFVNLLGKWKESEYSGGQYVPVGGIAYYITAPSSLADMAANPFHALFYLVFMLSACALFSKTWIEVSGSSA***********MVMPGHREANLQKELNRYIPTAAAFGGMCIGALTVLADFMGAIGSGTGILLAVTIIYQYFETFEKE**********
xxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFAKIVPYCKNGAQKLLGIIIAIGEAVAYVLSGMYGSVNQLGVGNAILIIVQLCFAGIIVICLDELLQKGYGLGSGISLFIATNICENIIWKAFSPTTINSGRGAEFEGAVIALFHLLITRNDKVRALREAFYRQNLPNVTNLLATVLIFLIVIYFQGFRVVLPVRSKNARGQQGSYPIKLFYTSNMPIILQSALVSNLYFISQLMYRRYSGNFFVNLLGKWKESEYSGGQYVPVGGIAYYITAPSSLADMAANPFHALFYLVFMLSACALFSKTWIEVSGSSARDVAKQLKEQQMVMPGHREANLQKELNRYIPTAAAFGGMCIGALTVLADFMGAIGSGTGILLAVTIIYQYFETFEKERASELGFFGF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein transport protein Sec61 subunit alpha-like 2 Appears to play a crucial role in the insertion of secretory and membrane polypeptides into the ER. It is required for assembly of membrane and secretory proteins. Found to be tightly associated with membrane-bound ribosomes, either directly or through adaptor proteins.probableQ90YL4
Protein transport protein Sec61 subunit alpha-like 1 Appears to play a crucial role in the insertion of secretory and membrane polypeptides into the ER. It is required for assembly of membrane and secretory proteins. Found to be tightly associated with membrane-bound ribosomes, either directly or through adaptor proteins.probableQ90ZM2
Protein transport protein Sec61 subunit alpha isoform 2 Appears to play a crucial role in the insertion of secretory and membrane polypeptides into the ER. It is required for assembly of membrane and secretory proteins. Found to be tightly associated with membrane-bound ribosomes, either directly or through adaptor proteins.probableQ2KHX4

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2WWB, chain A
Confidence level:very confident
Coverage over the Query: 5-368
View the alignment between query and template
View the model in PyMOL