Citrus Sinensis ID: 017515

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370

MNPESFTLPRATVTDYRLLKEAMLTSLPSPEMEDAVFYVENIINYNFKNKRLLEEALTHSSYTDSTSYQRLEFIGDAALGLALSNYVFLAYPQLDPGQLSLLRAANISTEKLARVAVKHGFYKFVRHSAAALDDKVKEFAEAVSQEDNTAVYGGSIKAPKVLADIVESIAAAIYVDIDFDLQKLWMIFRGLLEPIVTLEELQQQPQPVTLLFKLCQKNGKQVDIKHWRKNRKNIASVYVDGSFVASASSEQKEIAKLNAAREALEKLAQSMPVNCDVCEIFDDIDEKFEIEAAKQKLHELCGKKKWPKPSYKIEKDEGPSHDKKFMSAVQIATTDGVLFITGDEKSRVKDAENSAASMMLRALRESTYLC

cccccccccccccccHHHHHHHHccccccHHHHHHHHHHHHHcccccccHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHcccHHHHHHHHHcccHHHHHccccccHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHccccccHHHHHHHHHHHcccccccHHHccccccccEEEEEEEcccccccccccccccEEEEEEEEccEEEEEEEEccHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccEEEEEEEEEccEEEEEccccccccHHHHHHHHHHHHHHHHccccc

***********TVTDYRLLKEAMLTSL****MEDAVFYVENIINYNFKNKRLLEEALTHSSYTDSTSYQRLEFIGDAALGLALSNYVFLAYPQLDPGQLSLLRAANISTEKLARVAVKHGFYKFVRHSAAALDDKVKEFAEAVSQED*****GGSIKAPKVLADIVESIAAAIYVDIDFDLQKLWMIFRGLLEPIVTLEELQQQPQPVTLLFKLCQKNGKQVDIKHWRKNRKNIASVYVDGSFVAS*****K**AKLNAAREALEKLAQSMPVNCD************EIEAAKQKLHELCGKKKWP*****************FMSAVQIATTDGVLFIT*****************MLRALRESTYL*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MNPESFTLPRATVTDYRLLKEAMLTSLPSPEMEDAVFYVENIINYNFKNKRLLEEALTHSSYTDSTSYQRLEFIGDAALGLALSNYVFLAYPQLDPGQLSLLRAANISTEKLARVAVKHGFYKFVRHSAAALDDKVKEFAEAVSQEDNTAVYGGSIKAPKVLADIVESIAAAIYVDIDFDLQKLWMIFRGLLEPIVTLEELQQQPQPVTLLFKLCQKNGKQVDIKHWRKNRKNIASVYVDGSFVASxxxxxxxxxxxxxxxxxxxxxAQSMPVNCDVCEIFDDIDEKFEIEAAKQKLHELCGKKKWPKPSYKIEKDEGPSHDKKFMSAVQIATTDGVLFITGDEKSRVKDAENSAASMMLRALRESTYLC

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Ribonuclease 3-like protein 2	Ribonuclease that cleaves double-stranded RNA (dsRNA). Required for 3'-external transcribed spacer (ETS) cleavage of the pre-rRNA precursors. May promote the production of 21 nucleotide small interfering RNA (siRNA) during post-transcriptional gene silencing (PTGS).	probable	Q9LTQ0
Ribonuclease 3-like protein 2	Cleaves double-stranded RNA (dsRNA).	probable	Q6ATG6

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3C4B, chain A
Confidence level:very confident
Coverage over the Query: 35-254
View the alignment between query and template
View the model in PyMOL

Template: 1O0W, chain A
Confidence level:very confident
Coverage over the Query: 32-132,151-202,288-346
View the alignment between query and template
View the model in PyMOL

Template: 2L3J, chain A
Confidence level:very confident
Coverage over the Query: 205-369
View the alignment between query and template
View the model in PyMOL