Citrus Sinensis ID: 017455


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-
MKTSSTSCSLLNSLRFSTAITVSKKSYYHYQATQLRNHNCLSPFPSFSSTFPRNYNFHGKCLHVNPFSAFSSSSGHDSQNPPRDLAVLLEVDGVLVDAYRFGNRQAFNVAFQKLGLDCANWTAPIYTDLLRKSAGDEDRMLVLFFNRIGWPTSVPTNEKKAFVKNVLQEKKNALDEFLASKDAPLRPGVEDFVDDAYNEGIPLIVLTAYGKSGDRIARSVVEKLGSERISKIKIVGNEEVERSLYGQFVLGKGISSGVDEQLATEARKAVSAQKQEIAEEVASMLKLSVDIDTSSPESLDKIVAALRAGAEYAEKPVRNCFLIAGSQSGVAGAQRIGMPCVVMRSRCITTLPVSKTQRLADMLCRILKSIT
cccccccccccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccccccccHHHHHHHHHHHHcccccccccHHHHHHHHHcccccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHccccccccEEEccccHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHcHHHcccccccEEEEcccHHHHHHHHHccccEEEEccccccccccccccHHHHHHHHHHHHcc
cccHcccccccccccccccEEEccccEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEccccEcccHcccHHHHHHHHHHHcccccEEccHHHHHHHHHHccccccEEEEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccEEEEEEcccHHHHHHHHHHHHHHcHHHHccEEEEEcccccHHHHEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEEEcccccccHHHHHHHHHHHHHHcccccccEEEEEccccHHHHHHHccccEEEEEcccccccccHHHHHHHHHHHHHHHHcc
mktsstscsllNSLRFSTAITVSKKSYYHYQATqlrnhnclspfpsfsstfprnynfhgkclhvnpfsafssssghdsqnpprDLAVLLEVDGVLVDAYRFGNRQAFNVAFQKLGldcanwtapiytdllrksagdeDRMLVLFFNrigwptsvptneKKAFVKNVLQEKKNALDEflaskdaplrpgvedfvddaynegIPLIVLTAYGKSGDRIARSVVEKLGSERISKIKIVGNEEVERSLYGQFVlgkgissgvDEQLATEARKAVSAQKQEIAEEVASMLKLSVdidtsspeSLDKIVAALRAGAeyaekpvrncfliagsqsgvagaqrigmpcvvmrsrcittlpvsktQRLADMLCRILKSIT
mktsstscsllnsLRFSTAITVSKKSYYHYQATQLRNHNCLSPFPSFSSTFPRNYNFHGKCLHVNPFSAFSSSSGHDSQNPPRDLAVLLEVDGVLVDAYRFGNRQAFNVAFQKLGLDCANWTAPIYTDLLRKSAGDEDRMLVLFFNRigwptsvptneKKAFVKNVLQEKKNALDeflaskdaplrpGVEDFVDDAYNEGIPLIVLtaygksgdRIARSVveklgseriskikivgneeverSLYGQFVLGKGISSGVDEQLATEARKAVSAQKQEIAEEVASMLKLSvdidtsspeSLDKIVAALRAGAEYAEKPVRNCFLIAGSQSGVAGAQRIGMPCVVMRSRCIttlpvsktqrlADMLCRILKSIT
MKtsstscsllnslRFSTAITVSKKSYYHYQATQLRNHNCLspfpsfsstfpRNYNFHGKCLHVNPfsafssssGHDSQNPPRDLAVLLEVDGVLVDAYRFGNRQAFNVAFQKLGLDCANWTAPIYTDLLRKSAGDEDRMLVLFFNRIGWPTSVPTNEKKAFVKNVLQEKKNALDEFLASKDAPLRPGVEDFVDDAYNEGIPLIVLTAYGKSGDRIARSVVEKLGSERISKIKIVGNEEVERSLYGQFVLGKGISSGVDEQLATEARKAVSAQKQEIAEEVASMLKLSVDIDTSSPESLDKIVAALRAGAEYAEKPVRNCFLIAGSQSGVAGAQRIGMPCVVMRSRCITTLPVSKTQRLADMLCRILKSIT
*********LLNSLRFSTAITVSKKSYYHYQATQLRNHNCLSPFPSFSSTFPRNYNFHGKCLHVNPFS****************LAVLLEVDGVLVDAYRFGNRQAFNVAFQKLGLDCANWTAPIYTDLLRKSAGDEDRMLVLFFNRIGWPTSVPTNEKKAFVKNVLQEKKNALDEFLASKDAPLRPGVEDFVDDAYNEGIPLIVLTAYGKSGDRIARSVVEKLGSERISKIKIVGNEEVERSLYGQFVLGKGIS********************************************DKIVAALRAGAEYAEKPVRNCFLIAGSQSGVAGAQRIGMPCVVMRSRCITTLPVSKTQRLADMLCRIL****
******S***LNSLRFSTAITVS**************************************************************AVLLEVDGVLVDAYRFGNRQAFNVAFQKLGLDCANWTAPIYTDLLRKSAGDEDRMLVLFFNRIGWPTSVPTNEKKAFVKNVLQEKKNALDEFLASKDAPLRPGVEDFVDDAYNEGIPLIVLTAYGKSGDRIARSVVEKLGSERISKIKIVGNEEVERSLYGQFVLGKGISSGVDEQLATEARKAVSAQKQEIAEEVASMLKLSVDIDTSSPESLDKIVAALRAGAEYAEKPVRNCFLIAGSQSGVAGAQRIGMPCVVMRSRCITTLPVSKTQRLADMLCRILKSIT
*********LLNSLRFSTAITVSKKSYYHYQATQLRNHNCLSPFPSFSSTFPRNYNFHGKCLHVNPFSA***********PPRDLAVLLEVDGVLVDAYRFGNRQAFNVAFQKLGLDCANWTAPIYTDLLRKSAGDEDRMLVLFFNRIGWPTSVPTNEKKAFVKNVLQEKKNALDEFLASKDAPLRPGVEDFVDDAYNEGIPLIVLTAYGKSGDRIARSVVEKLGSERISKIKIVGNEEVERSLYGQFVLGKGISSGVDEQLA************EIAEEVASMLKLSVDIDTSSPESLDKIVAALRAGAEYAEKPVRNCFLIAGSQSGVAGAQRIGMPCVVMRSRCITTLPVSKTQRLADMLCRILKSIT
*******CSLLNSLRFSTAITVSKKSYYHYQATQLRNHNCLSPFPSFSSTFPRNYNFHGKCLHVNPF*************PPRDLAVLLEVDGVLVDAYRFGNRQAFNVAFQKLGLDCANWTAPIYTDLLRKSAGDEDRMLVLFFNRIGWPTSVPTNEKKAFVKNVLQEKKNALDEFLASKDAPLRPGVEDFVDDAYNEGIPLIVLTAYGKSGDRIARSVVEKLGSERISKIKIVGNEEVERSLYGQFVLGKGISSGVDEQLATEARKAVSAQKQEIAEEVASMLKLSVDIDTSSPESLDKIVAALRAGAEYAEKPVRNCFLIAGSQSGVAGAQRIGMPCVVMRSRCITTLPVSKTQRLADMLCRILKSIT
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKTSSTSCSLLNSLRFSTAITVSKKSYYHYQATQLRNHNCLSPFPSFSSTFPRNYNFHGKCLHVNPFSAFSSSSGHDSQNPPRDLAVLLEVDGVLVDAYRFGNRQAFNVAFQKLGLDCANWTAPIYTDLLRKSAGDEDRMLVLFFNRIGWPTSVPTNEKKAFVKNVLQEKKNALDEFLASKDAPLRPGVEDFVDDAYNEGIPLIVLTAYGKSGDRIARSVVEKLGSERISKIKIVGNEEVERSLYGQFVLGKGISSGVDEQLATEARKAVSAQKQEIAEEVASMLKLSVDIDTSSPESLDKIVAALRAGAEYAEKPVRNCFLIAGSQSGVAGAQRIGMPCVVMRSRCITTLPVSKTQRLADMLCRILKSIT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query371 2.2.26 [Sep-21-2011]
P40119254 Protein CbbY, chromosomal yes no 0.315 0.460 0.352 7e-10
Q04541254 Protein CbbY, plasmid OS= yes no 0.315 0.460 0.344 1e-09
P95649230 Protein CbbY OS=Rhodobact yes no 0.301 0.486 0.303 4e-06
O33513227 Protein CbbY OS=Rhodobact yes no 0.301 0.493 0.336 7e-05
>sp|P40119|CBBYC_CUPNH Protein CbbY, chromosomal OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=cbbYC PE=3 SV=3 Back     alignment and function desciption
 Score = 65.5 bits (158), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 65/122 (53%), Gaps = 5/122 (4%)

Query: 86  AVLLEVDGVLVDAYRFGNRQAFNVAFQKLGLDCANWTAPIYTDLLRKSAGDEDRMLVLFF 145
           A++ +VDG L D     + QAFN AF ++GLD   W AP+YT LL K AG ++R++   +
Sbjct: 3   ALIFDVDGTLADT-ESAHLQAFNAAFAEVGLDW-YWDAPLYTRLL-KVAGGKERLM--HY 57

Query: 146 NRIGWPTSVPTNEKKAFVKNVLQEKKNALDEFLASKDAPLRPGVEDFVDDAYNEGIPLIV 205
            R+  P      + K  +  V   K     E + +   PLRPG+   +D+A   G+PL +
Sbjct: 58  WRMVDPEEARGCKVKETIDAVHAIKTRHYAERVGAGGLPLRPGIARLIDEAGEAGLPLAI 117

Query: 206 LT 207
            T
Sbjct: 118 AT 119





Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) (taxid: 381666)
>sp|Q04541|CBBYP_CUPNH Protein CbbY, plasmid OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=cbbYP PE=3 SV=1 Back     alignment and function description
>sp|P95649|CBBY_RHOSH Protein CbbY OS=Rhodobacter sphaeroides GN=cbbY PE=3 SV=1 Back     alignment and function description
>sp|O33513|CBBY_RHOCA Protein CbbY OS=Rhodobacter capsulatus GN=cbbY PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query371
255549546340 2-deoxyglucose-6-phosphate phosphatase, 0.908 0.991 0.689 1e-130
224134306380 predicted protein [Populus trichocarpa] 0.938 0.915 0.652 1e-119
225465107376 PREDICTED: uncharacterized protein LOC10 0.889 0.877 0.611 1e-113
296081418367 unnamed protein product [Vitis vinifera] 0.889 0.899 0.611 1e-113
297791273372 hypothetical protein ARALYDRAFT_494462 [ 0.897 0.895 0.576 1e-110
30694711372 CbbY protein-like protein [Arabidopsis t 0.900 0.897 0.569 1e-109
356555851374 PREDICTED: uncharacterized protein LOC10 0.752 0.745 0.677 1e-109
356532993371 PREDICTED: uncharacterized protein LOC10 0.752 0.752 0.673 1e-108
449433515374 PREDICTED: uncharacterized protein LOC10 0.797 0.791 0.640 1e-107
414869086418 TPA: hypothetical protein ZEAMMB73_04861 0.749 0.665 0.664 1e-105
>gi|255549546|ref|XP_002515825.1| 2-deoxyglucose-6-phosphate phosphatase, putative [Ricinus communis] gi|223545054|gb|EEF46567.1| 2-deoxyglucose-6-phosphate phosphatase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  471 bits (1213), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 235/341 (68%), Positives = 278/341 (81%), Gaps = 4/341 (1%)

Query: 6   TSCSLLNSLRFSTAITVSKKSYYHYQATQLRNHNCLSPFPSFSSTFPRNYNFHGKCLHVN 65
           +SCS+L SLR S    ++  + +  Q T  RN N     PSFS +FPRNY   GK L  N
Sbjct: 4   SSCSILYSLRLSNNF-INYNNKFCSQ-TLPRNCNSFCLGPSFSFSFPRNYKIPGKFLQPN 61

Query: 66  PFSAFSSSSGHDSQNPPRDLAVLLEVDGVLVDAYRFGNRQAFNVAFQKLGLDCANWTAPI 125
             ++F+SSS    QNP  +LAVLLEVDGVL+D YR GNRQAFN+AFQKLGLDCANWT PI
Sbjct: 62  GLASFTSSS--PDQNPSLELAVLLEVDGVLMDVYRLGNRQAFNIAFQKLGLDCANWTEPI 119

Query: 126 YTDLLRKSAGDEDRMLVLFFNRIGWPTSVPTNEKKAFVKNVLQEKKNALDEFLASKDAPL 185
           Y DL+RKSAGDE+RMLVLFFNRIGWPTS+PT+EK  FV N+LQEKKNA+DEF+ SK APL
Sbjct: 120 YLDLVRKSAGDEERMLVLFFNRIGWPTSLPTSEKGTFVNNILQEKKNAMDEFVMSKSAPL 179

Query: 186 RPGVEDFVDDAYNEGIPLIVLTAYGKSGDRIARSVVEKLGSERISKIKIVGNEEVERSLY 245
           RPG EDF+DDA NEGIP+++LT+Y KS ++IARS+V+KLG ERI KIKIVG+ EV++SLY
Sbjct: 180 RPGAEDFIDDASNEGIPVVILTSYNKSEEKIARSIVDKLGPERILKIKIVGDAEVKQSLY 239

Query: 246 GQFVLGKGISSGVDEQLATEARKAVSAQKQEIAEEVASMLKLSVDIDTSSPESLDKIVAA 305
           GQ VLGKG+ SG+DEQLA EARKA SA++Q+IAEEVASMLKLSV IDTSS ESL+KIVAA
Sbjct: 240 GQLVLGKGVLSGLDEQLAKEARKAASAERQKIAEEVASMLKLSVQIDTSSSESLEKIVAA 299

Query: 306 LRAGAEYAEKPVRNCFLIAGSQSGVAGAQRIGMPCVVMRSR 346
           LRAGAEYA   V NC LIAGSQSGV+ A++IGMPC+V+RSR
Sbjct: 300 LRAGAEYAGLRVSNCVLIAGSQSGVSAAEKIGMPCIVLRSR 340




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224134306|ref|XP_002321787.1| predicted protein [Populus trichocarpa] gi|222868783|gb|EEF05914.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225465107|ref|XP_002271573.1| PREDICTED: uncharacterized protein LOC100253116 [Vitis vinifera] Back     alignment and taxonomy information
>gi|296081418|emb|CBI16769.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|297791273|ref|XP_002863521.1| hypothetical protein ARALYDRAFT_494462 [Arabidopsis lyrata subsp. lyrata] gi|297309356|gb|EFH39780.1| hypothetical protein ARALYDRAFT_494462 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|30694711|ref|NP_199330.2| CbbY protein-like protein [Arabidopsis thaliana] gi|44917581|gb|AAS49115.1| At5g45170 [Arabidopsis thaliana] gi|62321581|dbj|BAD95125.1| putative protein [Arabidopsis thaliana] gi|332007829|gb|AED95212.1| CbbY protein-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356555851|ref|XP_003546243.1| PREDICTED: uncharacterized protein LOC100800683 [Glycine max] Back     alignment and taxonomy information
>gi|356532993|ref|XP_003535053.1| PREDICTED: uncharacterized protein LOC100792632 [Glycine max] Back     alignment and taxonomy information
>gi|449433515|ref|XP_004134543.1| PREDICTED: uncharacterized protein LOC101206737 [Cucumis sativus] gi|449506776|ref|XP_004162845.1| PREDICTED: uncharacterized protein LOC101226823 [Cucumis sativus] Back     alignment and taxonomy information
>gi|414869086|tpg|DAA47643.1| TPA: hypothetical protein ZEAMMB73_048619 [Zea mays] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query371
TAIR|locus:2153348372 AT5G45170 "AT5G45170" [Arabido 0.770 0.768 0.613 2.3e-94
TAIR|locus:2101165319 AT3G48420 [Arabidopsis thalian 0.407 0.473 0.343 2.8e-18
TAIR|locus:2140050316 AT4G39970 [Arabidopsis thalian 0.350 0.411 0.299 1.3e-07
TAIR|locus:2153348 AT5G45170 "AT5G45170" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 939 (335.6 bits), Expect = 2.3e-94, P = 2.3e-94
 Identities = 176/287 (61%), Positives = 226/287 (78%)

Query:    59 GKCLHVNPXXXXXXXXGHDSQNPPRDLAVLLEVDGVLVDAYRFGNRQAFNVAFQKLGLDC 118
             GKCL +            +  NP  + AV+LEVD V++D +   NRQAFNVAFQKLGLDC
Sbjct:    53 GKCLRLQRFSSICLSASREDVNPSEEFAVILEVDRVMIDTWS-SNRQAFNVAFQKLGLDC 111

Query:   119 ANWTAPIYTDLLRKSAGDEDRMLVLFFNRIGWPTSVPTNEKKAFVKNVLQEKKNALDEFL 178
             ANW  P+Y+DLLRK A DE++ML+L+FN+IGWP+S+PT+EK +FVK+VL+EKKNA+DEFL
Sbjct:   112 ANWPEPVYSDLLRKGAADEEKMLLLYFNQIGWPSSLPTSEKASFVKSVLREKKNAMDEFL 171

Query:   179 ASKDAPLRPGVEDFVDDAYNEGIPLIVLTAYGKSGDRIARSVVEKLGSERISKIKIVGNE 238
              SK  PLR GV++F+D+AY E +P+ ++TAY KSGD++A S+VE LG ER+  +K++G+ 
Sbjct:   172 ISKSLPLRSGVQEFIDNAYAEKVPVAIVTAYCKSGDKVALSIVEMLGQERLPNVKVIGDN 231

Query:   239 EVERSLYGQFVLGKGISSGVDEQLATEARKAVSAQKQEIAEEVASMLKLSVDIDTSSPES 298
             EVE+S+YGQ VLGKG+SS ++EQL  E +KA SA+KQ IAEEVASMLKLSVDIDT+S E 
Sbjct:   232 EVEQSMYGQLVLGKGVSSSLEEQLVKEVKKAASAEKQRIAEEVASMLKLSVDIDTTSSER 291

Query:   299 LDKIVAALRAGAEYAEKPVRNCFLIAGSQSGVAGAQRIGMPCVVMRS 345
             L+KIV ALRA AE+   PV NC L+AGSQ GV+ A+ IGMPCVVMRS
Sbjct:   292 LEKIVVALRAAAEHIGLPVNNCVLVAGSQPGVSAAKMIGMPCVVMRS 338




GO:0003674 "molecular_function" evidence=ND
GO:0008150 "biological_process" evidence=ND
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0009570 "chloroplast stroma" evidence=IDA
GO:0015979 "photosynthesis" evidence=RCA
TAIR|locus:2101165 AT3G48420 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2140050 AT4G39970 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
eugene3.00150918
hypothetical protein (380 aa)
(Populus trichocarpa)
Predicted Functional Partners:
gw1.XIII.601.1
SubName- Full=Putative uncharacterized protein; (1016 aa)
      0.508
gw1.XIX.851.1
hypothetical protein (317 aa)
      0.427
fgenesh4_pm.C_LG_X000153
hypothetical protein (221 aa)
      0.403

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query371
PLN02779286 PLN02779, PLN02779, haloacid dehalogenase-like hyd 6e-22
pfam13419176 pfam13419, HAD_2, Haloacid dehalogenase-like hydro 4e-06
COG0546220 COG0546, Gph, Predicted phosphatases [General func 6e-05
>gnl|CDD|215416 PLN02779, PLN02779, haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
 Score = 94.0 bits (234), Expect = 6e-22
 Identities = 56/164 (34%), Positives = 84/164 (51%), Gaps = 12/164 (7%)

Query: 86  AVLLEVDGVLVDAYRFGNRQAFNVAFQKLGLDCANWTAPIYTDLLRKSAGDEDRMLVLFF 145
           A+L + DGVLV+  R G+R AFN AF++ GL    W   +Y D L    G ++RM   +F
Sbjct: 42  ALLFDCDGVLVETERDGHRVAFNDAFKEFGLRPVEWDVELY-DELLNIGGGKERM-TWYF 99

Query: 146 NRIGWPTS----VPTNE--KKAFVKNVLQEKKNAL-DEFLASKDAPLRPGVEDFVDDAYN 198
           N  GWPTS     P +E  +K  V + L ++K  L  E + S   PLRPGV   +D+A  
Sbjct: 100 NENGWPTSTIEKAPKDEEERKELVDS-LHDRKTELFKELIESGALPLRPGVLRLMDEALA 158

Query: 199 EGIPLIVLTAYGKSGDRIARSVVEKLGSERISKIKIVGNEEVER 242
            GI + V +   +       + +  LG ER   + +   ++V +
Sbjct: 159 AGIKVAVCSTSNEKAVSKIVNTL--LGPERAQGLDVFAGDDVPK 200


Length = 286

>gnl|CDD|222115 pfam13419, HAD_2, Haloacid dehalogenase-like hydrolase Back     alignment and domain information
>gnl|CDD|223620 COG0546, Gph, Predicted phosphatases [General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 371
PLN02779286 haloacid dehalogenase-like hydrolase family protei 99.96
COG0637221 Predicted phosphatase/phosphohexomutase [General f 99.96
TIGR03351220 PhnX-like phosphonatase-like hydrolase. This clade 99.95
TIGR01422253 phosphonatase phosphonoacetaldehyde hydrolase. Thi 99.95
TIGR01449213 PGP_bact 2-phosphoglycolate phosphatase, prokaryot 99.95
PRK13226229 phosphoglycolate phosphatase; Provisional 99.95
PRK13288214 pyrophosphatase PpaX; Provisional 99.95
PLN02770248 haloacid dehalogenase-like hydrolase family protei 99.95
PLN03243260 haloacid dehalogenase-like hydrolase; Provisional 99.95
PRK13478267 phosphonoacetaldehyde hydrolase; Provisional 99.95
COG0546220 Gph Predicted phosphatases [General function predi 99.94
PRK10826222 2-deoxyglucose-6-phosphatase; Provisional 99.94
TIGR01990185 bPGM beta-phosphoglucomutase. The enzyme from L. l 99.94
PRK10563221 6-phosphogluconate phosphatase; Provisional 99.94
PLN02575381 haloacid dehalogenase-like hydrolase 99.94
PRK11587218 putative phosphatase; Provisional 99.94
PRK13222226 phosphoglycolate phosphatase; Provisional 99.94
TIGR02009185 PGMB-YQAB-SF beta-phosphoglucomutase family hydrol 99.94
PLN02940 382 riboflavin kinase 99.93
TIGR02253221 CTE7 HAD superfamily (subfamily IA) hydrolase, TIG 99.93
PRK13225273 phosphoglycolate phosphatase; Provisional 99.93
PRK10725188 fructose-1-P/6-phosphogluconate phosphatase; Provi 99.93
TIGR01454205 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthes 99.93
PRK13223272 phosphoglycolate phosphatase; Provisional 99.93
TIGR02254224 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase 99.93
PRK09449224 dUMP phosphatase; Provisional 99.92
TIGR02252203 DREG-2 REG-2-like, HAD superfamily (subfamily IA) 99.92
TIGR01428198 HAD_type_II 2-haloalkanoic acid dehalogenase, type 99.91
PRK06698459 bifunctional 5'-methylthioadenosine/S-adenosylhomo 99.91
PRK14988224 GMP/IMP nucleotidase; Provisional 99.91
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 99.9
PLN02811220 hydrolase 99.89
PRK10748238 flavin mononucleotide phosphatase; Provisional 99.89
PF13419176 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 99.89
KOG2914222 consensus Predicted haloacid-halidohydrolase and r 99.88
TIGR02247211 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-li 99.88
TIGR01548197 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, 99.87
TIGR01509183 HAD-SF-IA-v3 haloacid dehalogenase superfamily, su 99.87
TIGR01993184 Pyr-5-nucltdase pyrimidine 5'-nucleotidase. These 99.87
PRK09456199 ?-D-glucose-1-phosphatase; Provisional 99.86
KOG3085237 consensus Predicted hydrolase (HAD superfamily) [G 99.85
COG1011229 Predicted hydrolase (HAD superfamily) [General fun 99.85
PHA02597197 30.2 hypothetical protein; Provisional 99.84
TIGR00338219 serB phosphoserine phosphatase SerB. Phosphoserine 99.82
TIGR01549154 HAD-SF-IA-v1 haloacid dehalogenase superfamily, su 99.81
PLN02954224 phosphoserine phosphatase 99.81
TIGR01493175 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, su 99.81
TIGR01491201 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPa 99.78
TIGR01691220 enolase-ppase 2,3-diketo-5-methylthio-1-phosphopen 99.75
PRK11133322 serB phosphoserine phosphatase; Provisional 99.75
KOG3109244 consensus Haloacid dehalogenase-like hydrolase [Ge 99.75
PRK08942181 D,D-heptose 1,7-bisphosphate phosphatase; Validate 99.73
TIGR01656147 Histidinol-ppas histidinol-phosphate phosphatase f 99.73
PRK09552219 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosp 99.69
TIGR01672237 AphA HAD superfamily (subfamily IIIB) phosphatase, 99.67
PRK06769173 hypothetical protein; Validated 99.66
PRK13582205 thrH phosphoserine phosphatase; Provisional 99.64
TIGR00213176 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase 99.64
TIGR01664166 DNA-3'-Pase DNA 3'-phosphatase. The central phosph 99.62
COG0560212 SerB Phosphoserine phosphatase [Amino acid transpo 99.59
TIGR01490202 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrol 99.58
TIGR01452279 PGP_euk phosphoglycolate/pyridoxal phosphate phosp 99.57
TIGR01261161 hisB_Nterm histidinol-phosphatase. This model desc 99.56
TIGR01489188 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopent 99.56
cd01427139 HAD_like Haloacid dehalogenase-like hydrolases. Th 99.56
TIGR02137203 HSK-PSP phosphoserine phosphatase/homoserine phosp 99.55
TIGR01685174 MDP-1 magnesium-dependent phosphatase-1. This mode 99.54
TIGR01458257 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydr 99.53
TIGR01488177 HAD-SF-IB Haloacid Dehalogenase superfamily, subfa 99.53
TIGR03333214 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl 99.52
TIGR01662132 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily I 99.51
TIGR01668170 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) ph 99.5
PRK11590211 hypothetical protein; Provisional 99.5
PF00702215 Hydrolase: haloacid dehalogenase-like hydrolase; I 99.49
PRK10444248 UMP phosphatase; Provisional 99.44
PRK11009237 aphA acid phosphatase/phosphotransferase; Provisio 99.43
TIGR01457249 HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydr 99.42
KOG1615227 consensus Phosphoserine phosphatase [Amino acid tr 99.35
PLN02645311 phosphoglycolate phosphatase 99.34
PHA02530300 pseT polynucleotide kinase; Provisional 99.33
PRK05446 354 imidazole glycerol-phosphate dehydratase/histidino 99.29
PF1324275 Hydrolase_like: HAD-hyrolase-like; PDB: 2P27_A 2OY 99.23
smart00577148 CPDc catalytic domain of ctd-like phosphatases. 99.22
PRK08238 479 hypothetical protein; Validated 99.21
COG0647269 NagD Predicted sugar phosphatases of the HAD super 99.21
TIGR01544277 HAD-SF-IE haloacid dehalogenase superfamily, subfa 99.21
TIGR01686 320 FkbH FkbH-like domain. The C-terminal portion of t 99.2
COG2179175 Predicted hydrolase of the HAD superfamily [Genera 99.18
TIGR01681128 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily 99.16
TIGR02726169 phenyl_P_delta phenylphosphate carboxylase, delta 99.14
TIGR01670154 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-pho 99.12
TIGR01545210 YfhB_g-proteo haloacid dehalogenase superfamily, s 99.12
TIGR01456321 CECR5 HAD-superfamily class IIA hydrolase, TIGR014 99.08
TIGR01663 526 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase 99.07
PRK10530272 pyridoxal phosphate (PLP) phosphatase; Provisional 99.07
PF06888234 Put_Phosphatase: Putative Phosphatase; InterPro: I 99.05
PF12689169 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 99.05
TIGR01460236 HAD-SF-IIA Haloacid Dehalogenase Superfamily Class 99.04
PRK09484183 3-deoxy-D-manno-octulosonate 8-phosphate phosphata 98.94
TIGR01459242 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolas 98.93
TIGR01533266 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) famil 98.82
PTZ00445219 p36-lilke protein; Provisional 98.81
TIGR02244343 HAD-IG-Ncltidse HAD superfamily (subfamily IG) hyd 98.8
COG4229229 Predicted enolase-phosphatase [Energy production a 98.79
KOG2882306 consensus p-Nitrophenyl phosphatase [Inorganic ion 98.79
COG0241181 HisB Histidinol phosphatase and related phosphatas 98.77
PF12710192 HAD: haloacid dehalogenase-like hydrolase; PDB: 3P 98.74
KOG3040262 consensus Predicted sugar phosphatase (HAD superfa 98.73
KOG3120256 consensus Predicted haloacid dehalogenase-like hyd 98.7
PRK01158230 phosphoglycolate phosphatase; Provisional 98.7
TIGR01512536 ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translo 98.65
TIGR01482225 SPP-subfamily Sucrose-phosphate phosphatase subfam 98.64
PRK00192273 mannosyl-3-phosphoglycerate phosphatase; Reviewed 98.61
TIGR01487215 SPP-like sucrose-phosphate phosphatase-like hydrol 98.61
TIGR01525556 ATPase-IB_hvy heavy metal translocating P-type ATP 98.59
COG4359220 Uncharacterized conserved protein [Function unknow 98.59
PRK10513270 sugar phosphate phosphatase; Provisional 98.56
PRK15126272 thiamin pyrimidine pyrophosphate hydrolase; Provis 98.55
TIGR01459242 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolas 98.51
TIGR01684301 viral_ppase viral phosphatase. These proteins also 98.48
TIGR02251162 HIF-SF_euk Dullard-like phosphatase domain. This d 98.47
TIGR02463221 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-r 98.46
COG0561264 Cof Predicted hydrolases of the HAD superfamily [G 98.44
TIGR01511562 ATPase-IB1_Cu copper-(or silver)-translocating P-t 98.41
PRK10976266 putative hydrolase; Provisional 98.4
PRK03669271 mannosyl-3-phosphoglycerate phosphatase; Reviewed 98.39
PRK10671834 copA copper exporting ATPase; Provisional 98.3
PLN02887580 hydrolase family protein 98.26
PF09419168 PGP_phosphatase: Mitochondrial PGP phosphatase; In 98.18
PF11019252 DUF2608: Protein of unknown function (DUF2608); In 98.16
TIGR00099256 Cof-subfamily Cof subfamily of IIB subfamily of ha 98.16
TIGR01485249 SPP_plant-cyano sucrose-6F-phosphate phosphohydrol 98.16
PF06941191 NT5C: 5' nucleotidase, deoxy (Pyrimidine), cytosol 98.1
PF08645159 PNK3P: Polynucleotide kinase 3 phosphatase; InterP 98.1
PHA03398303 viral phosphatase superfamily protein; Provisional 98.06
TIGR01522 884 ATPase-IIA2_Ca golgi membrane calcium-translocatin 98.02
PF03767229 Acid_phosphat_B: HAD superfamily, subfamily IIIB ( 98.01
PLN02382 413 probable sucrose-phosphatase 98.0
PRK11033741 zntA zinc/cadmium/mercury/lead-transporting ATPase 97.96
TIGR02461225 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphat 97.95
COG4087152 Soluble P-type ATPase [General function prediction 97.92
COG1778170 Low specificity phosphatase (HAD superfamily) [Gen 97.87
TIGR01675229 plant-AP plant acid phosphatase. This model explic 97.83
PRK14502694 bifunctional mannosyl-3-phosphoglycerate synthase/ 97.8
PLN02177 497 glycerol-3-phosphate acyltransferase 97.79
TIGR01680275 Veg_Stor_Prot vegetative storage protein. The prot 97.7
COG3700237 AphA Acid phosphatase (class B) [General function 97.68
smart00775157 LNS2 LNS2 domain. This domain is found in Saccharo 97.68
TIGR01497675 kdpB K+-transporting ATPase, B subunit. One sequen 97.63
TIGR01116 917 ATPase-IIA1_Ca sarco/endoplasmic reticulum calcium 97.58
KOG2630254 consensus Enolase-phosphatase E-1 [Amino acid tran 97.57
PLN02645 311 phosphoglycolate phosphatase 97.53
PRK12702302 mannosyl-3-phosphoglycerate phosphatase; Reviewed 97.49
PRK14010673 potassium-transporting ATPase subunit B; Provision 97.47
PRK01122679 potassium-transporting ATPase subunit B; Provision 97.45
COG2217713 ZntA Cation transport ATPase [Inorganic ion transp 97.35
TIGR02250156 FCP1_euk FCP1-like phosphatase, phosphatase domain 97.33
PF08235157 LNS2: LNS2 (Lipin/Ned1/Smp2); InterPro: IPR013209 97.24
PF05761448 5_nucleotid: 5' nucleotidase family; InterPro: IPR 97.24
COG5663194 Uncharacterized conserved protein [Function unknow 97.23
PRK10517 902 magnesium-transporting ATPase MgtA; Provisional 97.08
PF13344101 Hydrolase_6: Haloacid dehalogenase-like hydrolase; 97.06
TIGR01524 867 ATPase-IIIB_Mg magnesium-translocating P-type ATPa 96.98
COG0474 917 MgtA Cation transport ATPase [Inorganic ion transp 96.95
PRK15122 903 magnesium-transporting ATPase; Provisional 96.92
TIGR01647 755 ATPase-IIIA_H plasma-membrane proton-efflux P-type 96.9
TIGR01657 1054 P-ATPase-V P-type ATPase of unknown pump specifici 96.83
TIGR01523 1053 ATPase-IID_K-Na potassium and/or sodium efflux P-t 96.8
COG4996164 Predicted phosphatase [General function prediction 96.75
COG2503274 Predicted secreted acid phosphatase [General funct 96.71
TIGR01517 941 ATPase-IIB_Ca plasma-membrane calcium-translocatin 96.58
KOG0207951 consensus Cation transport ATPase [Inorganic ion t 96.38
TIGR01106 997 ATPase-IIC_X-K sodium or proton efflux -- potassiu 96.28
TIGR01484204 HAD-SF-IIB HAD-superfamily hydrolase, subfamily II 96.23
TIGR01652 1057 ATPase-Plipid phospholipid-translocating P-type AT 96.04
PF08282254 Hydrolase_3: haloacid dehalogenase-like hydrolase; 96.02
TIGR00685244 T6PP trehalose-phosphatase. At least 18 distinct s 96.01
COG5610 635 Predicted hydrolase (HAD superfamily) [General fun 95.95
TIGR01452279 PGP_euk phosphoglycolate/pyridoxal phosphate phosp 95.85
PLN02499 498 glycerol-3-phosphate acyltransferase 95.85
TIGR02471236 sucr_syn_bact_C sucrose phosphate synthase, sucros 95.82
COG4030315 Uncharacterized protein conserved in archaea [Func 95.82
PLN03190 1178 aminophospholipid translocase; Provisional 95.61
TIGR01457249 HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydr 95.61
TIGR01486256 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosph 95.58
KOG0202 972 consensus Ca2+ transporting ATPase [Inorganic ion 95.43
KOG0206 1151 consensus P-type ATPase [General function predicti 95.39
PF08282254 Hydrolase_3: haloacid dehalogenase-like hydrolase; 95.3
TIGR01494499 ATPase_P-type ATPase, P-type (transporting), HAD s 95.04
PF05116247 S6PP: Sucrose-6F-phosphate phosphohydrolase; Inter 94.95
PRK10444248 UMP phosphatase; Provisional 94.83
TIGR01458257 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydr 94.7
PTZ00174247 phosphomannomutase; Provisional 93.92
PRK10187266 trehalose-6-phosphate phosphatase; Provisional 93.83
PF03031159 NIF: NLI interacting factor-like phosphatase; Inte 93.77
KOG2961190 consensus Predicted hydrolase (HAD superfamily) [G 93.53
KOG2470 510 consensus Similar to IMP-GMP specific 5'-nucleotid 93.27
KOG2116738 consensus Protein involved in plasmid maintenance/ 92.77
TIGR02245195 HAD_IIID1 HAD-superfamily subfamily IIID hydrolase 92.65
COG2216681 KdpB High-affinity K+ transport system, ATPase cha 92.55
PRK10187266 trehalose-6-phosphate phosphatase; Provisional 92.49
TIGR01460236 HAD-SF-IIA Haloacid Dehalogenase Superfamily Class 91.84
PLN02423245 phosphomannomutase 91.76
PF13344101 Hydrolase_6: Haloacid dehalogenase-like hydrolase; 91.04
PF05822246 UMPH-1: Pyrimidine 5'-nucleotidase (UMPH-1); Inter 90.46
TIGR01662132 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily I 89.47
TIGR01689126 EcbF-BcbF capsule biosynthesis phosphatase. Due to 88.65
KOG0209 1160 consensus P-type ATPase [Inorganic ion transport a 88.5
COG0647269 NagD Predicted sugar phosphatases of the HAD super 87.61
COG1877266 OtsB Trehalose-6-phosphatase [Carbohydrate transpo 87.33
KOG3128298 consensus Uncharacterized conserved protein [Funct 86.74
PF06189264 5-nucleotidase: 5'-nucleotidase; InterPro: IPR0103 86.52
KOG2882306 consensus p-Nitrophenyl phosphatase [Inorganic ion 86.35
TIGR01670154 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-pho 86.29
PLN02423245 phosphomannomutase 86.18
KOG2134422 consensus Polynucleotide kinase 3' phosphatase [Re 86.04
KOG4549144 consensus Magnesium-dependent phosphatase [General 85.81
PRK14501726 putative bifunctional trehalose-6-phosphate syntha 85.38
COG5083580 SMP2 Uncharacterized protein involved in plasmid m 85.15
TIGR01658274 EYA-cons_domain eyes absent protein conserved doma 84.6
PRK09484183 3-deoxy-D-manno-octulosonate 8-phosphate phosphata 83.92
PTZ00174247 phosphomannomutase; Provisional 83.91
TIGR02726169 phenyl_P_delta phenylphosphate carboxylase, delta 83.5
PRK00192273 mannosyl-3-phosphoglycerate phosphatase; Reviewed 83.42
TIGR01681128 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily 83.28
PLN02580384 trehalose-phosphatase 82.99
KOG0323 635 consensus TFIIF-interacting CTD phosphatases, incl 82.1
COG1778170 Low specificity phosphatase (HAD superfamily) [Gen 81.93
PF06506176 PrpR_N: Propionate catabolism activator; InterPro: 80.85
TIGR01456 321 CECR5 HAD-superfamily class IIA hydrolase, TIGR014 80.09
>PLN02779 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
Probab=99.96  E-value=1e-27  Score=230.77  Aligned_cols=224  Identities=28%  Similarity=0.475  Sum_probs=160.4

Q ss_pred             CCceEEEEecCCcccccc-ccCcHHHHHHHHHHcCCCCCCCChHHHHHHHHhhcCChHHHHHHHHHHcCCC----CCC--
Q 017455           82 PRDLAVLLEVDGVLVDAY-RFGNRQAFNVAFQKLGLDCANWTAPIYTDLLRKSAGDEDRMLVLFFNRIGWP----TSV--  154 (371)
Q Consensus        82 ~~~kaviFD~DGTL~d~~-~~~~~~a~~~~~~~~g~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~g~~----~~~--  154 (371)
                      .++++|||||||||+|+. .. +..+|+++++++|++...|+.+.+..+.. .++....+... +...+++    ...  
T Consensus        38 ~~~k~VIFDlDGTLvDS~~~~-~~~a~~~~l~~~G~~~~~~~~~~~~~~~~-~g~~~~~~~~~-~~~~~~~~~~~~~~~~  114 (286)
T PLN02779         38 ALPEALLFDCDGVLVETERDG-HRVAFNDAFKEFGLRPVEWDVELYDELLN-IGGGKERMTWY-FNENGWPTSTIEKAPK  114 (286)
T ss_pred             cCCcEEEEeCceeEEccccHH-HHHHHHHHHHHcCCCCCCCCHHHHHHHHc-cCCChHHHHHH-HHHcCCCccccccCCc
Confidence            457999999999999999 87 89999999999998422366666555544 33334444333 3445555    111  


Q ss_pred             CcchhHHHHHHHHHHHHHHHHHHHhcCCCCCCccHHHHHHHHHHCCCcEEEEcCCCCCCcHHHHHHHHHcCccccchh-e
Q 017455          155 PTNEKKAFVKNVLQEKKNALDEFLASKDAPLRPGVEDFVDDAYNEGIPLIVLTAYGKSGDRIARSVVEKLGSERISKI-K  233 (371)
Q Consensus       155 ~~~~~~~~~~~l~~~~~~~~~~~l~~~~~~~~pgv~elL~~L~~~Gi~v~IvTn~~~~~~~~~~~~l~~lgl~~~f~~-~  233 (371)
                      ..++.+..++.+.+.+.+.|.+.+....++++||+.++|+.|+++|++++|+||+.   ...+..+++.++...+|+. .
T Consensus       115 ~~e~~~~~~~~~~~~~~~~y~~~~~~~~~~l~pGv~elL~~L~~~g~~l~IvTn~~---~~~~~~~l~~~~~~~~~~~~~  191 (286)
T PLN02779        115 DEEERKELVDSLHDRKTELFKELIESGALPLRPGVLRLMDEALAAGIKVAVCSTSN---EKAVSKIVNTLLGPERAQGLD  191 (286)
T ss_pred             cchhhHHHHHHHHHHHHHHHHHHHHhcCCCchhhHHHHHHHHHHCCCeEEEEeCCC---HHHHHHHHHHhccccccCceE
Confidence            12222334445555556666666533446899999999999999999999999954   6777788887754444432 1


Q ss_pred             eecchhHHhhhhccccccccccCCchhHHHHHHHHHHhHHHHHHHHHHHhhccCccccCCCCCchhHHHHHHHHHHHHHc
Q 017455          234 IVGNEEVERSLYGQFVLGKGISSGVDEQLATEARKAVSAQKQEIAEEVASMLKLSVDIDTSSPESLDKIVAALRAGAEYA  313 (371)
Q Consensus       234 i~~~~~~~~~~f~~~v~g~~v~~~~~~~~~~~~~k~~~~~~~~~~~~~~~~~KP~p~i~~p~~~~~~~~~~~~~~a~~~l  313 (371)
                      ++++              +++.                            ..||+|++              |..+++++
T Consensus       192 ~v~~--------------~~~~----------------------------~~KP~p~~--------------~~~a~~~~  215 (286)
T PLN02779        192 VFAG--------------DDVP----------------------------KKKPDPDI--------------YNLAAETL  215 (286)
T ss_pred             EEec--------------cccC----------------------------CCCCCHHH--------------HHHHHHHh
Confidence            1122              2221                            23888888              99999999


Q ss_pred             CCCCCcEEEEeCCHhhHHHHHHcCCcEEEECCCCCCCcccccccccchHHHHhh
Q 017455          314 EKPVRNCFLIAGSQSGVAGAQRIGMPCVVMRSRCITTLPVSKTQRLADMLCRIL  367 (371)
Q Consensus       314 gv~p~e~I~IgDs~~Di~aA~~aGm~~v~v~~~~~~~~~l~~~~~~~~~l~~~l  367 (371)
                      |++|++||||||+.+|+++|+++||++|++.+++....++..++.+++++.+..
T Consensus       216 ~~~p~~~l~IGDs~~Di~aA~~aG~~~i~v~~g~~~~~~l~~ad~vi~~~~~l~  269 (286)
T PLN02779        216 GVDPSRCVVVEDSVIGLQAAKAAGMRCIVTKSSYTADEDFSGADAVFDCLGDVP  269 (286)
T ss_pred             CcChHHEEEEeCCHHhHHHHHHcCCEEEEEccCCccccccCCCcEEECChhhcc
Confidence            999999999999999999999999999999988766666666677776666543



>COG0637 Predicted phosphatase/phosphohexomutase [General function prediction only] Back     alignment and domain information
>TIGR03351 PhnX-like phosphonatase-like hydrolase Back     alignment and domain information
>TIGR01422 phosphonatase phosphonoacetaldehyde hydrolase Back     alignment and domain information
>TIGR01449 PGP_bact 2-phosphoglycolate phosphatase, prokaryotic Back     alignment and domain information
>PRK13226 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PRK13288 pyrophosphatase PpaX; Provisional Back     alignment and domain information
>PLN02770 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PLN03243 haloacid dehalogenase-like hydrolase; Provisional Back     alignment and domain information
>PRK13478 phosphonoacetaldehyde hydrolase; Provisional Back     alignment and domain information
>COG0546 Gph Predicted phosphatases [General function prediction only] Back     alignment and domain information
>PRK10826 2-deoxyglucose-6-phosphatase; Provisional Back     alignment and domain information
>TIGR01990 bPGM beta-phosphoglucomutase Back     alignment and domain information
>PRK10563 6-phosphogluconate phosphatase; Provisional Back     alignment and domain information
>PLN02575 haloacid dehalogenase-like hydrolase Back     alignment and domain information
>PRK11587 putative phosphatase; Provisional Back     alignment and domain information
>PRK13222 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>TIGR02009 PGMB-YQAB-SF beta-phosphoglucomutase family hydrolase Back     alignment and domain information
>PLN02940 riboflavin kinase Back     alignment and domain information
>TIGR02253 CTE7 HAD superfamily (subfamily IA) hydrolase, TIGR02253 Back     alignment and domain information
>PRK13225 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PRK10725 fructose-1-P/6-phosphogluconate phosphatase; Provisional Back     alignment and domain information
>TIGR01454 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthesis related protein Back     alignment and domain information
>PRK13223 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>TIGR02254 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase, TIGR02254 Back     alignment and domain information
>PRK09449 dUMP phosphatase; Provisional Back     alignment and domain information
>TIGR02252 DREG-2 REG-2-like, HAD superfamily (subfamily IA) hydrolase Back     alignment and domain information
>TIGR01428 HAD_type_II 2-haloalkanoic acid dehalogenase, type II Back     alignment and domain information
>PRK06698 bifunctional 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase/phosphatase; Validated Back     alignment and domain information
>PRK14988 GMP/IMP nucleotidase; Provisional Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PLN02811 hydrolase Back     alignment and domain information
>PRK10748 flavin mononucleotide phosphatase; Provisional Back     alignment and domain information
>PF13419 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 2FI1_A 2I6X_A 3SD7_A 4F71_A 4DFD_B 4F72_B 4DCC_A 3DDH_A 3KZX_A 2B0C_A Back     alignment and domain information
>KOG2914 consensus Predicted haloacid-halidohydrolase and related hydrolases [General function prediction only] Back     alignment and domain information
>TIGR02247 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-like phosphatase Back     alignment and domain information
>TIGR01548 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, subfamily IA hydrolase, TIGR01548 Back     alignment and domain information
>TIGR01509 HAD-SF-IA-v3 haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED Back     alignment and domain information
>TIGR01993 Pyr-5-nucltdase pyrimidine 5'-nucleotidase Back     alignment and domain information
>PRK09456 ?-D-glucose-1-phosphatase; Provisional Back     alignment and domain information
>KOG3085 consensus Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>COG1011 Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>PHA02597 30 Back     alignment and domain information
>TIGR00338 serB phosphoserine phosphatase SerB Back     alignment and domain information
>TIGR01549 HAD-SF-IA-v1 haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E Back     alignment and domain information
>PLN02954 phosphoserine phosphatase Back     alignment and domain information
>TIGR01493 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, subfamily IA, variant 2 with 3rd motif like haloacid dehalogenase Back     alignment and domain information
>TIGR01491 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPase-like hydrolase, archaeal Back     alignment and domain information
>TIGR01691 enolase-ppase 2,3-diketo-5-methylthio-1-phosphopentane phosphatase Back     alignment and domain information
>PRK11133 serB phosphoserine phosphatase; Provisional Back     alignment and domain information
>KOG3109 consensus Haloacid dehalogenase-like hydrolase [General function prediction only] Back     alignment and domain information
>PRK08942 D,D-heptose 1,7-bisphosphate phosphatase; Validated Back     alignment and domain information
>TIGR01656 Histidinol-ppas histidinol-phosphate phosphatase family domain Back     alignment and domain information
>PRK09552 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; Reviewed Back     alignment and domain information
>TIGR01672 AphA HAD superfamily (subfamily IIIB) phosphatase, TIGR01672 Back     alignment and domain information
>PRK06769 hypothetical protein; Validated Back     alignment and domain information
>PRK13582 thrH phosphoserine phosphatase; Provisional Back     alignment and domain information
>TIGR00213 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase Back     alignment and domain information
>TIGR01664 DNA-3'-Pase DNA 3'-phosphatase Back     alignment and domain information
>COG0560 SerB Phosphoserine phosphatase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01490 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrolase, TIGR01490 Back     alignment and domain information
>TIGR01452 PGP_euk phosphoglycolate/pyridoxal phosphate phosphatase family Back     alignment and domain information
>TIGR01261 hisB_Nterm histidinol-phosphatase Back     alignment and domain information
>TIGR01489 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopentane phosphatase Back     alignment and domain information
>cd01427 HAD_like Haloacid dehalogenase-like hydrolases Back     alignment and domain information
>TIGR02137 HSK-PSP phosphoserine phosphatase/homoserine phosphotransferase bifunctional protein Back     alignment and domain information
>TIGR01685 MDP-1 magnesium-dependent phosphatase-1 Back     alignment and domain information
>TIGR01458 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydrolase, TIGR01458 Back     alignment and domain information
>TIGR01488 HAD-SF-IB Haloacid Dehalogenase superfamily, subfamily IB, phosphoserine phosphatase-like Back     alignment and domain information
>TIGR03333 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase Back     alignment and domain information
>TIGR01662 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily IIIA Back     alignment and domain information
>TIGR01668 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) phosphatase, TIGR01668 Back     alignment and domain information
>PRK11590 hypothetical protein; Provisional Back     alignment and domain information
>PF00702 Hydrolase: haloacid dehalogenase-like hydrolase; InterPro: IPR005834 This group of hydrolase enzymes is structurally different from the alpha/beta hydrolase family (abhydrolase) Back     alignment and domain information
>PRK10444 UMP phosphatase; Provisional Back     alignment and domain information
>PRK11009 aphA acid phosphatase/phosphotransferase; Provisional Back     alignment and domain information
>TIGR01457 HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydrolase, TIGR01457 Back     alignment and domain information
>KOG1615 consensus Phosphoserine phosphatase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02645 phosphoglycolate phosphatase Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>PRK05446 imidazole glycerol-phosphate dehydratase/histidinol phosphatase; Provisional Back     alignment and domain information
>PF13242 Hydrolase_like: HAD-hyrolase-like; PDB: 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A 2HX1_D 2X4D_A 3HLT_C 3L1U_B Back     alignment and domain information
>smart00577 CPDc catalytic domain of ctd-like phosphatases Back     alignment and domain information
>PRK08238 hypothetical protein; Validated Back     alignment and domain information
>COG0647 NagD Predicted sugar phosphatases of the HAD superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01544 HAD-SF-IE haloacid dehalogenase superfamily, subfamily IE hydrolase, TIGR01544 Back     alignment and domain information
>TIGR01686 FkbH FkbH-like domain Back     alignment and domain information
>COG2179 Predicted hydrolase of the HAD superfamily [General function prediction only] Back     alignment and domain information
>TIGR01681 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily IIIC Back     alignment and domain information
>TIGR02726 phenyl_P_delta phenylphosphate carboxylase, delta subunit Back     alignment and domain information
>TIGR01670 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family Back     alignment and domain information
>TIGR01545 YfhB_g-proteo haloacid dehalogenase superfamily, subfamily IF hydrolase, YfhB Back     alignment and domain information
>TIGR01456 CECR5 HAD-superfamily class IIA hydrolase, TIGR01456, CECR5 Back     alignment and domain information
>TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase Back     alignment and domain information
>PRK10530 pyridoxal phosphate (PLP) phosphatase; Provisional Back     alignment and domain information
>PF06888 Put_Phosphatase: Putative Phosphatase; InterPro: IPR016965 This group represents phosphatases related to PHOSPHO1 and PHOSPHO2 [] Back     alignment and domain information
>PF12689 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 This entry represents two closely related clades of sequences from eukaryotes and archaea Back     alignment and domain information
>TIGR01460 HAD-SF-IIA Haloacid Dehalogenase Superfamily Class (subfamily) IIA Back     alignment and domain information
>PRK09484 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; Provisional Back     alignment and domain information
>TIGR01459 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolase, TIGR01459 Back     alignment and domain information
>TIGR01533 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) family Back     alignment and domain information
>PTZ00445 p36-lilke protein; Provisional Back     alignment and domain information
>TIGR02244 HAD-IG-Ncltidse HAD superfamily (subfamily IG) hydrolase, 5'-nucleotidase Back     alignment and domain information
>COG4229 Predicted enolase-phosphatase [Energy production and conversion] Back     alignment and domain information
>KOG2882 consensus p-Nitrophenyl phosphatase [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG0241 HisB Histidinol phosphatase and related phosphatases [Amino acid transport and metabolism] Back     alignment and domain information
>PF12710 HAD: haloacid dehalogenase-like hydrolase; PDB: 3P96_A 3N28_A 3FVV_A 1RKU_A 1RKV_A 1Y8A_A 2FEA_B 3KD3_B Back     alignment and domain information
>KOG3040 consensus Predicted sugar phosphatase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>KOG3120 consensus Predicted haloacid dehalogenase-like hydrolase [General function prediction only] Back     alignment and domain information
>PRK01158 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>TIGR01512 ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase Back     alignment and domain information
>TIGR01482 SPP-subfamily Sucrose-phosphate phosphatase subfamily Back     alignment and domain information
>PRK00192 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>TIGR01487 SPP-like sucrose-phosphate phosphatase-like hydrolase, Archaeal Back     alignment and domain information
>TIGR01525 ATPase-IB_hvy heavy metal translocating P-type ATPase Back     alignment and domain information
>COG4359 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10513 sugar phosphate phosphatase; Provisional Back     alignment and domain information
>PRK15126 thiamin pyrimidine pyrophosphate hydrolase; Provisional Back     alignment and domain information
>TIGR01459 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolase, TIGR01459 Back     alignment and domain information
>TIGR01684 viral_ppase viral phosphatase Back     alignment and domain information
>TIGR02251 HIF-SF_euk Dullard-like phosphatase domain Back     alignment and domain information
>TIGR02463 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-related protein Back     alignment and domain information
>COG0561 Cof Predicted hydrolases of the HAD superfamily [General function prediction only] Back     alignment and domain information
>TIGR01511 ATPase-IB1_Cu copper-(or silver)-translocating P-type ATPase Back     alignment and domain information
>PRK10976 putative hydrolase; Provisional Back     alignment and domain information
>PRK03669 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>PRK10671 copA copper exporting ATPase; Provisional Back     alignment and domain information
>PLN02887 hydrolase family protein Back     alignment and domain information
>PF09419 PGP_phosphatase: Mitochondrial PGP phosphatase; InterPro: IPR010021 This group of hypothetical proteins is a part of the IIIA subfamily of the haloacid dehalogenase (HAD) superfamily of hydrolases Back     alignment and domain information
>PF11019 DUF2608: Protein of unknown function (DUF2608); InterPro: IPR022565 This family is conserved in Bacteria Back     alignment and domain information
>TIGR00099 Cof-subfamily Cof subfamily of IIB subfamily of haloacid dehalogenase superfamily Back     alignment and domain information
>TIGR01485 SPP_plant-cyano sucrose-6F-phosphate phosphohydrolase Back     alignment and domain information
>PF06941 NT5C: 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C); InterPro: IPR010708 This family consists of several 5' nucleotidase, deoxy (Pyrimidine), and cytosolic type C (NT5C) proteins Back     alignment and domain information
>PF08645 PNK3P: Polynucleotide kinase 3 phosphatase; InterPro: IPR013954 Polynucleotide kinase 3 phosphatases play a role in the repair of single breaks in DNA induced by DNA-damaging agents such as gamma radiation and camptothecin [] Back     alignment and domain information
>PHA03398 viral phosphatase superfamily protein; Provisional Back     alignment and domain information
>TIGR01522 ATPase-IIA2_Ca golgi membrane calcium-translocating P-type ATPase Back     alignment and domain information
>PF03767 Acid_phosphat_B: HAD superfamily, subfamily IIIB (Acid phosphatase); InterPro: IPR005519 This family of class B acid phosphatases also contains a number of vegetative storage proteins (VPS25) Back     alignment and domain information
>PLN02382 probable sucrose-phosphatase Back     alignment and domain information
>PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional Back     alignment and domain information
>TIGR02461 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphatase Back     alignment and domain information
>COG4087 Soluble P-type ATPase [General function prediction only] Back     alignment and domain information
>COG1778 Low specificity phosphatase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01675 plant-AP plant acid phosphatase Back     alignment and domain information
>PRK14502 bifunctional mannosyl-3-phosphoglycerate synthase/mannosyl-3 phosphoglycerate phosphatase; Provisional Back     alignment and domain information
>PLN02177 glycerol-3-phosphate acyltransferase Back     alignment and domain information
>TIGR01680 Veg_Stor_Prot vegetative storage protein Back     alignment and domain information
>COG3700 AphA Acid phosphatase (class B) [General function prediction only] Back     alignment and domain information
>smart00775 LNS2 LNS2 domain Back     alignment and domain information
>TIGR01497 kdpB K+-transporting ATPase, B subunit Back     alignment and domain information
>TIGR01116 ATPase-IIA1_Ca sarco/endoplasmic reticulum calcium-translocating P-type ATPase Back     alignment and domain information
>KOG2630 consensus Enolase-phosphatase E-1 [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02645 phosphoglycolate phosphatase Back     alignment and domain information
>PRK12702 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>PRK14010 potassium-transporting ATPase subunit B; Provisional Back     alignment and domain information
>PRK01122 potassium-transporting ATPase subunit B; Provisional Back     alignment and domain information
>COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02250 FCP1_euk FCP1-like phosphatase, phosphatase domain Back     alignment and domain information
>PF08235 LNS2: LNS2 (Lipin/Ned1/Smp2); InterPro: IPR013209 This domain is found in Saccharomyces cerevisiae (Baker's yeast) protein SMP2, proteins with an N-terminal lipin domain (IPR007651 from INTERPRO) and phosphatidylinositol transfer proteins [] Back     alignment and domain information
>PF05761 5_nucleotid: 5' nucleotidase family; InterPro: IPR008380 This family includes a 5'-nucleotidase, 3 Back     alignment and domain information
>COG5663 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10517 magnesium-transporting ATPase MgtA; Provisional Back     alignment and domain information
>PF13344 Hydrolase_6: Haloacid dehalogenase-like hydrolase; PDB: 2HO4_B 1YV9_A 1WVI_B 3EPR_A 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A Back     alignment and domain information
>TIGR01524 ATPase-IIIB_Mg magnesium-translocating P-type ATPase Back     alignment and domain information
>COG0474 MgtA Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK15122 magnesium-transporting ATPase; Provisional Back     alignment and domain information
>TIGR01647 ATPase-IIIA_H plasma-membrane proton-efflux P-type ATPase Back     alignment and domain information
>TIGR01657 P-ATPase-V P-type ATPase of unknown pump specificity (type V) Back     alignment and domain information
>TIGR01523 ATPase-IID_K-Na potassium and/or sodium efflux P-type ATPase, fungal-type Back     alignment and domain information
>COG4996 Predicted phosphatase [General function prediction only] Back     alignment and domain information
>COG2503 Predicted secreted acid phosphatase [General function prediction only] Back     alignment and domain information
>TIGR01517 ATPase-IIB_Ca plasma-membrane calcium-translocating P-type ATPase Back     alignment and domain information
>KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01106 ATPase-IIC_X-K sodium or proton efflux -- potassium uptake antiporter, P-type ATPase, alpha subunit Back     alignment and domain information
>TIGR01484 HAD-SF-IIB HAD-superfamily hydrolase, subfamily IIB Back     alignment and domain information
>TIGR01652 ATPase-Plipid phospholipid-translocating P-type ATPase, flippase Back     alignment and domain information
>PF08282 Hydrolase_3: haloacid dehalogenase-like hydrolase; InterPro: IPR013200 The Haloacid Dehydrogenase (HAD) superfamily includes phosphatases, phosphonatases, P-type ATPases, beta-phosphoglucomutases, phosphomannomutases, and dehalogenases, which are involved in a variety of cellular processes ranging from amino acid biosynthesis to detoxification [] Back     alignment and domain information
>TIGR00685 T6PP trehalose-phosphatase Back     alignment and domain information
>COG5610 Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01452 PGP_euk phosphoglycolate/pyridoxal phosphate phosphatase family Back     alignment and domain information
>PLN02499 glycerol-3-phosphate acyltransferase Back     alignment and domain information
>TIGR02471 sucr_syn_bact_C sucrose phosphate synthase, sucrose phosphatase-like domain, bacterial Back     alignment and domain information
>COG4030 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>PLN03190 aminophospholipid translocase; Provisional Back     alignment and domain information
>TIGR01457 HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydrolase, TIGR01457 Back     alignment and domain information
>TIGR01486 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosphatase family Back     alignment and domain information
>KOG0202 consensus Ca2+ transporting ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0206 consensus P-type ATPase [General function prediction only] Back     alignment and domain information
>PF08282 Hydrolase_3: haloacid dehalogenase-like hydrolase; InterPro: IPR013200 The Haloacid Dehydrogenase (HAD) superfamily includes phosphatases, phosphonatases, P-type ATPases, beta-phosphoglucomutases, phosphomannomutases, and dehalogenases, which are involved in a variety of cellular processes ranging from amino acid biosynthesis to detoxification [] Back     alignment and domain information
>TIGR01494 ATPase_P-type ATPase, P-type (transporting), HAD superfamily, subfamily IC Back     alignment and domain information
>PF05116 S6PP: Sucrose-6F-phosphate phosphohydrolase; InterPro: IPR006380 This family of sequences represent sucrose phosphate phosphohydrolase (SPP) from plants and cyanobacteria [] Back     alignment and domain information
>PRK10444 UMP phosphatase; Provisional Back     alignment and domain information
>TIGR01458 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydrolase, TIGR01458 Back     alignment and domain information
>PTZ00174 phosphomannomutase; Provisional Back     alignment and domain information
>PRK10187 trehalose-6-phosphate phosphatase; Provisional Back     alignment and domain information
>PF03031 NIF: NLI interacting factor-like phosphatase; InterPro: IPR004274 The function of this domain is unclear Back     alignment and domain information
>KOG2961 consensus Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>KOG2470 consensus Similar to IMP-GMP specific 5'-nucleotidase [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG2116 consensus Protein involved in plasmid maintenance/nuclear protein involved in lipid metabolism [Cell motility; Lipid transport and metabolism] Back     alignment and domain information
>TIGR02245 HAD_IIID1 HAD-superfamily subfamily IIID hydrolase, TIGR02245 Back     alignment and domain information
>COG2216 KdpB High-affinity K+ transport system, ATPase chain B [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10187 trehalose-6-phosphate phosphatase; Provisional Back     alignment and domain information
>TIGR01460 HAD-SF-IIA Haloacid Dehalogenase Superfamily Class (subfamily) IIA Back     alignment and domain information
>PLN02423 phosphomannomutase Back     alignment and domain information
>PF13344 Hydrolase_6: Haloacid dehalogenase-like hydrolase; PDB: 2HO4_B 1YV9_A 1WVI_B 3EPR_A 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A Back     alignment and domain information
>PF05822 UMPH-1: Pyrimidine 5'-nucleotidase (UMPH-1); InterPro: IPR006434 This family is a small group of metazoan sequences with sequences from Arabidopsis thaliana (Mouse-ear cress) and rice Back     alignment and domain information
>TIGR01662 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily IIIA Back     alignment and domain information
>TIGR01689 EcbF-BcbF capsule biosynthesis phosphatase Back     alignment and domain information
>KOG0209 consensus P-type ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG0647 NagD Predicted sugar phosphatases of the HAD superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG1877 OtsB Trehalose-6-phosphatase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG3128 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF06189 5-nucleotidase: 5'-nucleotidase; InterPro: IPR010394 This family consists of both eukaryotic and prokaryotic 5'-nucleotidase sequences (3 Back     alignment and domain information
>KOG2882 consensus p-Nitrophenyl phosphatase [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01670 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family Back     alignment and domain information
>PLN02423 phosphomannomutase Back     alignment and domain information
>KOG2134 consensus Polynucleotide kinase 3' phosphatase [Replication, recombination and repair] Back     alignment and domain information
>KOG4549 consensus Magnesium-dependent phosphatase [General function prediction only] Back     alignment and domain information
>PRK14501 putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional Back     alignment and domain information
>COG5083 SMP2 Uncharacterized protein involved in plasmid maintenance [General function prediction only] Back     alignment and domain information
>TIGR01658 EYA-cons_domain eyes absent protein conserved domain Back     alignment and domain information
>PRK09484 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; Provisional Back     alignment and domain information
>PTZ00174 phosphomannomutase; Provisional Back     alignment and domain information
>TIGR02726 phenyl_P_delta phenylphosphate carboxylase, delta subunit Back     alignment and domain information
>PRK00192 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>TIGR01681 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily IIIC Back     alignment and domain information
>PLN02580 trehalose-phosphatase Back     alignment and domain information
>KOG0323 consensus TFIIF-interacting CTD phosphatases, including NLI-interacting factor [Transcription] Back     alignment and domain information
>COG1778 Low specificity phosphatase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>PF06506 PrpR_N: Propionate catabolism activator; InterPro: IPR010524 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions [] Back     alignment and domain information
>TIGR01456 CECR5 HAD-superfamily class IIA hydrolase, TIGR01456, CECR5 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query371
1te2_A226 Putative phosphatase; structural genomics, phospha 3e-10
3iru_A277 Phoshonoacetaldehyde hydrolase like protein; phosp 6e-10
1swv_A267 Phosphonoacetaldehyde hydrolase; HAD enzyme superf 1e-09
3e58_A214 Putative beta-phosphoglucomutase; structu genomics 2e-09
4g9b_A243 Beta-PGM, beta-phosphoglucomutase; HAD, putative p 6e-09
2pib_A216 Phosphorylated carbohydrates phosphatase TM_1254; 7e-09
3s6j_A233 Hydrolase, haloacid dehalogenase-like family; stru 9e-09
3dv9_A247 Beta-phosphoglucomutase; structural genomics, APC6 6e-08
3qxg_A243 Inorganic pyrophosphatase; hydrolase, magnesium bi 8e-08
3nas_A233 Beta-PGM, beta-phosphoglucomutase; PSI, structural 5e-07
2wf7_A221 Beta-PGM, beta-phosphoglucomutase; transition stat 2e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
3l5k_A250 Protein GS1, haloacid dehalogenase-like hydrolase 2e-06
3kzx_A231 HAD-superfamily hydrolase, subfamily IA, variant; 2e-04
2zg6_A220 Putative uncharacterized protein ST2620, probable 3e-04
2qlt_A275 (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, sac 6e-04
2fdr_A229 Conserved hypothetical protein; SAD, structural ge 7e-04
4eek_A259 Beta-phosphoglucomutase-related protein; hydrolase 9e-04
>1te2_A Putative phosphatase; structural genomics, phosphates, PSI, protein S initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Escherichia coli} SCOP: c.108.1.6 Length = 226 Back     alignment and structure
 Score = 58.8 bits (143), Expect = 3e-10
 Identities = 33/167 (19%), Positives = 68/167 (40%), Gaps = 24/167 (14%)

Query: 80  NPPRDL-AVLLEVDGVLVDAYRFGNRQAFNVAFQKLGLDCANWTAPIYTDLLRKSAG-DE 137
           + PR + A + ++DG+L+D+      +A       LG+D +        + L  + G   
Sbjct: 4   STPRQILAAIFDMDGLLIDSEPLW-DRAELDVMASLGVDISRR------NELPDTLGLRI 56

Query: 138 DRMLVLFFNRIGWPTSVPTNEKKAFVKNVLQEKKNALDEFLASKDAPLRPGVEDFVDDAY 197
           D ++ L++ R  W    P+ ++       + E+  A    L  +  PL PGV + V    
Sbjct: 57  DMVVDLWYARQPWNG--PSRQE-------VVERVIARAISLVEETRPLLPGVREAVALCK 107

Query: 198 NEGIPLIVLTAYGKSGDRIARSVVEKLG-SERISKIKIVGNEEVERS 243
            +G+ + + +A   S   +   V+      +      +   E++  S
Sbjct: 108 EQGLLVGLASA---SPLHMLEKVLTMFDLRDSFD--ALASAEKLPYS 149


>3iru_A Phoshonoacetaldehyde hydrolase like protein; phosphonoacetaldehyde hydrolase like P structural genomics, PSI-2, protein structure initiative; 2.30A {Oleispira antarctica} Length = 277 Back     alignment and structure
>1swv_A Phosphonoacetaldehyde hydrolase; HAD enzyme superfamily, phosphonotase, metal binding; 2.30A {Bacillus cereus} SCOP: c.108.1.3 PDB: 1sww_A 2iof_A* 2ioh_A 1rql_A 1rqn_A 2iof_K* 1rdf_A 1fez_A Length = 267 Back     alignment and structure
>3e58_A Putative beta-phosphoglucomutase; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.86A {Streptococcus thermophilus lmg 18311} Length = 214 Back     alignment and structure
>4g9b_A Beta-PGM, beta-phosphoglucomutase; HAD, putative phosphoglucomutase, enzyme function initiative structural genomics, isomerase; 1.70A {Escherichia coli} Length = 243 Back     alignment and structure
>3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV} Length = 233 Back     alignment and structure
>3dv9_A Beta-phosphoglucomutase; structural genomics, APC60149, PSI- protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.72A {Bacteroides vulgatus} Length = 247 Back     alignment and structure
>3qxg_A Inorganic pyrophosphatase; hydrolase, magnesium binding site, NEW YORK research center for structural genomics; HET: TLA; 1.24A {Bacteroides thetaiotaomicron} PDB: 3qu2_A* 3qx7_A 3quq_A* 3r9k_A 3qut_A 3qu9_A* 3qu7_A 3qu5_A 3qyp_A 3quc_A 3qub_A 3qu4_A Length = 243 Back     alignment and structure
>3nas_A Beta-PGM, beta-phosphoglucomutase; PSI, structural genomics, protein structure initiative, NEW research center for structural genomics; 3.00A {Bacillus subtilis} Length = 233 Back     alignment and structure
>2wf7_A Beta-PGM, beta-phosphoglucomutase; transition state analogue, haloacid dehalogenase superfamily, isomerase, phosphotransferase; HET: G7P; 1.05A {Lactococcus lactis} PDB: 1o03_A* 1z4n_A* 1z4o_A* 1zol_A 2wf5_A* 2wf6_A* 1o08_A* 2wf8_A* 2wf9_A* 2wfa_A 2whe_A 1lvh_A* 3fm9_A Length = 221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3l5k_A Protein GS1, haloacid dehalogenase-like hydrolase domain- containing protein 1A; HDHD1A, haloacid dehalogenase-like hydrolase domain containing 1A; 2.00A {Homo sapiens} Length = 250 Back     alignment and structure
>3kzx_A HAD-superfamily hydrolase, subfamily IA, variant; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 1.90A {Ehrlichia chaffeensis} Length = 231 Back     alignment and structure
>2zg6_A Putative uncharacterized protein ST2620, probable 2-haloalkanoic; probable 2-haloalkanoic acid dehalogenase, hydrolase, structural genomics; 2.40A {Sulfolobus tokodaii} Length = 220 Back     alignment and structure
>2qlt_A (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, saccharom cerevisiae, structural genomics, PSI-2, protein structure initiative; 1.60A {Saccharomyces cerevisiae} Length = 275 Back     alignment and structure
>2fdr_A Conserved hypothetical protein; SAD, structural genomics, agrobacter tumefaciens, HAD-superfamily hydrolase; 2.00A {Agrobacterium tumefaciens str} SCOP: c.108.1.6 Length = 229 Back     alignment and structure
>4eek_A Beta-phosphoglucomutase-related protein; hydrolase, magnesium binding site, enzyme function initiativ; 1.60A {Deinococcus radiodurans} PDB: 4eel_A* 4een_A Length = 259 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query371
3kbb_A216 Phosphorylated carbohydrates phosphatase TM_1254; 99.97
4g9b_A243 Beta-PGM, beta-phosphoglucomutase; HAD, putative p 99.97
4gib_A250 Beta-phosphoglucomutase; rossmann fold, HAD-like, 99.96
2pib_A216 Phosphorylated carbohydrates phosphatase TM_1254; 99.95
3e58_A214 Putative beta-phosphoglucomutase; structu genomics 99.94
2hi0_A240 Putative phosphoglycolate phosphatase; YP_619066.1 99.94
2ah5_A210 COG0546: predicted phosphatases; MCSG, structural 99.94
4ex6_A237 ALNB; modified rossman fold, phosphatase, magnesiu 99.94
3s6j_A233 Hydrolase, haloacid dehalogenase-like family; stru 99.94
2hsz_A243 Novel predicted phosphatase; structural genomics, 99.94
3l5k_A250 Protein GS1, haloacid dehalogenase-like hydrolase 99.94
3qxg_A243 Inorganic pyrophosphatase; hydrolase, magnesium bi 99.94
3nas_A233 Beta-PGM, beta-phosphoglucomutase; PSI, structural 99.93
4eek_A259 Beta-phosphoglucomutase-related protein; hydrolase 99.93
2nyv_A222 Pgpase, PGP, phosphoglycolate phosphatase; structu 99.93
3dv9_A247 Beta-phosphoglucomutase; structural genomics, APC6 99.93
3mc1_A226 Predicted phosphatase, HAD family; PSI2, NYSGXRC, 99.93
3ed5_A238 YFNB; APC60080, bacillus subtilis subsp. subtilis 99.93
2hdo_A209 Phosphoglycolate phosphatase; NP_784602.1, structu 99.93
3k1z_A263 Haloacid dehalogenase-like hydrolase domain-conta 99.92
2hoq_A241 Putative HAD-hydrolase PH1655; haloacid dehalogena 99.92
3qnm_A240 Haloacid dehalogenase-like hydrolase; structural g 99.92
3iru_A277 Phoshonoacetaldehyde hydrolase like protein; phosp 99.92
2hcf_A234 Hydrolase, haloacid dehalogenase-like family; NP_6 99.92
3sd7_A240 Putative phosphatase; structural genomics, haloaci 99.92
2om6_A235 Probable phosphoserine phosphatase; rossmann fold, 99.91
2gfh_A260 Haloacid dehalogenase-like hydrolase domain conta; 99.91
2go7_A207 Hydrolase, haloacid dehalogenase-like family; stru 99.91
3kzx_A231 HAD-superfamily hydrolase, subfamily IA, variant; 99.91
3d6j_A225 Putative haloacid dehalogenase-like hydrolase; str 99.91
2wf7_A221 Beta-PGM, beta-phosphoglucomutase; transition stat 99.91
1te2_A226 Putative phosphatase; structural genomics, phospha 99.9
3ddh_A234 Putative haloacid dehalogenase-like family hydrol; 99.9
3smv_A240 S-(-)-azetidine-2-carboxylate hydrolase; haloacid 99.9
3umg_A254 Haloacid dehalogenase; defluorinase, hydrolase; 2. 99.9
1yns_A261 E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo 99.9
2zg6_A220 Putative uncharacterized protein ST2620, probable 99.9
3um9_A230 Haloacid dehalogenase, type II; haloacid dehalogen 99.9
3umc_A254 Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeru 99.9
3m9l_A205 Hydrolase, haloacid dehalogenase-like family; HAD 99.9
2pke_A251 Haloacid delahogenase-like family hydrolase; NP_63 99.9
2g80_A253 Protein UTR4; YEL038W, UTR4 protein (unknown trans 99.89
3umb_A233 Dehalogenase-like hydrolase; 2.20A {Ralstonia sola 99.89
1swv_A267 Phosphonoacetaldehyde hydrolase; HAD enzyme superf 99.89
2no4_A240 (S)-2-haloacid dehalogenase IVA; HAD superfamily, 99.89
4dcc_A229 Putative haloacid dehalogenase-like hydrolase; mag 99.89
1zrn_A232 L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseud 99.89
3vay_A230 HAD-superfamily hydrolase; rossmann fold, haloacid 99.89
3cnh_A200 Hydrolase family protein; NP_295428.1, predicted h 99.89
3u26_A234 PF00702 domain protein; structural genomics, PSI-b 99.88
2fi1_A190 Hydrolase, haloacid dehalogenase-like family; stru 99.88
2fdr_A229 Conserved hypothetical protein; SAD, structural ge 99.88
2w43_A201 Hypothetical 2-haloalkanoic acid dehalogenase; hyd 99.87
3nuq_A282 Protein SSM1, putative nucleotide phosphatase; sup 99.87
2qlt_A275 (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, sac 99.87
2i6x_A211 Hydrolase, haloacid dehalogenase-like family; HAD 99.87
2p11_A231 Hypothetical protein; putative haloacid dehalogena 99.86
2b0c_A206 Putative phosphatase; alpha-D-glucose-1-phosphate, 99.86
1nnl_A225 L-3-phosphoserine phosphatase; PSP, HPSP, phospho- 99.85
1qq5_A253 Protein (L-2-haloacid dehalogenase); hydrolase; 1. 99.85
3l8h_A179 Putative haloacid dehalogenase-like hydrolase; HAD 99.84
3ib6_A189 Uncharacterized protein; structural genomics, unkn 99.84
3i28_A 555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 99.83
3fvv_A232 Uncharacterized protein; unknown function, structu 99.83
1qyi_A384 ZR25, hypothetical protein; structural genomics, P 99.82
3m1y_A217 Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, 99.82
2oda_A196 Hypothetical protein pspto_2114; haloacid dehaloge 99.82
4eze_A317 Haloacid dehalogenase-like hydrolase; magnesium bi 99.81
2c4n_A250 Protein NAGD; nucleotide phosphatase, HAD superfam 99.79
2ho4_A259 Haloacid dehalogenase-like hydrolase domain contai 99.78
1rku_A206 Homoserine kinase; phosphoserine phosphatase, phos 99.78
3kd3_A219 Phosphoserine phosphohydrolase-like protein; csgid 99.78
3p96_A415 Phosphoserine phosphatase SERB; ssgcid, structural 99.78
1yv9_A264 Hydrolase, haloacid dehalogenase family; hypotheti 99.77
2gmw_A211 D,D-heptose 1,7-bisphosphate phosphatase; Zn-bindi 99.76
2i7d_A193 5'(3')-deoxyribonucleotidase, cytosolic type; hydr 99.76
1q92_A197 5(3)-deoxyribonucleotidase; alpha-beta rossman fol 99.75
2fea_A236 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate 99.75
1l7m_A211 Phosphoserine phosphatase; rossmann fold, four-hel 99.74
3n28_A335 Phosphoserine phosphatase; HAD family hydrolase, s 99.73
2wm8_A187 MDP-1, magnesium-dependent phosphatase 1; haloacid 99.73
4ap9_A201 Phosphoserine phosphatase; hydrolase, haloacid deh 99.71
2b82_A211 APHA, class B acid phosphatase; DDDD acid phosphat 99.7
3a1c_A287 Probable copper-exporting P-type ATPase A; ATP-bin 99.7
1vjr_A271 4-nitrophenylphosphatase; TM1742, structural genom 99.69
2x4d_A271 HLHPP, phospholysine phosphohistidine inorganic py 99.68
2pr7_A137 Haloacid dehalogenase/epoxide hydrolase family; NP 99.63
3e8m_A164 Acylneuraminate cytidylyltransferase; 2-keto-3-deo 99.63
3skx_A280 Copper-exporting P-type ATPase B; P1B-ATPase, ATP 99.63
2hx1_A284 Predicted sugar phosphatases of the HAD superfamil 99.63
2p9j_A162 Hypothetical protein AQ2171; secsg, riken, PSI, st 99.62
3qgm_A268 P-nitrophenyl phosphatase (PHO2); structural genom 99.61
2oyc_A306 PLP phosphatase, pyridoxal phosphate phosphatase; 99.61
3mmz_A176 Putative HAD family hydrolase; structural genomics 99.61
3ij5_A211 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; 99.61
2o2x_A218 Hypothetical protein; structural genomics, joint c 99.6
2fpr_A176 Histidine biosynthesis bifunctional protein HISB; 99.6
1zjj_A263 Hypothetical protein PH1952; alpha/beta hydrolase 99.59
3mn1_A189 Probable YRBI family phosphatase; structural genom 99.58
3epr_A264 Hydrolase, haloacid dehalogenase-like family; stru 99.57
3bwv_A180 Putative 5'(3')-deoxyribonucleotidase; NP_764060.1 99.57
3zvl_A 416 Bifunctional polynucleotide phosphatase/kinase; hy 99.56
3n07_A195 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; 99.54
2yj3_A263 Copper-transporting ATPase; hydrolase, P-type ATPa 99.3
1k1e_A180 Deoxy-D-mannose-octulosonate 8-phosphate phosphat; 99.54
2r8e_A188 3-deoxy-D-manno-octulosonate 8-phosphate phosphata 99.52
3pdw_A266 Uncharacterized hydrolase YUTF; structural genomic 99.52
3n1u_A191 Hydrolase, HAD superfamily, subfamily III A; struc 99.52
3gyg_A289 NTD biosynthesis operon putative hydrolase NTDB; P 99.44
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 99.39
2i33_A258 Acid phosphatase; HAD superfamily, hydrolase; 1.57 99.38
4dw8_A279 Haloacid dehalogenase-like hydrolase; HAD, putativ 99.33
3dnp_A290 Stress response protein YHAX; structural PSI-2, pr 99.32
2pq0_A258 Hypothetical conserved protein GK1056; hyopthetica 99.29
1wr8_A231 Phosphoglycolate phosphatase; alpha / beta core do 99.27
3dao_A283 Putative phosphatse; structural genomics, joint ce 99.22
3mpo_A279 Predicted hydrolase of the HAD superfamily; SGX, P 99.2
3l7y_A304 Putative uncharacterized protein SMU.1108C; hydrol 99.19
3nvb_A387 Uncharacterized protein; protein FKBH, protein fkb 99.15
3kc2_A352 Uncharacterized protein YKR070W; HAD-like, mitocho 99.14
2rbk_A261 Putative uncharacterized protein; HAD-like phospha 99.13
3fzq_A274 Putative hydrolase; YP_001086940.1, putative haloa 99.07
1nrw_A288 Hypothetical protein, haloacid dehalogenase-like h 99.0
1rlm_A271 Phosphatase; HAD family, rossman fold, hydrolase; 98.97
3pgv_A285 Haloacid dehalogenase-like hydrolase; structural g 98.95
3pct_A260 Class C acid phosphatase; hydrolase, outer membran 98.93
3ocu_A262 Lipoprotein E; hydrolase, outer membrane; HET: NMN 98.92
2hhl_A195 CTD small phosphatase-like protein; CTD phosphatas 98.9
3ewi_A168 N-acylneuraminate cytidylyltransferase; beta barre 98.87
3r4c_A268 Hydrolase, haloacid dehalogenase-like hydrolase; h 98.86
1l6r_A227 Hypothetical protein TA0175; structural genomics, 98.85
2ght_A181 Carboxy-terminal domain RNA polymerase II polypept 98.81
1y8a_A332 Hypothetical protein AF1437; structural genomics, 98.8
4fe3_A297 Cytosolic 5'-nucleotidase 3; substrate complex, HA 98.66
1nf2_A268 Phosphatase; structural proteomics, HAD NEW fold, 98.6
1rkq_A282 Hypothetical protein YIDA; two domain structure wi 98.57
3zx4_A259 MPGP, mannosyl-3-phosphoglycerate phosphatase; hyd 98.54
4gxt_A385 A conserved functionally unknown protein; structur 98.49
2b30_A301 Pvivax hypothetical protein; SGPP, structural geno 98.34
2jc9_A 555 Cytosolic purine 5'-nucleotidase; cytosolic 5-prim 98.25
3j08_A645 COPA, copper-exporting P-type ATPase A; copper tra 98.19
3j09_A723 COPA, copper-exporting P-type ATPase A; copper tra 98.02
4as2_A327 Phosphorylcholine phosphatase; hydrolase, HAD supe 97.88
3ar4_A 995 Sarcoplasmic/endoplasmic reticulum calcium ATPase; 97.59
3rfu_A736 Copper efflux ATPase; alpha helical, CPC, CXXC, AT 97.53
3qle_A204 TIM50P; chaperone, mitochondrion, preprotein trans 97.34
1mhs_A 920 Proton pump, plasma membrane ATPase; ION transport 97.16
4g63_A 470 Cytosolic IMP-GMP specific 5'-nucleotidase; struct 97.09
2obb_A142 Hypothetical protein; structural genomics, PSI-2, 97.07
2zxe_A 1028 Na, K-ATPase alpha subunit; membrane protein, ION 97.01
1xvi_A275 MPGP, YEDP, putative mannosyl-3-phosphoglycerate p 96.73
3ef0_A 372 RNA polymerase II subunit A C-terminal domain phos 96.7
3ixz_A 1034 Potassium-transporting ATPase alpha; ION pump, H+, 96.62
2zos_A249 MPGP, mannosyl-3-phosphoglycerate phosphatase; hal 96.52
3b8c_A 885 ATPase 2, plasma membrane-type; P-type ATPase, pro 96.49
1s2o_A244 SPP, sucrose-phosphatase; phosphohydrolase, HAD su 96.36
1xvi_A275 MPGP, YEDP, putative mannosyl-3-phosphoglycerate p 95.93
2zos_A249 MPGP, mannosyl-3-phosphoglycerate phosphatase; hal 95.52
2pr7_A137 Haloacid dehalogenase/epoxide hydrolase family; NP 95.23
2hx1_A284 Predicted sugar phosphatases of the HAD superfamil 95.02
2amy_A246 PMM 2, phosphomannomutase 2; HS.459855, HS.313504, 94.74
3ef1_A 442 RNA polymerase II subunit A C-terminal domain phos 94.7
3f9r_A246 Phosphomannomutase; trypanosome glycobiology struc 94.48
1xpj_A126 Hypothetical protein; structural genomics, MCSG, p 94.45
3shq_A320 UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila 93.62
3kc2_A 352 Uncharacterized protein YKR070W; HAD-like, mitocho 93.39
2fue_A262 PMM 1, PMMH-22, phosphomannomutase 1; enzyme-produ 92.22
2fue_A262 PMM 1, PMMH-22, phosphomannomutase 1; enzyme-produ 92.14
1u02_A239 Trehalose-6-phosphate phosphatase related protein; 91.82
1zjj_A263 Hypothetical protein PH1952; alpha/beta hydrolase 90.9
3epr_A264 Hydrolase, haloacid dehalogenase-like family; stru 89.67
3ewi_A168 N-acylneuraminate cytidylyltransferase; beta barre 89.38
2q5c_A196 NTRC family transcriptional regulator; structural 89.05
2amy_A246 PMM 2, phosphomannomutase 2; HS.459855, HS.313504, 88.62
1u02_A239 Trehalose-6-phosphate phosphatase related protein; 88.07
3pdw_A266 Uncharacterized hydrolase YUTF; structural genomic 87.93
1s2o_A244 SPP, sucrose-phosphatase; phosphohydrolase, HAD su 85.15
3geb_A274 EYES absent homolog 2; hydrolase, activator, alter 84.04
2pju_A225 Propionate catabolism operon regulatory protein; s 83.91
>3kbb_A Phosphorylated carbohydrates phosphatase TM_1254; hydrolase, arbohydrate metabolism, COBA magnesium, manganese, metal-binding, nickel; HET: MSE GOL; 1.74A {Thermotoga maritima MSB8} Back     alignment and structure
Probab=99.97  E-value=1.9e-30  Score=233.59  Aligned_cols=210  Identities=20%  Similarity=0.254  Sum_probs=156.8

Q ss_pred             ceEEEEecCCccccccccCcHHHHHHHHHHcCCCCCCCChHHHHHHHHhhcCChHHHHHHHHHHcCCCCCCCcchhHHHH
Q 017455           84 DLAVLLEVDGVLVDAYRFGNRQAFNVAFQKLGLDCANWTAPIYTDLLRKSAGDEDRMLVLFFNRIGWPTSVPTNEKKAFV  163 (371)
Q Consensus        84 ~kaviFD~DGTL~d~~~~~~~~a~~~~~~~~g~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~g~~~~~~~~~~~~~~  163 (371)
                      +||||||+||||+|+... +..+|+++++++|.+   ++.+.+..+.+   ....................     +.+.
T Consensus         1 IkAViFD~DGTL~ds~~~-~~~a~~~~~~~~g~~---~~~~~~~~~~g---~~~~~~~~~~~~~~~~~~~~-----~~~~   68 (216)
T 3kbb_A            1 MEAVIFDMDGVLMDTEPL-YFEAYRRVAESYGKP---YTEDLHRRIMG---VPEREGLPILMEALEIKDSL-----ENFK   68 (216)
T ss_dssp             CCEEEEESBTTTBCCGGG-HHHHHHHHHHHTTCC---CCHHHHHHHTT---SCHHHHHHHHHHHTTCCSCH-----HHHH
T ss_pred             CeEEEECCCCcccCCHHH-HHHHHHHHHHHcCCC---CCHHHHHHHhc---cchhhhhhhhhhcccchhhH-----HHHH
Confidence            589999999999999987 899999999999987   66666655543   23334444555555554331     2222


Q ss_pred             HHHHHHHHHHHHHHHhcCCCCCCccHHHHHHHHHHCCCcEEEEcCCCCCCcHHHHHHHHHcCccccchheeecchhHHhh
Q 017455          164 KNVLQEKKNALDEFLASKDAPLRPGVEDFVDDAYNEGIPLIVLTAYGKSGDRIARSVVEKLGSERISKIKIVGNEEVERS  243 (371)
Q Consensus       164 ~~l~~~~~~~~~~~l~~~~~~~~pgv~elL~~L~~~Gi~v~IvTn~~~~~~~~~~~~l~~lgl~~~f~~~i~~~~~~~~~  243 (371)
                      +.+.+.+...+.+     ..+++||+.++++.|+++|++++++||   +....+...++.+|+.++|+.++. ++++.  
T Consensus        69 ~~~~~~~~~~~~~-----~~~~~pg~~~~l~~L~~~g~~~~i~tn---~~~~~~~~~l~~~~l~~~fd~~~~-~~~~~--  137 (216)
T 3kbb_A           69 KRVHEEKKRVFSE-----LLKENPGVREALEFVKSKRIKLALATS---TPQREALERLRRLDLEKYFDVMVF-GDQVK--  137 (216)
T ss_dssp             HHHHHHHHHHHHH-----HCCBCTTHHHHHHHHHHTTCEEEEECS---SCHHHHHHHHHHTTCGGGCSEEEC-GGGSS--
T ss_pred             HHHHHHHHHHHHH-----hcccCccHHHHHHHHHHcCCCcccccC---CcHHHHHHHHHhcCCCcccccccc-ccccC--
Confidence            2333333332222     356899999999999999999999999   447889999999999999987543 32321  


Q ss_pred             hhccccccccccCCchhHHHHHHHHHHhHHHHHHHHHHHhhccCccccCCCCCchhHHHHHHHHHHHHHcCCCCCcEEEE
Q 017455          244 LYGQFVLGKGISSGVDEQLATEARKAVSAQKQEIAEEVASMLKLSVDIDTSSPESLDKIVAALRAGAEYAEKPVRNCFLI  323 (371)
Q Consensus       244 ~f~~~v~g~~v~~~~~~~~~~~~~k~~~~~~~~~~~~~~~~~KP~p~i~~p~~~~~~~~~~~~~~a~~~lgv~p~e~I~I  323 (371)
                                                              ..||+|++              |+.+++++|++|++||||
T Consensus       138 ----------------------------------------~~KP~p~~--------------~~~a~~~lg~~p~e~l~V  163 (216)
T 3kbb_A          138 ----------------------------------------NGKPDPEI--------------YLLVLERLNVVPEKVVVF  163 (216)
T ss_dssp             ----------------------------------------SCTTSTHH--------------HHHHHHHHTCCGGGEEEE
T ss_pred             ----------------------------------------CCcccHHH--------------HHHHHHhhCCCccceEEE
Confidence                                                    23888888              999999999999999999


Q ss_pred             eCCHhhHHHHHHcCCcEEE-ECCCCCCCcccccc--cc--cchHHHHhhhhc
Q 017455          324 AGSQSGVAGAQRIGMPCVV-MRSRCITTLPVSKT--QR--LADMLCRILKSI  370 (371)
Q Consensus       324 gDs~~Di~aA~~aGm~~v~-v~~~~~~~~~l~~~--~~--~~~~l~~~l~~i  370 (371)
                      ||+.+||.+|+++||++|+ +.++....+.+..+  ..  -++++++.|++|
T Consensus       164 gDs~~Di~aA~~aG~~~i~~v~~g~~~~~~l~~~~~~~i~~~~eli~~l~eL  215 (216)
T 3kbb_A          164 EDSKSGVEAAKSAGIERIYGVVHSLNDGKALLEAGAVALVKPEEILNVLKEV  215 (216)
T ss_dssp             ECSHHHHHHHHHTTCCCEEEECCSSSCCHHHHHTTCSEEECGGGHHHHHHHH
T ss_pred             ecCHHHHHHHHHcCCcEEEEecCCCCCHHHHHhCCCcEECCHHHHHHHHHHH
Confidence            9999999999999999985 78777665555432  22  257778888776



>4g9b_A Beta-PGM, beta-phosphoglucomutase; HAD, putative phosphoglucomutase, enzyme function initiative structural genomics, isomerase; 1.70A {Escherichia coli} Back     alignment and structure
>4gib_A Beta-phosphoglucomutase; rossmann fold, HAD-like, structural genomics, center for structural genomics of infectious DISE csgid, isomerase; 2.27A {Clostridium difficile} Back     alignment and structure
>3e58_A Putative beta-phosphoglucomutase; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.86A {Streptococcus thermophilus lmg 18311} Back     alignment and structure
>2hi0_A Putative phosphoglycolate phosphatase; YP_619066.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.51A {Lactobacillus delbrueckii} Back     alignment and structure
>2ah5_A COG0546: predicted phosphatases; MCSG, structural genomics, hydrola haloacid dehalogenase-like, PSI; 1.74A {Streptococcus pneumoniae} SCOP: c.108.1.6 Back     alignment and structure
>4ex6_A ALNB; modified rossman fold, phosphatase, magnesium binding, hydro; 1.25A {Streptomyces SP} PDB: 4ex7_A Back     alignment and structure
>3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV} Back     alignment and structure
>2hsz_A Novel predicted phosphatase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: UNL; 1.90A {Haemophilus somnus 129PT} SCOP: c.108.1.6 Back     alignment and structure
>3l5k_A Protein GS1, haloacid dehalogenase-like hydrolase domain- containing protein 1A; HDHD1A, haloacid dehalogenase-like hydrolase domain containing 1A; 2.00A {Homo sapiens} Back     alignment and structure
>3qxg_A Inorganic pyrophosphatase; hydrolase, magnesium binding site, NEW YORK research center for structural genomics; HET: TLA; 1.24A {Bacteroides thetaiotaomicron} PDB: 3qu2_A* 3qx7_A 3quq_A* 3r9k_A 3qut_A 3qu9_A* 3qu7_A 3qu5_A 3qyp_A 3quc_A 3qub_A 3qu4_A Back     alignment and structure
>3nas_A Beta-PGM, beta-phosphoglucomutase; PSI, structural genomics, protein structure initiative, NEW research center for structural genomics; 3.00A {Bacillus subtilis} Back     alignment and structure
>4eek_A Beta-phosphoglucomutase-related protein; hydrolase, magnesium binding site, enzyme function initiativ; 1.60A {Deinococcus radiodurans} PDB: 4eel_A* 4een_A Back     alignment and structure
>2nyv_A Pgpase, PGP, phosphoglycolate phosphatase; structural genomics, PSI-2, protein structure initiative; 2.10A {Aquifex aeolicus} PDB: 2yy6_A Back     alignment and structure
>3dv9_A Beta-phosphoglucomutase; structural genomics, APC60149, PSI- protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.72A {Bacteroides vulgatus} Back     alignment and structure
>3mc1_A Predicted phosphatase, HAD family; PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.93A {Clostridium acetobutylicum} SCOP: c.108.1.0 Back     alignment and structure
>3ed5_A YFNB; APC60080, bacillus subtilis subsp. subtilis STR. 168, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.72A {Bacillus subtilis} PDB: 3i76_A Back     alignment and structure
>2hdo_A Phosphoglycolate phosphatase; NP_784602.1, structur genomics, PSI-2, protein structure initiative, joint center structural genomics; HET: MSE; 1.50A {Lactobacillus plantarum} SCOP: c.108.1.6 Back     alignment and structure
>3k1z_A Haloacid dehalogenase-like hydrolase domain-conta protein 3; HDHD3, haloacid dehalogenase-like hydrolase domain containin structural genomics; 1.55A {Homo sapiens} Back     alignment and structure
>2hoq_A Putative HAD-hydrolase PH1655; haloacid dehalogenase, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.70A {Pyrococcus horikoshii} Back     alignment and structure
>3qnm_A Haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 1.70A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 Back     alignment and structure
>3iru_A Phoshonoacetaldehyde hydrolase like protein; phosphonoacetaldehyde hydrolase like P structural genomics, PSI-2, protein structure initiative; 2.30A {Oleispira antarctica} SCOP: c.108.1.0 Back     alignment and structure
>2hcf_A Hydrolase, haloacid dehalogenase-like family; NP_662590.1, ST genomics, PSI-2, protein structure initiative; 1.80A {Chlorobaculum tepidum} SCOP: c.108.1.6 Back     alignment and structure
>3sd7_A Putative phosphatase; structural genomics, haloacid dehalogenase-like hydrolase, H center for structural genomics of infectious diseases; HET: PGE; 1.70A {Clostridium difficile} Back     alignment and structure
>2om6_A Probable phosphoserine phosphatase; rossmann fold, B-hairpin, four-helix bundle, structural GENO NPPSFA; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>2gfh_A Haloacid dehalogenase-like hydrolase domain conta; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Mus musculus} SCOP: c.108.1.6 PDB: 2w4m_A Back     alignment and structure
>2go7_A Hydrolase, haloacid dehalogenase-like family; structural genomics, joint center for structural genomics, J protein structure initiative; 2.10A {Streptococcus pneumoniae} SCOP: c.108.1.6 Back     alignment and structure
>3kzx_A HAD-superfamily hydrolase, subfamily IA, variant; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 1.90A {Ehrlichia chaffeensis} Back     alignment and structure
>3d6j_A Putative haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>2wf7_A Beta-PGM, beta-phosphoglucomutase; transition state analogue, haloacid dehalogenase superfamily, isomerase, phosphotransferase; HET: G7P; 1.05A {Lactococcus lactis} PDB: 1o03_A* 1z4n_A* 1z4o_A* 1zol_A 2wf5_A* 2wf6_A* 1o08_A* 2wf8_A* 2wf9_A* 2wfa_A 2whe_A 1lvh_A* 3fm9_A Back     alignment and structure
>1te2_A Putative phosphatase; structural genomics, phosphates, PSI, protein S initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Escherichia coli} SCOP: c.108.1.6 Back     alignment and structure
>3ddh_A Putative haloacid dehalogenase-like family hydrol; hydrolase, HAD superfamily, ST genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3smv_A S-(-)-azetidine-2-carboxylate hydrolase; haloacid dehalogenase superfamily, L-azetidine-2- carboxylate; HET: GOL; 1.38A {Pseudomonas} Back     alignment and structure
>3umg_A Haloacid dehalogenase; defluorinase, hydrolase; 2.25A {Rhodococcus jostii} Back     alignment and structure
>1yns_A E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo sapiens} SCOP: c.108.1.22 PDB: 1zs9_A Back     alignment and structure
>2zg6_A Putative uncharacterized protein ST2620, probable 2-haloalkanoic; probable 2-haloalkanoic acid dehalogenase, hydrolase, structural genomics; 2.40A {Sulfolobus tokodaii} Back     alignment and structure
>3um9_A Haloacid dehalogenase, type II; haloacid dehalogenase-like hydrolase protein superfamily, defluorinase, hydrolase; 2.19A {Polaromonas SP} Back     alignment and structure
>3umc_A Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeruginosa} Back     alignment and structure
>3m9l_A Hydrolase, haloacid dehalogenase-like family; HAD family hydrolase, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Pseudomonas fluorescens} PDB: 2ybd_A* 3r09_A* Back     alignment and structure
>2pke_A Haloacid delahogenase-like family hydrolase; NP_639141.1, ST genomics, joint center for structural genomics, JCSG; 1.81A {Xanthomonas campestris PV} Back     alignment and structure
>2g80_A Protein UTR4; YEL038W, UTR4 protein (unknown transcript 4 protein), struct genomics, PSI, protein structure initiative; 2.28A {Saccharomyces cerevisiae} SCOP: c.108.1.22 Back     alignment and structure
>3umb_A Dehalogenase-like hydrolase; 2.20A {Ralstonia solanacearum} Back     alignment and structure
>1swv_A Phosphonoacetaldehyde hydrolase; HAD enzyme superfamily, phosphonotase, metal binding; 2.30A {Bacillus cereus} SCOP: c.108.1.3 PDB: 1sww_A 2iof_A* 2ioh_A 1rql_A 1rqn_A 2iof_K* 1rdf_A 1fez_A Back     alignment and structure
>2no4_A (S)-2-haloacid dehalogenase IVA; HAD superfamily, rossman fold, hydrol; 1.93A {Burkholderia cepacia} PDB: 2no5_A* Back     alignment and structure
>4dcc_A Putative haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 1.65A {Bacteroides thetaiotaomicron} PDB: 4dfd_A 4f71_A 4f72_A Back     alignment and structure
>1zrn_A L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseudomonas SP} SCOP: c.108.1.1 PDB: 1zrm_A 1jud_A 1qh9_A Back     alignment and structure
>3vay_A HAD-superfamily hydrolase; rossmann fold, haloacid dehalogenase; 1.98A {Pseudomonas syringae PV} Back     alignment and structure
>3cnh_A Hydrolase family protein; NP_295428.1, predicted hydrolase of haloacid dehalogenase-LI superfamily; HET: MSE PG4; 1.66A {Deinococcus radiodurans R1} Back     alignment and structure
>3u26_A PF00702 domain protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 1.59A {Pyrococcus horikoshii} SCOP: c.108.1.1 PDB: 1x42_A Back     alignment and structure
>2fi1_A Hydrolase, haloacid dehalogenase-like family; structural genomics, haloacid dehalogenase-like F PSI, protein structure initiative; 1.40A {Streptococcus pneumoniae} SCOP: c.108.1.3 Back     alignment and structure
>2fdr_A Conserved hypothetical protein; SAD, structural genomics, agrobacter tumefaciens, HAD-superfamily hydrolase; 2.00A {Agrobacterium tumefaciens str} SCOP: c.108.1.6 Back     alignment and structure
>2w43_A Hypothetical 2-haloalkanoic acid dehalogenase; hydrolase, metabolic process; HET: MES; 1.66A {Sulfolobus tokodaii} PDB: 2w11_A Back     alignment and structure
>3nuq_A Protein SSM1, putative nucleotide phosphatase; suppresses the 6-AU sensitivity of transcription elongation II; 1.70A {Saccharomyces cerevisiae} PDB: 3onn_A 3opx_A* Back     alignment and structure
>2qlt_A (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, saccharom cerevisiae, structural genomics, PSI-2, protein structure initiative; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2i6x_A Hydrolase, haloacid dehalogenase-like family; HAD superfamily, struct genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Porphyromonas gingivalis} Back     alignment and structure
>2p11_A Hypothetical protein; putative haloacid dehalogenase-like hydrolase, structural GE joint center for structural genomics, JCSG; 2.20A {Burkholderia xenovorans} Back     alignment and structure
>2b0c_A Putative phosphatase; alpha-D-glucose-1-phosphate, structural genomic protein structure initiative, midwest center for structural genomics, MCSG; HET: G1P; 2.00A {Escherichia coli} SCOP: c.108.1.2 Back     alignment and structure
>1nnl_A L-3-phosphoserine phosphatase; PSP, HPSP, phospho-aspartyl, hydrolase; 1.53A {Homo sapiens} SCOP: c.108.1.4 PDB: 1l8l_A* 1l8o_A Back     alignment and structure
>1qq5_A Protein (L-2-haloacid dehalogenase); hydrolase; 1.52A {Xanthobacter autotrophicus} SCOP: c.108.1.1 PDB: 1qq6_A* 1qq7_A* 1aq6_A Back     alignment and structure
>3l8h_A Putative haloacid dehalogenase-like hydrolase; HAD superfamily, GMHB, D-glycero-D-manno-heptose-1, 7-bispho phosphatase; HET: FX1; 1.68A {Bordetella bronchiseptica} Back     alignment and structure
>3ib6_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Listeria monocytogenes} Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>3fvv_A Uncharacterized protein; unknown function, structural genomics, PSI,MCSG, protein STR initiative, midwest center for structural genomics; 2.10A {Bordetella pertussis} Back     alignment and structure
>1qyi_A ZR25, hypothetical protein; structural genomics, PSI, protein structure initiative, NORT structural genomics consortium, NESG; 2.50A {Staphylococcus aureus subsp} SCOP: c.108.1.13 Back     alignment and structure
>3m1y_A Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, phophoserine phosphatase, protein structure initiative, structural genomics; 2.40A {Helicobacter pylori} SCOP: c.108.1.0 Back     alignment and structure
>2oda_A Hypothetical protein pspto_2114; haloacid dehalogenase, phosphonoacetaldehyde hydrolase, protein binding; HET: EPE; 1.90A {Pseudomonas syringae PV} Back     alignment and structure
>4eze_A Haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 2.27A {Salmonella enterica subsp} Back     alignment and structure
>2c4n_A Protein NAGD; nucleotide phosphatase, HAD superfamily, UMP phosphatase, carbohydrate metabolism, hydrolase; 1.8A {Escherichia coli} SCOP: c.108.1.14 Back     alignment and structure
>2ho4_A Haloacid dehalogenase-like hydrolase domain containing 2; HDHD2, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; 2.20A {Mus musculus} PDB: 3hlt_A Back     alignment and structure
>1rku_A Homoserine kinase; phosphoserine phosphatase, phosphoserine:homoserine phosphotransferase, THRH, phosphoserine phosphoryl donor; 1.47A {Pseudomonas aeruginosa} SCOP: c.108.1.11 PDB: 1rkv_A Back     alignment and structure
>3kd3_A Phosphoserine phosphohydrolase-like protein; csgid, niaid, S genomics, national institute of allergy and infectious DISE (niaid); 1.70A {Francisella tularensis subsp} Back     alignment and structure
>3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} Back     alignment and structure
>1yv9_A Hydrolase, haloacid dehalogenase family; hypothetical protein, struc genomics, PSI, protein structure initiative; 2.80A {Enterococcus faecalis} SCOP: c.108.1.14 Back     alignment and structure
>2gmw_A D,D-heptose 1,7-bisphosphate phosphatase; Zn-binding protein, hydrolase; 1.50A {Escherichia coli} SCOP: c.108.1.19 PDB: 3esq_A 3esr_A 3l1u_A 3l1v_A 3l8e_A 3l8f_A 3l8g_A* Back     alignment and structure
>2i7d_A 5'(3')-deoxyribonucleotidase, cytosolic type; hydrolase; HET: DUR; 1.20A {Homo sapiens} PDB: 2jar_A* 2jao_A* Back     alignment and structure
>1q92_A 5(3)-deoxyribonucleotidase; alpha-beta rossman fold, hydrolase; HET: DRM; 1.40A {Homo sapiens} SCOP: c.108.1.8 PDB: 1mh9_A* 1q91_A* 1z4m_A* 1z4i_A* 1z4j_A* 1z4l_A* 1z4k_A* 1z4p_X* 1z4q_A* 2jau_A* 2jaw_A* 3u19_A* 3u13_A 4e88_A Back     alignment and structure
>2fea_A 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; 2633731, structural genomics, joint center for structural GE JCSG; HET: MSE; 2.00A {Bacillus subtilis} SCOP: c.108.1.20 Back     alignment and structure
>1l7m_A Phosphoserine phosphatase; rossmann fold, four-helix bundle, B-hairpin, structural genomics, BSGC structure funded by NIH; 1.48A {Methanocaldococcus jannaschii} SCOP: c.108.1.4 PDB: 1f5s_A 1l7n_A 1l7p_A* 1l7o_A* 1j97_A* Back     alignment and structure
>3n28_A Phosphoserine phosphatase; HAD family hydrolase, structural genomics, PSI, protein STRU initiative, nysgrc; 2.30A {Vibrio cholerae} Back     alignment and structure
>2wm8_A MDP-1, magnesium-dependent phosphatase 1; haloacid dehalogenase, protein phosphatase, hydrolase, magne metal-binding; 1.75A {Homo sapiens} PDB: 1u7o_A 1u7p_A Back     alignment and structure
>4ap9_A Phosphoserine phosphatase; hydrolase, haloacid dehalogenase superfamily, NDSB; HET: 1PS; 1.78A {Thermococcus onnurineus} PDB: 4b6j_A Back     alignment and structure
>2b82_A APHA, class B acid phosphatase; DDDD acid phosphatase, metallo-ENZ hydrolase; HET: ADN; 1.25A {Escherichia coli} SCOP: c.108.1.12 PDB: 2b8j_A* 2hf7_A 1rmt_A* 1n9k_A 1rmq_A 1n8n_A* 1rmy_A* 2g1a_A* 3cz4_A 2heg_A* 1z5g_A 1z5u_A* 1z88_A 2aut_A Back     alignment and structure
>3a1c_A Probable copper-exporting P-type ATPase A; ATP-binding, cell membrane, copper transport, hydrolase, ION transport, magnesium, membrane; HET: ACP; 1.85A {Archaeoglobus fulgidus} PDB: 3a1d_A* 3a1e_A* 2b8e_A 2voy_J 2voy_I Back     alignment and structure
>1vjr_A 4-nitrophenylphosphatase; TM1742, structural genomics, JCSG, protein structure initiative, joint center for structural G hydrolase; 2.40A {Thermotoga maritima} SCOP: c.108.1.14 PDB: 1pw5_A* Back     alignment and structure
>2x4d_A HLHPP, phospholysine phosphohistidine inorganic pyrophos phosphatase; hydrolase; 1.92A {Homo sapiens} Back     alignment and structure
>2pr7_A Haloacid dehalogenase/epoxide hydrolase family; NP_599989.1, uncharacterized protein, structural genomics; 1.44A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3e8m_A Acylneuraminate cytidylyltransferase; 2-keto-3-deoxynononic acid 9-phosphate phosphohydrolase, nucleotidyltransferase; HET: PEG PG4 EDO PGE; 1.10A {Bacteroides thetaiotaomicron} PDB: 3e84_A 3e81_A* Back     alignment and structure
>3skx_A Copper-exporting P-type ATPase B; P1B-ATPase, ATP binding domain, copper(II) transporter, MEMB protein, hydrolase; 1.59A {Archaeoglobus fulgidus} PDB: 3sky_A* Back     alignment and structure
>2hx1_A Predicted sugar phosphatases of the HAD superfamily; ZP_00311070.1, possible sugar phosphatase, structural genomics; HET: MSE EPE; 2.10A {Cytophaga hutchinsonii} Back     alignment and structure
>2p9j_A Hypothetical protein AQ2171; secsg, riken, PSI, structural GENO protein structure initiative, southeast collaboratory for S genomics; 2.40A {Aquifex aeolicus} Back     alignment and structure
>3qgm_A P-nitrophenyl phosphatase (PHO2); structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 2.00A {Archaeoglobus fulgidus} SCOP: c.108.1.0 Back     alignment and structure
>2oyc_A PLP phosphatase, pyridoxal phosphate phosphatase; structural genomics, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI-2; 1.72A {Homo sapiens} PDB: 2p27_A 2p69_A* 2cft_A* 2cfs_A 2cfr_A* Back     alignment and structure
>3mmz_A Putative HAD family hydrolase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.84A {Streptomyces avermitilis} Back     alignment and structure
>3ij5_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; IDP022 hydrolase, lipopolysaccharide biosynthesis, magnesium, STRU genomics; 1.95A {Yersinia pestis} Back     alignment and structure
>2o2x_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; 1.50A {Mesorhizobium loti} SCOP: c.108.1.19 Back     alignment and structure
>2fpr_A Histidine biosynthesis bifunctional protein HISB; histidinola phosphate phosphatase, bifunctional enzyme structural genomics; 1.70A {Escherichia coli} SCOP: c.108.1.19 PDB: 2fps_A 2fpu_A* 2fpx_A 2fpw_A* Back     alignment and structure
>1zjj_A Hypothetical protein PH1952; alpha/beta hydrolase fold, HAD superfamily, structural genom riken structural genomics/proteomics initiative; 1.85A {Pyrococcus horikoshii} Back     alignment and structure
>3mn1_A Probable YRBI family phosphatase; structural genomics, PSI, protein structure initiative, NYSG phosphatase; 1.80A {Pseudomonas syringae PV} PDB: 3nrj_A Back     alignment and structure
>3epr_A Hydrolase, haloacid dehalogenase-like family; structural genomics, unknown function, HAD superfamily hydro PSI-2; 1.55A {Streptococcus agalactiae serogroup V} SCOP: c.108.1.14 PDB: 1ys9_A 1wvi_A 1ydf_A Back     alignment and structure
>3bwv_A Putative 5'(3')-deoxyribonucleotidase; NP_764060.1, deoxyribonucleotidase-like protein; HET: MSE; 1.55A {Staphylococcus epidermidis} Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>3n07_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; structural genomics, phosphatase, PSI-2, protein structure initiative; HET: MSE; 1.76A {Vibrio cholerae} Back     alignment and structure
>2yj3_A Copper-transporting ATPase; hydrolase, P-type ATPase, COPB, heavy metal translocation; 2.20A {Sulfolobus solfataricus} PDB: 2iye_A 2yj6_A* 2yj5_A* 2yj4_A* Back     alignment and structure
>1k1e_A Deoxy-D-mannose-octulosonate 8-phosphate phosphat; structural genomics, KDO 8-P phosphatase, structure function project, S2F; HET: MES; 1.67A {Haemophilus influenzae RD} SCOP: c.108.1.5 PDB: 1j8d_A* Back     alignment and structure
>2r8e_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; YRBI, divalent metal, HAD superfamily, KDO 8-P, hydrolase; 1.40A {Escherichia coli O6} PDB: 2r8x_A 2r8y_A 2r8z_A 3hyc_A 3i6b_A* Back     alignment and structure
>3pdw_A Uncharacterized hydrolase YUTF; structural genomics, PSI2, NYSGXRC, protein structure initia YORK SGX research center for structural genomics; 1.60A {Bacillus subtilis} SCOP: c.108.1.0 Back     alignment and structure
>3n1u_A Hydrolase, HAD superfamily, subfamily III A; structural genomics, PSI-2; 1.80A {Legionella pneumophila} SCOP: c.108.1.0 Back     alignment and structure
>3gyg_A NTD biosynthesis operon putative hydrolase NTDB; PF05116, PF08282, MCSG, PSI-2, haloacid dehalogenase-like HY structural genomics; 2.45A {Bacillus subtilis subsp} Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>2i33_A Acid phosphatase; HAD superfamily, hydrolase; 1.57A {Bacillus anthracis} PDB: 2i34_A Back     alignment and structure
>4dw8_A Haloacid dehalogenase-like hydrolase; HAD, putative phosphatase, enzyme function initiative, EFI, structural genomics; 1.50A {Bacteroides thetaiotaomicron} PDB: 3niw_A 4dwo_A Back     alignment and structure
>3dnp_A Stress response protein YHAX; structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG, unknown function; HET: MSE; 1.85A {Bacillus subtilis} SCOP: c.108.1.0 Back     alignment and structure
>2pq0_A Hypothetical conserved protein GK1056; hyopthetical protein, structural genomics, unknown function; 2.60A {Geobacillus kaustophilus} PDB: 2qyh_A Back     alignment and structure
>1wr8_A Phosphoglycolate phosphatase; alpha / beta core domain, HAD superfamily, structural genomi structural genomics/proteomics initiative, RSGI; 1.60A {Pyrococcus horikoshii} SCOP: c.108.1.10 Back     alignment and structure
>3dao_A Putative phosphatse; structural genomics, joint center for S genomics, JCSG, protein structure initiative, PSI-2, hydrol; HET: MSE 1PE CIT; 1.80A {Eubacterium rectale} Back     alignment and structure
>3mpo_A Predicted hydrolase of the HAD superfamily; SGX, PSI, structural genomics, protein structure initiative; 2.90A {Lactobacillus brevis} SCOP: c.108.1.0 Back     alignment and structure
>3l7y_A Putative uncharacterized protein SMU.1108C; hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>3kc2_A Uncharacterized protein YKR070W; HAD-like, mitochondral protein, PSI, MCSG, structural genomi protein structure initiative; HET: MSE; 1.55A {Saccharomyces cerevisiae} PDB: 3rf6_A* Back     alignment and structure
>2rbk_A Putative uncharacterized protein; HAD-like phosphatase, unknown function; 1.00A {Bacteroides thetaiotaomicron} SCOP: c.108.1.10 PDB: 1ymq_A 2rb5_A 2rav_A 2rar_A Back     alignment and structure
>3fzq_A Putative hydrolase; YP_001086940.1, putative haloacid dehalogenase-like hydrolas structural genomics, joint center for structural genomics; HET: MSE; 2.10A {Clostridium difficile} SCOP: c.108.1.0 Back     alignment and structure
>1nrw_A Hypothetical protein, haloacid dehalogenase-like hydrolase; structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: c.108.1.10 Back     alignment and structure
>1rlm_A Phosphatase; HAD family, rossman fold, hydrolase; 1.90A {Escherichia coli} SCOP: c.108.1.10 PDB: 1rlt_A 1rlo_A* 2hf2_A Back     alignment and structure
>3pgv_A Haloacid dehalogenase-like hydrolase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: EPE; 2.39A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3pct_A Class C acid phosphatase; hydrolase, outer membrane; 1.85A {Pasteurella multocida} Back     alignment and structure
>3ocu_A Lipoprotein E; hydrolase, outer membrane; HET: NMN; 1.35A {Haemophilus influenzae} PDB: 3ocv_A* 3ocw_A* 3ocx_A* 3ocz_A* 3ocy_A* 3sf0_A* 2hlk_A 2hll_A 3et4_A 3et5_A Back     alignment and structure
>2hhl_A CTD small phosphatase-like protein; CTD phosphatase, keggins anion, structural genomics, PSI, protein structure initiative; HET: KEG; 2.10A {Homo sapiens} Back     alignment and structure
>3ewi_A N-acylneuraminate cytidylyltransferase; beta barrel, HAD-like, rossmannoid fold, nucleotidyltransferase, nucleus; 1.90A {Mus musculus} Back     alignment and structure
>3r4c_A Hydrolase, haloacid dehalogenase-like hydrolase; haloalkanoate dehalogenase enzyme superfamily, phosphohydrol hydrolase; 1.82A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 Back     alignment and structure
>1l6r_A Hypothetical protein TA0175; structural genomics, putative hydrolas midwest center for structural genomics, MCSG, PSI; 1.40A {Thermoplasma acidophilum} SCOP: c.108.1.10 PDB: 1kyt_A Back     alignment and structure
>2ght_A Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1; protein-peptide complex, HAD superfamily, hydrolase; HET: SEP; 1.80A {Homo sapiens} PDB: 2ghq_A* 3pgl_A* 1t9z_A* 1ta0_A* 3l0c_A 3l0y_A 3l0b_A* 2q5e_A Back     alignment and structure
>1y8a_A Hypothetical protein AF1437; structural genomics, protein structu initiative, PSI, midwest center for structural genomics; 1.40A {Archaeoglobus fulgidus} SCOP: c.108.1.24 Back     alignment and structure
>4fe3_A Cytosolic 5'-nucleotidase 3; substrate complex, HAD-like, protein binding; HET: U5P; 1.74A {Mus musculus} PDB: 2g09_A* 2bdu_A* 2g08_A 2g06_A* 2g0a_A* 2q4t_A* 2g07_A* 2jga_A 2vkq_A 2cn1_A Back     alignment and structure
>1nf2_A Phosphatase; structural proteomics, HAD NEW fold, structural genomics, BSGC structure funded by NIH structure initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.108.1.10 Back     alignment and structure
>1rkq_A Hypothetical protein YIDA; two domain structure with beta-alpha sandwich. stucture contains A magnesium ION., PSI, protein structure initiative; 1.40A {Escherichia coli} SCOP: c.108.1.10 Back     alignment and structure
>3zx4_A MPGP, mannosyl-3-phosphoglycerate phosphatase; hydrolase, haloalkanoid acid dehalogenase-like phosphatase, crystallographic snapshot; HET: 2M8; 1.74A {Thermus thermophilus} PDB: 3zty_A 3zu6_A* 3ztw_A* 3zw7_A* 3zwd_A* 3zwk_A 3zup_A* 3zx5_A* Back     alignment and structure
>4gxt_A A conserved functionally unknown protein; structural genomics, PSI-biology; 1.82A {Anaerococcus prevotii} Back     alignment and structure
>2b30_A Pvivax hypothetical protein; SGPP, structural genomics, PSI, protein structure initiative; 2.70A {Plasmodium vivax} SCOP: c.108.1.10 Back     alignment and structure
>2jc9_A Cytosolic purine 5'-nucleotidase; cytosolic 5-prime nucleotidase II, GMP-IMP specific nucleotidase, CN-II, NT5C2, hydrolase, polymorphism; HET: ADN; 1.5A {Homo sapiens} PDB: 2j2c_A* 2xje_A* 2xjf_A* 2jcm_A* 2xcw_A* 2xcv_A* 2xcx_A 2xjb_A* 2xjc_A* 2xjd_A* Back     alignment and structure
>3j08_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Back     alignment and structure
>3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Back     alignment and structure
>4as2_A Phosphorylcholine phosphatase; hydrolase, HAD superfamily, alkylammonium compounds; HET: BTB; 2.12A {Pseudomonas aeruginosa} PDB: 4as3_A* Back     alignment and structure
>3ar4_A Sarcoplasmic/endoplasmic reticulum calcium ATPase; P-type ATPase, hydrolase, calcium transport, calcium binding binding; HET: ATP TG1 PTY; 2.15A {Oryctolagus cuniculus} PDB: 2ear_A* 2eas_A* 2eat_A* 2eau_A* 2dqs_A* 2zbe_A 2zbf_A* 2zbg_A* 3ar2_A* 2zbd_A* 3ar3_A* 3ar5_A* 3ar6_A* 3ar7_A* 3ar8_A* 3ar9_A* 3n5k_A* 1kju_A 1iwo_A 1t5s_A* ... Back     alignment and structure
>3rfu_A Copper efflux ATPase; alpha helical, CPC, CXXC, ATP-binding, hydrolase, ION transp magnesium, Cu+, membrane, metal-binding; 3.20A {Legionella pneumophila subsp} Back     alignment and structure
>3qle_A TIM50P; chaperone, mitochondrion, preprotein translocation; HET: 1PE; 1.83A {Saccharomyces cerevisiae EC1118} Back     alignment and structure
>1mhs_A Proton pump, plasma membrane ATPase; ION transport, membrane protein, P-type ATPase, active transport, cryo-electron microscopy; 8.00A {Neurospora crassa} SCOP: i.18.1.1 Back     alignment and structure
>4g63_A Cytosolic IMP-GMP specific 5'-nucleotidase; structural genomics, PSI-biology, northeast structural genom consortium, NESG; 2.70A {Legionella pneumophila subsp} PDB: 2bde_A Back     alignment and structure
>2obb_A Hypothetical protein; structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic unknown function; 2.20A {Bacteroides thetaiotaomicron} SCOP: c.108.1.25 Back     alignment and structure
>2zxe_A Na, K-ATPase alpha subunit; membrane protein, ION pump, ATPase, K+ binding, haloacid dehydrogenease superfamily, phosphate analogue; HET: CLR NAG NDG; 2.40A {Squalus acanthias} PDB: 3a3y_A* 3b8e_A* 3kdp_A* 3n2f_A* 3n23_A* 1mo7_A 1mo8_A* 1q3i_A Back     alignment and structure
>1xvi_A MPGP, YEDP, putative mannosyl-3-phosphoglycerate phosphatase; hypothetical protein, conserved protein, phophatase-like domain; HET: 1PE PG4 PGE; 2.26A {Escherichia coli K12} SCOP: c.108.1.10 Back     alignment and structure
>3ef0_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, ALF4, transition state analog, cobalt, magnesium; 2.10A {Schizosaccharomyces pombe} Back     alignment and structure
>3ixz_A Potassium-transporting ATPase alpha; ION pump, H+, K+-ATPase, P-type ATPase, membrane protein, hydrolase, aluminium fluoride, ATP-binding; 6.50A {Sus scrofa} PDB: 2yn9_A 2xzb_A 1iwc_A 1iwf_A Back     alignment and structure
>2zos_A MPGP, mannosyl-3-phosphoglycerate phosphatase; haloacid dehalogenase like hydrolase, mannosylglycerate, cytoplasm, hydrolase, magnesium; 1.70A {Pyrococcus horikoshii} PDB: 1wzc_A Back     alignment and structure
>3b8c_A ATPase 2, plasma membrane-type; P-type ATPase, proton pump, ATP-binding, hydrogen ION transport, hydrolase, ION transport; HET: ACP; 3.60A {Arabidopsis thaliana} Back     alignment and structure
>1s2o_A SPP, sucrose-phosphatase; phosphohydrolase, HAD superfamily, cyanobacteria; 1.40A {Synechocystis SP} SCOP: c.108.1.10 PDB: 1tj3_A 1tj4_A* 1tj5_A* 1u2s_A* 1u2t_A* 2b1q_A* 2b1r_A* 2d2v_A* Back     alignment and structure
>1xvi_A MPGP, YEDP, putative mannosyl-3-phosphoglycerate phosphatase; hypothetical protein, conserved protein, phophatase-like domain; HET: 1PE PG4 PGE; 2.26A {Escherichia coli K12} SCOP: c.108.1.10 Back     alignment and structure
>2zos_A MPGP, mannosyl-3-phosphoglycerate phosphatase; haloacid dehalogenase like hydrolase, mannosylglycerate, cytoplasm, hydrolase, magnesium; 1.70A {Pyrococcus horikoshii} PDB: 1wzc_A Back     alignment and structure
>2pr7_A Haloacid dehalogenase/epoxide hydrolase family; NP_599989.1, uncharacterized protein, structural genomics; 1.44A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2hx1_A Predicted sugar phosphatases of the HAD superfamily; ZP_00311070.1, possible sugar phosphatase, structural genomics; HET: MSE EPE; 2.10A {Cytophaga hutchinsonii} Back     alignment and structure
>2amy_A PMM 2, phosphomannomutase 2; HS.459855, HS.313504, BC008310, phosphatase, PFAM PF03332, H superfamily, jaecken disease; 2.09A {Homo sapiens} SCOP: c.108.1.10 PDB: 2q4r_A Back     alignment and structure
>3ef1_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, BEF3, acylphosphate analog, cobalt, magnesium; HET: BFD; 2.15A {Schizosaccharomyces pombe} Back     alignment and structure
>3f9r_A Phosphomannomutase; trypanosome glycobiology structural genomics, isomerase, structural genomics consortium, SGC; 1.85A {Trypanosoma brucei} SCOP: c.108.1.0 PDB: 2i54_A* 2i55_A* Back     alignment and structure
>1xpj_A Hypothetical protein; structural genomics, MCSG, protein STR initiative, PSI, midwest center for structural genomics, UN function; HET: TLA; 2.30A {Vibrio cholerae} SCOP: c.108.1.18 Back     alignment and structure
>3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} Back     alignment and structure
>3kc2_A Uncharacterized protein YKR070W; HAD-like, mitochondral protein, PSI, MCSG, structural genomi protein structure initiative; HET: MSE; 1.55A {Saccharomyces cerevisiae} PDB: 3rf6_A* Back     alignment and structure
>2fue_A PMM 1, PMMH-22, phosphomannomutase 1; enzyme-product complex, protein glycosyl carbohydrate-deficient glycoprotein syndrome; HET: MSE M1P; 1.75A {Homo sapiens} SCOP: c.108.1.10 PDB: 2fuc_A* Back     alignment and structure
>2fue_A PMM 1, PMMH-22, phosphomannomutase 1; enzyme-product complex, protein glycosyl carbohydrate-deficient glycoprotein syndrome; HET: MSE M1P; 1.75A {Homo sapiens} SCOP: c.108.1.10 PDB: 2fuc_A* Back     alignment and structure
>1u02_A Trehalose-6-phosphate phosphatase related protein; structural genomics, PSI; 1.92A {Thermoplasma acidophilum} SCOP: c.108.1.15 Back     alignment and structure
>1zjj_A Hypothetical protein PH1952; alpha/beta hydrolase fold, HAD superfamily, structural genom riken structural genomics/proteomics initiative; 1.85A {Pyrococcus horikoshii} Back     alignment and structure
>3epr_A Hydrolase, haloacid dehalogenase-like family; structural genomics, unknown function, HAD superfamily hydro PSI-2; 1.55A {Streptococcus agalactiae serogroup V} SCOP: c.108.1.14 PDB: 1ys9_A 1wvi_A 1ydf_A Back     alignment and structure
>3ewi_A N-acylneuraminate cytidylyltransferase; beta barrel, HAD-like, rossmannoid fold, nucleotidyltransferase, nucleus; 1.90A {Mus musculus} Back     alignment and structure
>2q5c_A NTRC family transcriptional regulator; structural genomics, protein structure initiative; HET: SO4 GOL; 1.49A {Clostridium acetobutylicum atcc 824} Back     alignment and structure
>2amy_A PMM 2, phosphomannomutase 2; HS.459855, HS.313504, BC008310, phosphatase, PFAM PF03332, H superfamily, jaecken disease; 2.09A {Homo sapiens} SCOP: c.108.1.10 PDB: 2q4r_A Back     alignment and structure
>1u02_A Trehalose-6-phosphate phosphatase related protein; structural genomics, PSI; 1.92A {Thermoplasma acidophilum} SCOP: c.108.1.15 Back     alignment and structure
>3pdw_A Uncharacterized hydrolase YUTF; structural genomics, PSI2, NYSGXRC, protein structure initia YORK SGX research center for structural genomics; 1.60A {Bacillus subtilis} SCOP: c.108.1.0 Back     alignment and structure
>1s2o_A SPP, sucrose-phosphatase; phosphohydrolase, HAD superfamily, cyanobacteria; 1.40A {Synechocystis SP} SCOP: c.108.1.10 PDB: 1tj3_A 1tj4_A* 1tj5_A* 1u2s_A* 1u2t_A* 2b1q_A* 2b1r_A* 2d2v_A* Back     alignment and structure
>3geb_A EYES absent homolog 2; hydrolase, activator, alternative splicing, cytoplasm, developmental protein, magnesium, nucleus, polymorphism; 2.40A {Homo sapiens} PDB: 3hb0_A 3hb1_A Back     alignment and structure
>2pju_A Propionate catabolism operon regulatory protein; structural genomics, PRPR, transcriptional regulation, PSI- 2, protein structure initiative; 2.10A {Escherichia coli} SCOP: c.92.3.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 371
d1swva_257 c.108.1.3 (A:) Phosphonoacetaldehyde hydrolase {Ba 1e-05
d2bdua1291 c.108.1.21 (A:7-297) Cytosolic 5'-nucleotidase III 6e-05
d1cr6a1222 c.108.1.2 (A:4-225) Epoxide hydrolase, N-terminal 0.003
>d1swva_ c.108.1.3 (A:) Phosphonoacetaldehyde hydrolase {Bacillus cereus [TaxId: 1396]} Length = 257 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: HAD-like
superfamily: HAD-like
family: Phosphonoacetaldehyde hydrolase-like
domain: Phosphonoacetaldehyde hydrolase
species: Bacillus cereus [TaxId: 1396]
 Score = 44.0 bits (102), Expect = 1e-05
 Identities = 22/110 (20%), Positives = 38/110 (34%), Gaps = 5/110 (4%)

Query: 86  AVLLEVDGVLVDAYRFGNRQAFNVAFQKLGLDCANWTAPIYTDLLRKSAGDEDR-MLVLF 144
           AV+    G  VD   F   + F   F K G+     TA      +     D  R +  + 
Sbjct: 4   AVIFAWAGTTVDYGCFAPLEVFMEIFHKRGVA---ITAEEARKPMGLLKIDHVRALTEMP 60

Query: 145 FNRIGWPTSVPTNEKKAFVKNVLQEKKNALDEFLASKDAPLRPGVEDFVD 194
                W         +A ++ + +E +  L   L  + A    GV++ + 
Sbjct: 61  RIASEWNRVFRQLPTEADIQEMYEEFEEILFAILP-RYASPINGVKEVIA 109


>d2bdua1 c.108.1.21 (A:7-297) Cytosolic 5'-nucleotidase III {Mouse (Mus musculus) [TaxId: 10090]} Length = 291 Back     information, alignment and structure
>d1cr6a1 c.108.1.2 (A:4-225) Epoxide hydrolase, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 222 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query371
d1te2a_218 Phosphatase YniC {Escherichia coli [TaxId: 562]} 99.96
d2hdoa1207 Phosphoglycolate phosphatase {Lactobacillus planta 99.96
d1o08a_221 beta-Phosphoglucomutase {Lactococcus lactis [TaxId 99.95
d2hsza1224 Phosphoglycolate phosphatase Gph {Haemophilus somn 99.95
d1swva_257 Phosphonoacetaldehyde hydrolase {Bacillus cereus [ 99.95
d2go7a1204 Hypothetical protein SP2064 {Streptococcus pneumon 99.94
d2fdra1222 Hypothetical protein Atu0790 {Agrobacterium tumefa 99.94
d2ah5a1210 predicted phosphatase SP0104 {Streptococcus pneumo 99.93
d2fi1a1187 Putative hydrolase SP0805 {Streptococcus pneumonia 99.93
d2hcfa1228 Hypothetical protein CT1708 {Chlorobium tepidum [T 99.92
d1x42a1230 Hypothetical protein PH0459 {Archaeon Pyrococcus h 99.91
d1zs9a1253 E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} 99.9
d2gfha1247 N-acylneuraminate-9-phosphatase NANP {Mouse (Mus m 99.9
d1zrna_220 L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., s 99.9
d1zd3a1225 Epoxide hydrolase, N-terminal domain {Human (Homo 99.87
d1cr6a1222 Epoxide hydrolase, N-terminal domain {Mouse (Mus m 99.86
d1qq5a_245 L-2-Haloacid dehalogenase, HAD {Xanthobacter autot 99.85
d2b0ca1197 Putative phosphatase YihX {Escherichia coli [TaxId 99.83
d1u7pa_164 Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mu 99.82
d2g80a1225 Protein UTR4 {Baker's yeast (Saccharomyces cerevis 99.8
d2c4na1250 NagD {Escherichia coli [TaxId: 562]} 99.74
d2feaa1226 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate 99.73
d2o2xa1209 Hypothetical protein Mll2559 {Mesorhizobium loti [ 99.71
d1nnla_217 Phosphoserine phosphatase {Human (Homo sapiens) [T 99.71
d2fpwa1161 Histidine biosynthesis bifunctional protein HisB, 99.7
d1qyia_380 Hypothetical protein MW1667 (SA1546) {Staphylococc 99.69
d1vjra_261 Hypothetical protein TM1742 {Thermotoga maritima [ 99.68
d2gmwa1182 D,D-heptose 1,7-bisphosphate phosphatase GmhB {Esc 99.67
d1yv9a1253 Putative hydrolase EF1188 {Enterococcus faecalis [ 99.67
d1wvia_253 Putative phosphatase SMU.1415c {Streptococcus muta 99.64
d1j97a_210 Phosphoserine phosphatase {Archaeon Methanococcus 99.59
d1ltqa1149 Polynucleotide kinase, phosphatase domain {Bacteri 99.43
d1rkua_206 Homoserine kinase ThrH {Pseudomonas aeruginosa [Ta 99.25
d2b82a1209 Class B acid phosphatase, AphA {Escherichia coli [ 98.84
d1wr8a_230 Phosphoglycolate phosphatase, PGPase {Pyrococcus h 98.83
d2bdua1291 Cytosolic 5'-nucleotidase III {Mouse (Mus musculus 98.72
d1rkqa_271 Hypothetical protein YidA {Escherichia coli [TaxId 98.69
d1nrwa_285 Hypothetical protein YwpJ {Bacillus subtilis [TaxI 98.5
d1l6ra_225 Phosphoglycolate phosphatase, PGPase {Archaeon The 98.48
d1xvia_232 Putative mannosyl-3-phosphoglycerate phosphatase M 98.45
d1s2oa1244 Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 98.33
d1yj5a1195 5' polynucleotide kinase-3' phosphatase, middle do 98.32
d1nf2a_267 Hypothetical protein TM0651 {Thermotoga maritima [ 98.28
d1wzca1243 Putative mannosyl-3-phosphoglycerate phosphatase M 98.2
d2b8ea1135 Cation-transporting ATPase {Archaeon Archaeoglobus 98.09
d2b30a1283 PFL1270w orthologue {Plasmodium vivax [TaxId: 5855 98.06
d1q92a_195 5'(3')-deoxyribonucleotidase (dNT-2) {Human (Homo 98.06
d1k1ea_177 Probable phosphatase YrbI {Haemophilus influenzae, 97.82
d1wpga2168 Calcium ATPase, catalytic domain P {Rabbit (Orycto 97.54
d2bdea1 458 Cytosolic IMP-GMP specific 5'-nucleotidase {Legion 97.23
d1rlma_269 Sugar phosphatase SupH (YbiV) {Escherichia coli [T 96.48
d2rbka1260 Sugar-phosphate phosphatase BT4131 {Bacteroides th 96.26
d2amya1243 Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 95.52
d1ta0a_181 Carboxy-terminal domain RNA polymerase II polypept 94.29
d1y8aa1308 Hypothetical protein AF1437 {Archaeon Archaeoglobu 94.25
d2fuea1244 Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 92.8
d2rbka1260 Sugar-phosphate phosphatase BT4131 {Bacteroides th 92.11
d2amya1243 Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 91.96
d1rlma_269 Sugar phosphatase SupH (YbiV) {Escherichia coli [T 91.01
d1u02a_229 Trehalose-6-phosphate phosphatase related protein 89.9
d2fuea1244 Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 89.12
d1u02a_229 Trehalose-6-phosphate phosphatase related protein 88.29
d2pjua1186 Propionate catabolism operon regulatory protein Pr 85.68
d2obba1122 Hypothetical protein BT0820 {Bacteroides thetaiota 84.52
d1xpja_124 Hypothetical protein VC0232 {Vibrio cholerae [TaxI 83.31
d1k1ea_177 Probable phosphatase YrbI {Haemophilus influenzae, 83.09
>d1te2a_ c.108.1.6 (A:) Phosphatase YniC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: HAD-like
superfamily: HAD-like
family: beta-Phosphoglucomutase-like
domain: Phosphatase YniC
species: Escherichia coli [TaxId: 562]
Probab=99.96  E-value=1.9e-29  Score=225.93  Aligned_cols=209  Identities=17%  Similarity=0.191  Sum_probs=151.9

Q ss_pred             CceEEEEecCCccccccccCcHHHHHHHHHHcCCCCCCCChHHHHHHHHhhcCChHHHHHHHHHHcCCCCCCCcchhHHH
Q 017455           83 RDLAVLLEVDGVLVDAYRFGNRQAFNVAFQKLGLDCANWTAPIYTDLLRKSAGDEDRMLVLFFNRIGWPTSVPTNEKKAF  162 (371)
Q Consensus        83 ~~kaviFD~DGTL~d~~~~~~~~a~~~~~~~~g~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~g~~~~~~~~~~~~~  162 (371)
                      ++||||||+||||+|+... +..+|+++++++|++.   +.+.  .+....+.........+....++....        
T Consensus         2 ~i~a~iFD~DGTL~dt~~~-~~~a~~~~~~~~g~~~---~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~--------   67 (218)
T d1te2a_           2 QILAAIFDMDGLLIDSEPL-WDRAELDVMASLGVDI---SRRN--ELPDTLGLRIDMVVDLWYARQPWNGPS--------   67 (218)
T ss_dssp             CCCEEEECCBTTTBCCHHH-HHHHHHHHHHHTTCCG---GGGG--GSCCCTTCCHHHHHHHHHHHSCCSSSC--------
T ss_pred             cceEEEECCCCcccCCHHH-HHHHHHHHHHHcCCCC---CHHH--HHHHHhCCCccchhhhhhhcccccchh--------
Confidence            6899999999999999887 8899999999999873   3221  111122222333434444454554332        


Q ss_pred             HHHHHHHHHHHHHHHHhcCCCCCCccHHHHHHHHHHCCCcEEEEcCCCCCCcHHHHHHHHHcCccccchheeecchhHHh
Q 017455          163 VKNVLQEKKNALDEFLASKDAPLRPGVEDFVDDAYNEGIPLIVLTAYGKSGDRIARSVVEKLGSERISKIKIVGNEEVER  242 (371)
Q Consensus       163 ~~~l~~~~~~~~~~~l~~~~~~~~pgv~elL~~L~~~Gi~v~IvTn~~~~~~~~~~~~l~~lgl~~~f~~~i~~~~~~~~  242 (371)
                      ...+.....+.+.+.+. ...+++||+.++|+.|+++|++++|+||   ++...+..+++.+|+.++|+.++. ++++. 
T Consensus        68 ~~~~~~~~~~~~~~~~~-~~~~~~pg~~~~l~~L~~~g~~~~i~T~---~~~~~~~~~l~~~~l~~~F~~i~~-~~~~~-  141 (218)
T d1te2a_          68 RQEVVERVIARAISLVE-ETRPLLPGVREAVALCKEQGLLVGLASA---SPLHMLEKVLTMFDLRDSFDALAS-AEKLP-  141 (218)
T ss_dssp             HHHHHHHHHHHHHHHHH-HHCCBCTTHHHHHHHHHHTTCEEEEEES---SCHHHHHHHHHHTTCGGGCSEEEE-CTTSS-
T ss_pred             HHHHHHHHHHHHHHhhh-ccccccchHHHHHHHhhhcccccccccc---cccccccccccccccccccccccc-ccccc-
Confidence            12333333344444332 2356899999999999999999999999   558889999999999999987543 33321 


Q ss_pred             hhhccccccccccCCchhHHHHHHHHHHhHHHHHHHHHHHhhccCccccCCCCCchhHHHHHHHHHHHHHcCCCCCcEEE
Q 017455          243 SLYGQFVLGKGISSGVDEQLATEARKAVSAQKQEIAEEVASMLKLSVDIDTSSPESLDKIVAALRAGAEYAEKPVRNCFL  322 (371)
Q Consensus       243 ~~f~~~v~g~~v~~~~~~~~~~~~~k~~~~~~~~~~~~~~~~~KP~p~i~~p~~~~~~~~~~~~~~a~~~lgv~p~e~I~  322 (371)
                                                               ..||+|++              |+.+++++|++|++|+|
T Consensus       142 -----------------------------------------~~Kp~~~~--------------~~~~~~~l~~~~~~~l~  166 (218)
T d1te2a_         142 -----------------------------------------YSKPHPQV--------------YLDCAAKLGVDPLTCVA  166 (218)
T ss_dssp             -----------------------------------------CCTTSTHH--------------HHHHHHHHTSCGGGEEE
T ss_pred             -----------------------------------------cchhhHHH--------------HHHHHHHcCCCchhcEE
Confidence                                                     22788888              99999999999999999


Q ss_pred             EeCCHhhHHHHHHcCCcEEEECCCCCCCc-ccccccccchHHHHh
Q 017455          323 IAGSQSGVAGAQRIGMPCVVMRSRCITTL-PVSKTQRLADMLCRI  366 (371)
Q Consensus       323 IgDs~~Di~aA~~aGm~~v~v~~~~~~~~-~l~~~~~~~~~l~~~  366 (371)
                      |||+.+||.+|+++||++|+|.++..... ....++.+++++.|+
T Consensus       167 igD~~~di~aA~~~G~~~i~v~~~~~~~~~~~~~a~~~i~~l~el  211 (218)
T d1te2a_         167 LEDSVNGMIASKAARMRSIVVPAPEAQNDPRFVLANVKLSSLTEL  211 (218)
T ss_dssp             EESSHHHHHHHHHTTCEEEECCCTTTTTCGGGGGSSEECSCGGGC
T ss_pred             EeeCHHHHHHHHHcCCEEEEECCCCCccchhhcCCCEEECChhhC
Confidence            99999999999999999999987655444 335566666666553



>d2hdoa1 c.108.1.6 (A:1-207) Phosphoglycolate phosphatase {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d1o08a_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d2hsza1 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase Gph {Haemophilus somnus [TaxId: 731]} Back     information, alignment and structure
>d1swva_ c.108.1.3 (A:) Phosphonoacetaldehyde hydrolase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2go7a1 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2fdra1 c.108.1.6 (A:3-224) Hypothetical protein Atu0790 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2ah5a1 c.108.1.6 (A:1-210) predicted phosphatase SP0104 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2fi1a1 c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2hcfa1 c.108.1.6 (A:2-229) Hypothetical protein CT1708 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1x42a1 c.108.1.1 (A:1-230) Hypothetical protein PH0459 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1zs9a1 c.108.1.22 (A:4-256) E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gfha1 c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatase NANP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zrna_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., strain YL [TaxId: 306]} Back     information, alignment and structure
>d1zd3a1 c.108.1.2 (A:2-224) Epoxide hydrolase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cr6a1 c.108.1.2 (A:4-225) Epoxide hydrolase, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qq5a_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d2b0ca1 c.108.1.2 (A:8-204) Putative phosphatase YihX {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u7pa_ c.108.1.17 (A:) Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2g80a1 c.108.1.22 (A:17-241) Protein UTR4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2c4na1 c.108.1.14 (A:1-250) NagD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2feaa1 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2o2xa1 c.108.1.19 (A:8-216) Hypothetical protein Mll2559 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1nnla_ c.108.1.4 (A:) Phosphoserine phosphatase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fpwa1 c.108.1.19 (A:3-163) Histidine biosynthesis bifunctional protein HisB, phosphatase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qyia_ c.108.1.13 (A:) Hypothetical protein MW1667 (SA1546) {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1vjra_ c.108.1.14 (A:) Hypothetical protein TM1742 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2gmwa1 c.108.1.19 (A:24-205) D,D-heptose 1,7-bisphosphate phosphatase GmhB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yv9a1 c.108.1.14 (A:4-256) Putative hydrolase EF1188 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1wvia_ c.108.1.14 (A:) Putative phosphatase SMU.1415c {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1j97a_ c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ltqa1 c.108.1.9 (A:153-301) Polynucleotide kinase, phosphatase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1rkua_ c.108.1.11 (A:) Homoserine kinase ThrH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2b82a1 c.108.1.12 (A:4-212) Class B acid phosphatase, AphA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wr8a_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2bdua1 c.108.1.21 (A:7-297) Cytosolic 5'-nucleotidase III {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rkqa_ c.108.1.10 (A:) Hypothetical protein YidA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nrwa_ c.108.1.10 (A:) Hypothetical protein YwpJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1l6ra_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1xvia_ c.108.1.10 (A:) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s2oa1 c.108.1.10 (A:1-244) Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1yj5a1 c.108.1.9 (A:144-338) 5' polynucleotide kinase-3' phosphatase, middle domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nf2a_ c.108.1.10 (A:) Hypothetical protein TM0651 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wzca1 c.108.1.10 (A:1-243) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2b8ea1 c.108.1.7 (A:416-434,A:548-663) Cation-transporting ATPase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2b30a1 c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmodium vivax [TaxId: 5855]} Back     information, alignment and structure
>d1q92a_ c.108.1.8 (A:) 5'(3')-deoxyribonucleotidase (dNT-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1ea_ c.108.1.5 (A:) Probable phosphatase YrbI {Haemophilus influenzae, HI1679 [TaxId: 727]} Back     information, alignment and structure
>d1wpga2 c.108.1.7 (A:344-360,A:600-750) Calcium ATPase, catalytic domain P {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2bdea1 c.108.1.23 (A:2-459) Cytosolic IMP-GMP specific 5'-nucleotidase {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1rlma_ c.108.1.10 (A:) Sugar phosphatase SupH (YbiV) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2rbka1 c.108.1.10 (A:2-261) Sugar-phosphate phosphatase BT4131 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2amya1 c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ta0a_ c.108.1.16 (A:) Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y8aa1 c.108.1.24 (A:1-308) Hypothetical protein AF1437 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2fuea1 c.108.1.10 (A:13-256) Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2rbka1 c.108.1.10 (A:2-261) Sugar-phosphate phosphatase BT4131 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2amya1 c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rlma_ c.108.1.10 (A:) Sugar phosphatase SupH (YbiV) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u02a_ c.108.1.15 (A:) Trehalose-6-phosphate phosphatase related protein {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2fuea1 c.108.1.10 (A:13-256) Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u02a_ c.108.1.15 (A:) Trehalose-6-phosphate phosphatase related protein {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2pjua1 c.92.3.1 (A:11-196) Propionate catabolism operon regulatory protein PrpR {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2obba1 c.108.1.25 (A:1-122) Hypothetical protein BT0820 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1xpja_ c.108.1.18 (A:) Hypothetical protein VC0232 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1k1ea_ c.108.1.5 (A:) Probable phosphatase YrbI {Haemophilus influenzae, HI1679 [TaxId: 727]} Back     information, alignment and structure