Citrus Sinensis ID: 017515
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 370 | ||||||
| 255577153 | 342 | ribonuclease III, putative [Ricinus comm | 0.916 | 0.991 | 0.712 | 1e-142 | |
| 225460893 | 364 | PREDICTED: ribonuclease 3-like protein 2 | 0.924 | 0.939 | 0.708 | 1e-138 | |
| 297737474 | 337 | unnamed protein product [Vitis vinifera] | 0.908 | 0.997 | 0.712 | 1e-137 | |
| 449459642 | 338 | PREDICTED: ribonuclease 3-like protein 2 | 0.913 | 1.0 | 0.656 | 1e-130 | |
| 449526603 | 338 | PREDICTED: LOW QUALITY PROTEIN: ribonucl | 0.913 | 1.0 | 0.644 | 1e-126 | |
| 356552945 | 345 | PREDICTED: ribonuclease 3-like protein 2 | 0.891 | 0.956 | 0.630 | 1e-118 | |
| 357464753 | 344 | Endoribonuclease Dicer-like protein [Med | 0.9 | 0.968 | 0.591 | 1e-115 | |
| 388495198 | 344 | unknown [Medicago truncatula] | 0.908 | 0.976 | 0.585 | 1e-114 | |
| 297834980 | 391 | hypothetical protein ARALYDRAFT_479566 [ | 0.916 | 0.867 | 0.561 | 1e-110 | |
| 18402610 | 391 | RNAse THREE-like protein 2 [Arabidopsis | 0.916 | 0.867 | 0.553 | 1e-107 |
| >gi|255577153|ref|XP_002529460.1| ribonuclease III, putative [Ricinus communis] gi|223531076|gb|EEF32926.1| ribonuclease III, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 511 bits (1316), Expect = e-142, Method: Compositional matrix adjust.
Identities = 243/341 (71%), Positives = 293/341 (85%), Gaps = 2/341 (0%)
Query: 31 EMEDAVFYVENIINYNFKNKRLLEEALTHSSYTDSTSYQRLEFIGDAALGLALSNYVFLA 90
E ++ VE I+NY FKNK+L+EEALTHSSYT S +YQRLEFIGDAALGLALSN+VFLA
Sbjct: 2 EASSSISAVEKILNYTFKNKQLVEEALTHSSYTASPNYQRLEFIGDAALGLALSNHVFLA 61
Query: 91 YPQLDPGQLSLLRAANISTEKLARVAVKHGFYKFVRHSAAALDDKVKEFAEAVSQEDNTA 150
YP LDPG LSLLRAANISTEKLARVAVKHG ++F+RH+A ALDDKVKEF++AV +E++ A
Sbjct: 62 YPDLDPGHLSLLRAANISTEKLARVAVKHGLFRFLRHNATALDDKVKEFSDAVLREEDEA 121
Query: 151 V-YGGSIKAPKVLADIVESIAAAIYVDIDFDLQKLWMIFRGLLEPIVTLEELQQQPQPVT 209
V +GG++KAPKVLADIVES+AAA+YVD++FDLQ+LW+IFRGLLEPIVT E+LQQQPQP+T
Sbjct: 122 VAHGGTVKAPKVLADIVESVAAAVYVDVNFDLQRLWVIFRGLLEPIVTPEDLQQQPQPMT 181
Query: 210 LLFKLCQKNGKQVDIKHWRKNRKNIASVYVDGSFVASASSEQKEIAKLNAAREALEKLAQ 269
+LF+LCQK GK+VDI HW+ KNIAS+YVDG FVAS SSEQKE AKLNAA+ AL+KL+
Sbjct: 182 MLFELCQKKGKEVDIVHWKSGTKNIASIYVDGGFVASGSSEQKETAKLNAAKGALQKLSH 241
Query: 270 SMPVNCDVCE-IFDDIDEKFEIEAAKQKLHELCGKKKWPKPSYKIEKDEGPSHDKKFMSA 328
MP N E + I FEIE AK+KLHELCGKKKWPKP+Y IEK+ GPSH+KK++ +
Sbjct: 242 LMPSNLGHFEDVLKTIGGSFEIEGAKRKLHELCGKKKWPKPTYNIEKETGPSHEKKYVCS 301
Query: 329 VQIATTDGVLFITGDEKSRVKDAENSAASMMLRALRESTYL 369
VQIAT DGVL++ GDEK RVK+A+NSAAS+M+RAL+ES YL
Sbjct: 302 VQIATVDGVLYMRGDEKMRVKEADNSAASLMIRALQESNYL 342
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225460893|ref|XP_002278706.1| PREDICTED: ribonuclease 3-like protein 2-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297737474|emb|CBI26675.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449459642|ref|XP_004147555.1| PREDICTED: ribonuclease 3-like protein 2-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449526603|ref|XP_004170303.1| PREDICTED: LOW QUALITY PROTEIN: ribonuclease 3-like protein 2-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356552945|ref|XP_003544820.1| PREDICTED: ribonuclease 3-like protein 2-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357464753|ref|XP_003602658.1| Endoribonuclease Dicer-like protein [Medicago truncatula] gi|355491706|gb|AES72909.1| Endoribonuclease Dicer-like protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|388495198|gb|AFK35665.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|297834980|ref|XP_002885372.1| hypothetical protein ARALYDRAFT_479566 [Arabidopsis lyrata subsp. lyrata] gi|297331212|gb|EFH61631.1| hypothetical protein ARALYDRAFT_479566 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|18402610|ref|NP_566661.1| RNAse THREE-like protein 2 [Arabidopsis thaliana] gi|75274109|sp|Q9LTQ0.1|RTL2_ARATH RecName: Full=Ribonuclease 3-like protein 2; AltName: Full=Ribonuclease III-like protein 2; Short=RNase III-like protein 2; AltName: Full=Ribonuclease three-like protein 2 gi|9294562|dbj|BAB02825.1| unnamed protein product [Arabidopsis thaliana] gi|332642855|gb|AEE76376.1| RNAse THREE-like protein 2 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 370 | ||||||
| TAIR|locus:2092409 | 391 | RTL2 "RNAse THREE-like protein | 0.916 | 0.867 | 0.553 | 7.1e-100 | |
| TAIR|locus:2153333 | 957 | RTL3 "RNAse THREE-like protein | 0.645 | 0.249 | 0.431 | 3e-47 | |
| UNIPROTKB|Q8LMR2 | 1883 | DCL1 "Endoribonuclease Dicer h | 0.9 | 0.176 | 0.365 | 1.3e-48 | |
| TAIR|locus:504955425 | 264 | RTL1 "RNAse II-like 1" [Arabid | 0.602 | 0.844 | 0.389 | 1.3e-36 | |
| TAIR|locus:2149259 | 1702 | DCL4 "dicer-like 4" [Arabidops | 0.610 | 0.132 | 0.315 | 1e-32 | |
| UNIPROTKB|A7LFZ6 | 1657 | DCL4 "Endoribonuclease Dicer h | 0.670 | 0.149 | 0.294 | 2.5e-32 | |
| TAIR|locus:2097705 | 1388 | DCL2 "dicer-like 2" [Arabidops | 0.627 | 0.167 | 0.330 | 2.4e-26 | |
| FB|FBgn0039016 | 2249 | Dcr-1 "Dicer-1" [Drosophila me | 0.605 | 0.099 | 0.307 | 3.3e-23 | |
| RGD|1309381 | 401 | Dicer1 "dicer 1, ribonuclease | 0.627 | 0.578 | 0.302 | 2.5e-19 | |
| UNIPROTKB|B3KRG4 | 820 | DICER1 "Endoribonuclease Dicer | 0.627 | 0.282 | 0.301 | 4.4e-19 |
| TAIR|locus:2092409 RTL2 "RNAse THREE-like protein 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 991 (353.9 bits), Expect = 7.1e-100, P = 7.1e-100
Identities = 192/347 (55%), Positives = 268/347 (77%)
Query: 26 SLP-SPEMEDAVFYVENIINYNFKNKRLLEEALTHSSYTDSTSYQRLEFIGDAALGLALS 84
S+P S EME ++ VE I+NY F NK LL+EA+TH+S TD SY+RLEFIGD+A+GLA+S
Sbjct: 50 SVPVSSEME-SMEAVEKILNYKFSNKSLLKEAITHTSCTDFPSYERLEFIGDSAIGLAIS 108
Query: 85 NYVFLAYPQLDPGQLSLLRAANISTEKLARVAVKHGFYKFVRHSAAALDDKVKEFAEAVS 144
NY++L YP L+P LSLLRAAN+STEKLARV++ HG Y F+R +A +LD+KVKEF+EAV
Sbjct: 109 NYLYLTYPSLEPHDLSLLRAANVSTEKLARVSLNHGLYSFLRRNAPSLDEKVKEFSEAVG 168
Query: 145 QEDNTAV-YGGSIKAPKVLADIVESIAAAIYVDIDFDLQKLWMIFRGLLEPIVTLEELQQ 203
+ED+ +V YGG +KAPKVLAD+ ES+A A+YVD++FDLQ+LW+IFRGLLEPIVTL++LQ+
Sbjct: 169 KEDDLSVSYGGLVKAPKVLADLFESLAGAVYVDVNFDLQRLWVIFRGLLEPIVTLDDLQK 228
Query: 204 QPQPVTLLFKLCQKNGKQVDIKHWRKNRKNIASVYVDGSFVASASSEQKEIAKLNAAREA 263
QPQPV++LFKLC K+ K++DIK+W+ +IA +Y+D +AS +E K+IA+L AA+EA
Sbjct: 229 QPQPVSMLFKLCHKHKKRIDIKNWKDGNVSIAVIYLDDELLASGRAENKDIARLIAAKEA 288
Query: 264 LEKLAQSMPVNCDVCEIFDDIDEKFEIEAAKQKLHELCGKKKWPKPSYKIEKDEGPSHDK 323
L KL++ PV + D+ + ++ AK KL+E+C KKKWPKP Y +E+D K
Sbjct: 289 LRKLSEVFPVEM----VIDEDSVEIQLTHAKTKLNEICLKKKWPKPIYSVEEDRSSVQGK 344
Query: 324 KFMSAVQIATTDG-VLFITGDEKSRVKDAENSAASMMLRALRESTYL 369
+F+ + +I T+ L++ GDE+S++K AE+S+A M+RALR+S YL
Sbjct: 345 RFVCSAKIKITEEKTLYMKGDEQSKIKKAESSSAYHMIRALRKSHYL 391
|
|
| TAIR|locus:2153333 RTL3 "RNAse THREE-like protein 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8LMR2 DCL1 "Endoribonuclease Dicer homolog 1" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:504955425 RTL1 "RNAse II-like 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2149259 DCL4 "dicer-like 4" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A7LFZ6 DCL4 "Endoribonuclease Dicer homolog 4" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2097705 DCL2 "dicer-like 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0039016 Dcr-1 "Dicer-1" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| RGD|1309381 Dicer1 "dicer 1, ribonuclease type III" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B3KRG4 DICER1 "Endoribonuclease Dicer" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00027279001 | SubName- Full=Chromosome chr19 scaffold_4, whole genome shotgun sequence; (337 aa) | ||||||||||
(Vitis vinifera) | |||||||||||
| GSVIVG00002216001 | • | 0.481 | |||||||||
| GSVIVG00028703001 | • | • | 0.471 | ||||||||
| GSVIVG00000640001 | • | 0.416 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 370 | |||
| COG0571 | 235 | COG0571, Rnc, dsRNA-specific ribonuclease [Transcr | 2e-37 | |
| PRK00102 | 229 | PRK00102, rnc, ribonuclease III; Reviewed | 5e-36 | |
| cd00593 | 133 | cd00593, RIBOc, RIBOc | 7e-36 | |
| TIGR02191 | 220 | TIGR02191, RNaseIII, ribonuclease III, bacterial | 8e-35 | |
| smart00535 | 129 | smart00535, RIBOc, Ribonuclease III family | 5e-31 | |
| pfam00636 | 91 | pfam00636, Ribonuclease_3, Ribonuclease III domain | 7e-23 | |
| PRK12371 | 235 | PRK12371, PRK12371, ribonuclease III; Reviewed | 5e-18 | |
| cd00048 | 68 | cd00048, DSRM, Double-stranded RNA binding motif | 2e-15 | |
| pfam00035 | 66 | pfam00035, dsrm, Double-stranded RNA binding motif | 3e-12 | |
| smart00358 | 67 | smart00358, DSRM, Double-stranded RNA binding moti | 8e-12 | |
| PRK12372 | 413 | PRK12372, PRK12372, ribonuclease III; Reviewed | 8e-11 | |
| PRK14718 | 467 | PRK14718, PRK14718, ribonuclease III; Provisional | 9e-11 | |
| PRK00102 | 229 | PRK00102, rnc, ribonuclease III; Reviewed | 3e-09 | |
| TIGR02191 | 220 | TIGR02191, RNaseIII, ribonuclease III, bacterial | 2e-08 | |
| COG0571 | 235 | COG0571, Rnc, dsRNA-specific ribonuclease [Transcr | 4e-08 | |
| pfam00035 | 66 | pfam00035, dsrm, Double-stranded RNA binding motif | 6e-08 | |
| smart00358 | 67 | smart00358, DSRM, Double-stranded RNA binding moti | 9e-06 | |
| PRK12371 | 235 | PRK12371, PRK12371, ribonuclease III; Reviewed | 1e-04 | |
| cd00048 | 68 | cd00048, DSRM, Double-stranded RNA binding motif | 6e-04 |
| >gnl|CDD|223644 COG0571, Rnc, dsRNA-specific ribonuclease [Transcription] | Back alignment and domain information |
|---|
Score = 134 bits (340), Expect = 2e-37
Identities = 74/239 (30%), Positives = 109/239 (45%), Gaps = 32/239 (13%)
Query: 40 ENIINYNFKNKRLLEEALTHSSYT----DSTSYQRLEFIGDAALGLALSNYVFLAYPQLD 95
E + Y FK+K LLE+ALTH SY + +RLEF+GDA LGL ++ Y+F YP L
Sbjct: 12 EKKLGYTFKDKELLEQALTHRSYANEHKAVENNERLEFLGDAVLGLVVAEYLFKKYPNLP 71
Query: 96 PGQLSLLRAANISTEKLARVAVKHGFYKFVRHSAAALDDKVKEFAEAVSQEDNTAVYGGS 155
G+LS LRAA +S E LA +A + G ++R G
Sbjct: 72 EGELSKLRAALVSEESLAEIARELGLGDYLRLGKGEEKS-------------------GG 112
Query: 156 IKAPKVLADIVESIAAAIYVDIDFDLQKLWMIFRGLLEPIVT-LEELQQQPQPVTLLFKL 214
+ +LAD E++ AIY +D L+ L P + ++ Q P T L +L
Sbjct: 113 RRRESILADAFEALIGAIY--LDSGLEAARKFILKLFLPRLEEIDAGDQFKDPKTRLQEL 170
Query: 215 CQKNGK------QVDIKHWRKNRKNIASVYVDGSFVASASSEQKEIAKLNAAREALEKL 267
Q G V + +++ V V G + + K+ A+ AA +AL+KL
Sbjct: 171 LQAQGLVLPEYRLVKEEGPAHDKEFTVEVAVGGKELGTGKGRSKKEAEQAAAEQALKKL 229
|
Length = 235 |
| >gnl|CDD|234633 PRK00102, rnc, ribonuclease III; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|238333 cd00593, RIBOc, RIBOc | Back alignment and domain information |
|---|
| >gnl|CDD|233772 TIGR02191, RNaseIII, ribonuclease III, bacterial | Back alignment and domain information |
|---|
| >gnl|CDD|197778 smart00535, RIBOc, Ribonuclease III family | Back alignment and domain information |
|---|
| >gnl|CDD|216036 pfam00636, Ribonuclease_3, Ribonuclease III domain | Back alignment and domain information |
|---|
| >gnl|CDD|171444 PRK12371, PRK12371, ribonuclease III; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|238007 cd00048, DSRM, Double-stranded RNA binding motif | Back alignment and domain information |
|---|
| >gnl|CDD|215670 pfam00035, dsrm, Double-stranded RNA binding motif | Back alignment and domain information |
|---|
| >gnl|CDD|214634 smart00358, DSRM, Double-stranded RNA binding motif | Back alignment and domain information |
|---|
| >gnl|CDD|237081 PRK12372, PRK12372, ribonuclease III; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|173181 PRK14718, PRK14718, ribonuclease III; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234633 PRK00102, rnc, ribonuclease III; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|233772 TIGR02191, RNaseIII, ribonuclease III, bacterial | Back alignment and domain information |
|---|
| >gnl|CDD|223644 COG0571, Rnc, dsRNA-specific ribonuclease [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|215670 pfam00035, dsrm, Double-stranded RNA binding motif | Back alignment and domain information |
|---|
| >gnl|CDD|214634 smart00358, DSRM, Double-stranded RNA binding motif | Back alignment and domain information |
|---|
| >gnl|CDD|171444 PRK12371, PRK12371, ribonuclease III; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|238007 cd00048, DSRM, Double-stranded RNA binding motif | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 370 | |||
| COG0571 | 235 | Rnc dsRNA-specific ribonuclease [Transcription] | 100.0 | |
| PRK12371 | 235 | ribonuclease III; Reviewed | 100.0 | |
| PRK14718 | 467 | ribonuclease III; Provisional | 100.0 | |
| PRK12372 | 413 | ribonuclease III; Reviewed | 100.0 | |
| PRK00102 | 229 | rnc ribonuclease III; Reviewed | 100.0 | |
| TIGR02191 | 220 | RNaseIII ribonuclease III, bacterial. This family | 100.0 | |
| KOG1817 | 533 | consensus Ribonuclease [RNA processing and modific | 100.0 | |
| PF14622 | 128 | Ribonucleas_3_3: Ribonuclease-III-like; PDB: 1O0W_ | 99.96 | |
| smart00535 | 129 | RIBOc Ribonuclease III family. | 99.94 | |
| cd00593 | 133 | RIBOc RIBOc. Ribonuclease III C terminal domain. T | 99.94 | |
| KOG3732 | 339 | consensus Staufen and related double-stranded-RNA- | 99.94 | |
| KOG3769 | 333 | consensus Ribonuclease III domain proteins [Transl | 99.92 | |
| PF00636 | 114 | Ribonuclease_3: Ribonuclease III domain; InterPro: | 99.9 | |
| KOG1817 | 533 | consensus Ribonuclease [RNA processing and modific | 99.88 | |
| PHA02701 | 183 | ORF020 dsRNA-binding PKR inhibitor; Provisional | 99.66 | |
| cd00048 | 68 | DSRM Double-stranded RNA binding motif. Binding is | 99.63 | |
| KOG0701 | 1606 | consensus dsRNA-specific nuclease Dicer and relate | 99.61 | |
| smart00358 | 67 | DSRM Double-stranded RNA binding motif. | 99.6 | |
| PHA03103 | 183 | double-strand RNA-binding protein; Provisional | 99.58 | |
| KOG0701 | 1606 | consensus dsRNA-specific nuclease Dicer and relate | 99.55 | |
| PF00035 | 67 | dsrm: Double-stranded RNA binding motif; InterPro: | 99.52 | |
| KOG3732 | 339 | consensus Staufen and related double-stranded-RNA- | 99.5 | |
| PF14709 | 80 | DND1_DSRM: double strand RNA binding domain from D | 99.5 | |
| PHA03103 | 183 | double-strand RNA-binding protein; Provisional | 99.4 | |
| PHA02701 | 183 | ORF020 dsRNA-binding PKR inhibitor; Provisional | 99.4 | |
| smart00358 | 67 | DSRM Double-stranded RNA binding motif. | 99.37 | |
| PF00035 | 67 | dsrm: Double-stranded RNA binding motif; InterPro: | 99.36 | |
| cd00048 | 68 | DSRM Double-stranded RNA binding motif. Binding is | 99.33 | |
| PRK12371 | 235 | ribonuclease III; Reviewed | 99.17 | |
| KOG4334 | 650 | consensus Uncharacterized conserved protein, conta | 99.05 | |
| PRK14718 | 467 | ribonuclease III; Provisional | 99.04 | |
| COG0571 | 235 | Rnc dsRNA-specific ribonuclease [Transcription] | 99.02 | |
| PRK12372 | 413 | ribonuclease III; Reviewed | 99.01 | |
| KOG2777 | 542 | consensus tRNA-specific adenosine deaminase 1 [RNA | 98.99 | |
| PRK00102 | 229 | rnc ribonuclease III; Reviewed | 98.96 | |
| TIGR02191 | 220 | RNaseIII ribonuclease III, bacterial. This family | 98.94 | |
| PF14709 | 80 | DND1_DSRM: double strand RNA binding domain from D | 98.59 | |
| KOG3769 | 333 | consensus Ribonuclease III domain proteins [Transl | 98.08 | |
| COG1939 | 132 | Ribonuclease III family protein [Replication, reco | 97.93 | |
| KOG0921 | 1282 | consensus Dosage compensation complex, subunit MLE | 97.72 | |
| PF03368 | 90 | Dicer_dimer: Dicer dimerisation domain; InterPro: | 97.53 | |
| KOG2777 | 542 | consensus tRNA-specific adenosine deaminase 1 [RNA | 97.42 | |
| KOG4334 | 650 | consensus Uncharacterized conserved protein, conta | 97.37 | |
| PF03368 | 90 | Dicer_dimer: Dicer dimerisation domain; InterPro: | 96.24 | |
| KOG3792 | 816 | consensus Transcription factor NFAT, subunit NF90 | 96.19 | |
| KOG0921 | 1282 | consensus Dosage compensation complex, subunit MLE | 95.8 | |
| PF14954 | 252 | LIX1: Limb expression 1 | 93.67 | |
| KOG2334 | 477 | consensus tRNA-dihydrouridine synthase [Translatio | 92.73 | |
| PF14954 | 252 | LIX1: Limb expression 1 | 92.0 | |
| PF11469 | 120 | Ribonucleas_3_2: Ribonuclease III; InterPro: IPR02 | 87.25 |
| >COG0571 Rnc dsRNA-specific ribonuclease [Transcription] | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.3e-52 Score=373.30 Aligned_cols=223 Identities=36% Similarity=0.582 Sum_probs=200.8
Q ss_pred HHHHHHHHHcCcccCChhHHHHHhcCCCCCC----CCCcchhhhhhHHHHHHHHHHHHHHHCCCCCcchhhHHHHHhcCh
Q 017515 34 DAVFYVENIINYNFKNKRLLEEALTHSSYTD----STSYQRLEFIGDAALGLALSNYVFLAYPQLDPGQLSLLRAANIST 109 (370)
Q Consensus 34 ~~~~~le~~lgy~f~~~~Ll~~AlTh~s~~~----~~~~erLe~LGdavL~~~v~~~l~~~~p~~~~~~l~~lr~~lvsn 109 (370)
..+..|++.+||.|+|++||.+||||+|+.+ ..||||||||||+||+++|++|||++||+.++|.||.+|+.+||+
T Consensus 6 ~~~~~l~~~lg~~f~~~~lL~~AltH~S~~~e~~~~~~nERLEFLGDavL~l~vae~Lf~~yP~~~EG~Ls~~ra~lV~~ 85 (235)
T COG0571 6 KKLEALEKKLGYTFKDKELLEQALTHRSYANEHKAVENNERLEFLGDAVLGLVVAEYLFKKYPNLPEGELSKLRAALVSE 85 (235)
T ss_pred HHHHHHHHHhCCCcCCHHHHHHHhcCcchhccccCCcchHHHHhhHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHH
Confidence 4678899999999999999999999999986 468999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHcChhHHHhhccchhhHHHHHHHHHhhccccccccCCCcCCchHHHHHHHHHHHHHhhcCCcChHHHHHHHH
Q 017515 110 EKLARVAVKHGFYKFVRHSAAALDDKVKEFAEAVSQEDNTAVYGGSIKAPKVLADIVESIAAAIYVDIDFDLQKLWMIFR 189 (370)
Q Consensus 110 ~~La~~a~~~gL~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~k~lad~feAliGAIyld~g~~~~~~~~v~~ 189 (370)
.+|+.+|..+||++||+.+..+. ..++ ...+++++|+|||+|||||+|+|++.++ +|+.
T Consensus 86 ~~La~ia~~l~l~~~l~lg~ge~------------------~~gg-~~~~silaD~~EAligAiylD~g~~~~~--~~i~ 144 (235)
T COG0571 86 ESLAEIARELGLGDYLRLGKGEE------------------KSGG-RRRESILADAFEALIGAIYLDSGLEAAR--KFIL 144 (235)
T ss_pred HHHHHHHHHhCccchhhccCChh------------------hcCC-CCchhHHHHHHHHHHHHHHHhCChHHHH--HHHH
Confidence 99999999999999999987643 3445 6689999999999999999999966554 7899
Q ss_pred HhhhhhhhhhhhccCCchHHHHHHHHHhcCCceeEEEeecCCeEEEEEEECCeeEEEEeccCHHHHHHHHHHHHHHHhhh
Q 017515 190 GLLEPIVTLEELQQQPQPVTLLFKLCQKNGKQVDIKHWRKNRKNIASVYVDGSFVASASSEQKEIAKLNAAREALEKLAQ 269 (370)
Q Consensus 190 ~ll~~~i~~~~~~~~~~p~~~L~e~~~k~~~~~~y~~~~~~~~f~~~v~v~g~~~~~g~g~skk~Ak~~AA~~AL~~L~~ 269 (370)
+++.+.+...+..
T Consensus 145 ~l~~~~~~~~~~~------------------------------------------------------------------- 157 (235)
T COG0571 145 KLFLPRLEEIDAG------------------------------------------------------------------- 157 (235)
T ss_pred HHHHHHHhhcccc-------------------------------------------------------------------
Confidence 9998877532111
Q ss_pred cCCCcccccccccCCchhhhhhhHHHHHHHHHHhcCCCCCceEEecccCCCCCcceEEEEEEEecCCeEEEeecCCCchh
Q 017515 270 SMPVNCDVCEIFDDIDEKFEIEAAKQKLHELCGKKKWPKPSYKIEKDEGPSHDKKFMSAVQIATTDGVLFITGDEKSRVK 349 (370)
Q Consensus 270 ~~~~~~~~~~~~~~~~~~~~~~~~ks~L~e~~~k~~~~~P~y~~~~~~g~~~~~~f~~~v~v~~~~~~~~~~g~g~skkk 349 (370)
....|||+.||||||+++...|.|.++.++||+|++.|+++|.| ++..+++|.|+|| |
T Consensus 158 ------------------~~~~D~Kt~LQe~~q~~~~~~p~Y~~v~~~g~~h~~~F~v~v~v---~~~~~g~G~G~sk-k 215 (235)
T COG0571 158 ------------------DQFKDPKTRLQELLQAQGLVLPEYRLVKEEGPAHDKEFTVEVAV---GGKELGTGKGRSK-K 215 (235)
T ss_pred ------------------ccccChhHHHHHHHHhcCCCCCeEEEeeccCCCCCceEEEEEEE---CCeeEEEecccCH-H
Confidence 12368999999999999999999999999999999999999999 6899999999999 9
Q ss_pred HHHHHHHHHHHHHHhhc
Q 017515 350 DAENSAASMMLRALRES 366 (370)
Q Consensus 350 ~A~~~AA~~~l~~l~~~ 366 (370)
+|||.||+.||..|...
T Consensus 216 ~AEq~AA~~al~~l~~~ 232 (235)
T COG0571 216 EAEQAAAEQALKKLGVK 232 (235)
T ss_pred HHHHHHHHHHHHHhccc
Confidence 99999999999998753
|
|
| >PRK12371 ribonuclease III; Reviewed | Back alignment and domain information |
|---|
| >PRK14718 ribonuclease III; Provisional | Back alignment and domain information |
|---|
| >PRK12372 ribonuclease III; Reviewed | Back alignment and domain information |
|---|
| >PRK00102 rnc ribonuclease III; Reviewed | Back alignment and domain information |
|---|
| >TIGR02191 RNaseIII ribonuclease III, bacterial | Back alignment and domain information |
|---|
| >KOG1817 consensus Ribonuclease [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF14622 Ribonucleas_3_3: Ribonuclease-III-like; PDB: 1O0W_A 2A11_A 3N3W_B | Back alignment and domain information |
|---|
| >smart00535 RIBOc Ribonuclease III family | Back alignment and domain information |
|---|
| >cd00593 RIBOc RIBOc | Back alignment and domain information |
|---|
| >KOG3732 consensus Staufen and related double-stranded-RNA-binding proteins [Intracellular trafficking, secretion, and vesicular transport; Transcription] | Back alignment and domain information |
|---|
| >KOG3769 consensus Ribonuclease III domain proteins [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF00636 Ribonuclease_3: Ribonuclease III domain; InterPro: IPR000999 Prokaryotic ribonuclease III (3 | Back alignment and domain information |
|---|
| >KOG1817 consensus Ribonuclease [RNA processing and modification] | Back alignment and domain information |
|---|
| >PHA02701 ORF020 dsRNA-binding PKR inhibitor; Provisional | Back alignment and domain information |
|---|
| >cd00048 DSRM Double-stranded RNA binding motif | Back alignment and domain information |
|---|
| >KOG0701 consensus dsRNA-specific nuclease Dicer and related ribonucleases [RNA processing and modification] | Back alignment and domain information |
|---|
| >smart00358 DSRM Double-stranded RNA binding motif | Back alignment and domain information |
|---|
| >PHA03103 double-strand RNA-binding protein; Provisional | Back alignment and domain information |
|---|
| >KOG0701 consensus dsRNA-specific nuclease Dicer and related ribonucleases [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF00035 dsrm: Double-stranded RNA binding motif; InterPro: IPR001159 The DsRBD domain is found in a variety of RNA-binding proteins with different structures and exhibiting a diversity of functions [] | Back alignment and domain information |
|---|
| >KOG3732 consensus Staufen and related double-stranded-RNA-binding proteins [Intracellular trafficking, secretion, and vesicular transport; Transcription] | Back alignment and domain information |
|---|
| >PF14709 DND1_DSRM: double strand RNA binding domain from DEAD END PROTEIN 1 | Back alignment and domain information |
|---|
| >PHA03103 double-strand RNA-binding protein; Provisional | Back alignment and domain information |
|---|
| >PHA02701 ORF020 dsRNA-binding PKR inhibitor; Provisional | Back alignment and domain information |
|---|
| >smart00358 DSRM Double-stranded RNA binding motif | Back alignment and domain information |
|---|
| >PF00035 dsrm: Double-stranded RNA binding motif; InterPro: IPR001159 The DsRBD domain is found in a variety of RNA-binding proteins with different structures and exhibiting a diversity of functions [] | Back alignment and domain information |
|---|
| >cd00048 DSRM Double-stranded RNA binding motif | Back alignment and domain information |
|---|
| >PRK12371 ribonuclease III; Reviewed | Back alignment and domain information |
|---|
| >KOG4334 consensus Uncharacterized conserved protein, contains double-stranded RNA-binding motif and WW domain [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14718 ribonuclease III; Provisional | Back alignment and domain information |
|---|
| >COG0571 Rnc dsRNA-specific ribonuclease [Transcription] | Back alignment and domain information |
|---|
| >PRK12372 ribonuclease III; Reviewed | Back alignment and domain information |
|---|
| >KOG2777 consensus tRNA-specific adenosine deaminase 1 [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK00102 rnc ribonuclease III; Reviewed | Back alignment and domain information |
|---|
| >TIGR02191 RNaseIII ribonuclease III, bacterial | Back alignment and domain information |
|---|
| >PF14709 DND1_DSRM: double strand RNA binding domain from DEAD END PROTEIN 1 | Back alignment and domain information |
|---|
| >KOG3769 consensus Ribonuclease III domain proteins [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG1939 Ribonuclease III family protein [Replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription] | Back alignment and domain information |
|---|
| >PF03368 Dicer_dimer: Dicer dimerisation domain; InterPro: IPR005034 This domain is found in members of the Dicer protein family of dsRNA nucleases | Back alignment and domain information |
|---|
| >KOG2777 consensus tRNA-specific adenosine deaminase 1 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4334 consensus Uncharacterized conserved protein, contains double-stranded RNA-binding motif and WW domain [General function prediction only] | Back alignment and domain information |
|---|
| >PF03368 Dicer_dimer: Dicer dimerisation domain; InterPro: IPR005034 This domain is found in members of the Dicer protein family of dsRNA nucleases | Back alignment and domain information |
|---|
| >KOG3792 consensus Transcription factor NFAT, subunit NF90 [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription] | Back alignment and domain information |
|---|
| >PF14954 LIX1: Limb expression 1 | Back alignment and domain information |
|---|
| >KOG2334 consensus tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF14954 LIX1: Limb expression 1 | Back alignment and domain information |
|---|
| >PF11469 Ribonucleas_3_2: Ribonuclease III; InterPro: IPR021568 This archaeal family of proteins has no known function | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 370 | ||||
| 3c4t_A | 265 | Structure Of Rnaseiiib And Dsrna Binding Domains Of | 2e-20 | ||
| 2eb1_A | 200 | Crystal Structure Of The C-Terminal Rnase Iii Domai | 2e-19 | ||
| 3c4b_A | 265 | Structure Of Rnaseiiib And Dsrna Binding Domains Of | 4e-18 | ||
| 3n3w_A | 248 | 2.2 Angstrom Resolution Crystal Structure Of Nuclea | 3e-15 | ||
| 3o2r_A | 170 | Structural Flexibility In Region Involved In Dimer | 1e-14 | ||
| 3o2r_D | 144 | Structural Flexibility In Region Involved In Dimer | 2e-13 | ||
| 1o0w_A | 252 | Crystal Structure Of Ribonuclease Iii (Tm1102) From | 5e-13 | ||
| 1yyk_A | 221 | Crystal Structure Of Rnase Iii From Aquifex Aeolicu | 4e-11 | ||
| 1yz9_A | 221 | Crystal Structure Of Rnase Iii Mutant E110q From Aq | 1e-10 | ||
| 1i4s_A | 147 | Crystal Structure Of Rnase Iii Endonuclease Domain | 1e-10 | ||
| 1rc7_A | 220 | Crystal Structure Of Rnase Iii Mutant E110k From Aq | 1e-10 | ||
| 1yyo_A | 221 | Crystal Structure Of Rnase Iii Mutant E110k From Aq | 1e-10 | ||
| 1jfz_A | 154 | Crystal Structure Of Mn(Ii)-Complex Of Rnase Iii En | 1e-10 | ||
| 2ez6_A | 221 | Crystal Structure Of Aquifex Aeolicus Rnase Iii (d4 | 1e-10 | ||
| 2a11_A | 242 | Crystal Structure Of Nuclease Domain Of Ribonuclase | 5e-08 | ||
| 2lrs_A | 71 | The Second Dsrbd Domain From A. Thaliana Dicer-like | 4e-07 | ||
| 3rv0_A | 341 | Crystal Structure Of K. Polysporus Dcr1 Without The | 2e-04 | ||
| 2l2n_A | 103 | Backbone 1h, 13c, And 15n Chemical Shift Assignment | 3e-04 | ||
| 3rv1_A | 246 | Crystal Structure Of The N-Terminal And Rnase Iii D | 5e-04 | ||
| 3adg_A | 73 | Structure Of Arabidopsis Hyl1 And Its Molecular Imp | 9e-04 |
| >pdb|3C4T|A Chain A, Structure Of Rnaseiiib And Dsrna Binding Domains Of Mouse Dicer Length = 265 | Back alignment and structure |
|
| >pdb|2EB1|A Chain A, Crystal Structure Of The C-Terminal Rnase Iii Domain Of Human Dicer Length = 200 | Back alignment and structure |
| >pdb|3C4B|A Chain A, Structure Of Rnaseiiib And Dsrna Binding Domains Of Mouse Dicer Length = 265 | Back alignment and structure |
| >pdb|3N3W|A Chain A, 2.2 Angstrom Resolution Crystal Structure Of Nuclease Domain Ribonuclase Iii (Rnc) From Campylobacter Jejuni Length = 248 | Back alignment and structure |
| >pdb|3O2R|A Chain A, Structural Flexibility In Region Involved In Dimer Formation Of Nuclease Domain Of Ribonuclase Iii (Rnc) From Campylobacter Jejuni Length = 170 | Back alignment and structure |
| >pdb|1O0W|A Chain A, Crystal Structure Of Ribonuclease Iii (Tm1102) From Thermotoga Maritima At 2.0 A Resolution Length = 252 | Back alignment and structure |
| >pdb|1YYK|A Chain A, Crystal Structure Of Rnase Iii From Aquifex Aeolicus Complexed With Double-Stranded Rna At 2.5-Angstrom Resolution Length = 221 | Back alignment and structure |
| >pdb|1YZ9|A Chain A, Crystal Structure Of Rnase Iii Mutant E110q From Aquifex Aeolicus Complexed With Double Stranded Rna At 2.1- Angstrom Resolution Length = 221 | Back alignment and structure |
| >pdb|1I4S|A Chain A, Crystal Structure Of Rnase Iii Endonuclease Domain From Aquifex Aeolicus At 2.15 Angstrom Resolution Length = 147 | Back alignment and structure |
| >pdb|1RC7|A Chain A, Crystal Structure Of Rnase Iii Mutant E110k From Aquifex Aeolicus Complexed With Ds-Rna At 2.15 Angstrom Resolution Length = 220 | Back alignment and structure |
| >pdb|1YYO|A Chain A, Crystal Structure Of Rnase Iii Mutant E110k From Aquifex Aeolicus Complexed With Double-stranded Rna At 2.9- Angstrom Resolution Length = 221 | Back alignment and structure |
| >pdb|1JFZ|A Chain A, Crystal Structure Of Mn(Ii)-Complex Of Rnase Iii Endonuclease Domain From Aquifex Aeolicus At 2.10 Angstrom Resolution Length = 154 | Back alignment and structure |
| >pdb|2EZ6|A Chain A, Crystal Structure Of Aquifex Aeolicus Rnase Iii (d44n) Complexed With Product Of Double-stranded Rna Processing Length = 221 | Back alignment and structure |
| >pdb|2A11|A Chain A, Crystal Structure Of Nuclease Domain Of Ribonuclase Iii From Mycobacterium Tuberculosis Length = 242 | Back alignment and structure |
| >pdb|2LRS|A Chain A, The Second Dsrbd Domain From A. Thaliana Dicer-like 1 Length = 71 | Back alignment and structure |
| >pdb|3RV0|A Chain A, Crystal Structure Of K. Polysporus Dcr1 Without The C-Terminal Dsrbd Length = 341 | Back alignment and structure |
| >pdb|2L2N|A Chain A, Backbone 1h, 13c, And 15n Chemical Shift Assignments For The First Dsrbd Of Protein Hyl1 Length = 103 | Back alignment and structure |
| >pdb|3RV1|A Chain A, Crystal Structure Of The N-Terminal And Rnase Iii Domains Of K. Polysporus Dcr1 E224q Mutant Length = 246 | Back alignment and structure |
| >pdb|3ADG|A Chain A, Structure Of Arabidopsis Hyl1 And Its Molecular Implications For Mirna Processing Length = 73 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 370 | |||
| 3c4b_A | 265 | Endoribonuclease dicer; RNAse, dsRNA binding prote | 3e-68 | |
| 3c4b_A | 265 | Endoribonuclease dicer; RNAse, dsRNA binding prote | 5e-10 | |
| 3n3w_A | 248 | Ribonuclease III; nuclease domain, ribonuclase III | 4e-38 | |
| 3n3w_A | 248 | Ribonuclease III; nuclease domain, ribonuclase III | 1e-11 | |
| 2nug_A | 221 | Ribonuclease III, RNAse III; dsRNA, RNA interferen | 2e-36 | |
| 2nug_A | 221 | Ribonuclease III, RNAse III; dsRNA, RNA interferen | 8e-12 | |
| 1o0w_A | 252 | Ribonuclease III, RNAse III; TM1102, structural ge | 4e-35 | |
| 1o0w_A | 252 | Ribonuclease III, RNAse III; TM1102, structural ge | 1e-11 | |
| 3o2r_A | 170 | Ribonuclease III; structural genomics, center for | 3e-33 | |
| 2a11_A | 242 | Ribonuclease III, RNAse III; nuclease domain, stru | 2e-32 | |
| 2a11_A | 242 | Ribonuclease III, RNAse III; nuclease domain, stru | 1e-09 | |
| 3rv0_A | 341 | K. polysporus DCR1; RNAse III enzyme, RNA binding | 5e-32 | |
| 3rv0_A | 341 | K. polysporus DCR1; RNAse III enzyme, RNA binding | 1e-04 | |
| 3rv1_A | 246 | K. polysporus DCR1; RNAse III enzyme, RNA binding | 2e-26 | |
| 2qvw_A | 756 | GLP_546_48378_50642; dicer, RNAI,pseudo-merohedral | 1e-25 | |
| 2qvw_A | 756 | GLP_546_48378_50642; dicer, RNAI,pseudo-merohedral | 4e-24 | |
| 2qvw_A | 756 | GLP_546_48378_50642; dicer, RNAI,pseudo-merohedral | 5e-04 | |
| 1qu6_A | 179 | Protein kinase PKR; dsRNA-binding domain, solution | 1e-17 | |
| 1qu6_A | 179 | Protein kinase PKR; dsRNA-binding domain, solution | 1e-11 | |
| 2yt4_A | 232 | Protein DGCR8; DSRBD, RNA binding domain, RNA bind | 3e-16 | |
| 3adj_A | 76 | F21M12.9 protein; HYL1, miRNA processing, RNA bind | 2e-15 | |
| 3adl_A | 88 | RISC-loading complex subunit tarbp2; TRBP2, miRNA | 3e-13 | |
| 3adg_A | 73 | F21M12.9 protein; HYL1, miRNA processing mechanism | 4e-13 | |
| 1di2_A | 69 | XLRBPA, double stranded RNA binding protein A; pro | 7e-13 | |
| 2cpn_A | 89 | TAR RNA-binding protein 2; double-stranded RNA bin | 8e-13 | |
| 1whn_A | 128 | Hypothetical protein riken cDNA 2310016K04; double | 3e-12 | |
| 2l2n_A | 103 | Hyponastic leave 1; DSRBD, miRNA, RNA binding prot | 4e-12 | |
| 3llh_A | 90 | RISC-loading complex subunit tarbp2; DSRBD, DSRM, | 5e-12 | |
| 1x49_A | 97 | Interferon-induced, double-stranded RNA- activated | 5e-12 | |
| 1ekz_A | 76 | DSRBDIII, maternal effect protein (staufen); struc | 2e-11 | |
| 2dix_A | 84 | Interferon-inducible double stranded RNA- dependen | 2e-11 | |
| 1uhz_A | 89 | Staufen (RNA binding protein) homolog 2; DSRM, sta | 5e-11 | |
| 1whq_A | 99 | RNA helicase A; double-stranded RNA binding domain | 2e-10 | |
| 2b7v_A | 71 | Double-stranded RNA-specific editase 1; RNA editin | 5e-10 | |
| 2b7v_A | 71 | Double-stranded RNA-specific editase 1; RNA editin | 5e-04 | |
| 1uil_A | 113 | Double-stranded RNA-binding motif; structural geno | 7e-10 | |
| 2khx_A | 85 | Ribonuclease 3; drosha, RNA binding domain, hydrol | 9e-10 | |
| 2l33_A | 91 | Interleukin enhancer-binding factor 3; structural | 1e-09 | |
| 2l33_A | 91 | Interleukin enhancer-binding factor 3; structural | 3e-05 | |
| 3p1x_A | 75 | Interleukin enhancer-binding factor 3; structural | 2e-09 | |
| 3p1x_A | 75 | Interleukin enhancer-binding factor 3; structural | 5e-05 | |
| 2b7t_A | 73 | Double-stranded RNA-specific editase 1; RNA editin | 7e-09 | |
| 2ljh_A | 114 | Double-stranded RNA-specific editase ADAR; DSRBD, | 1e-08 | |
| 2dmy_A | 97 | Spermatid perinuclear RNA-binding protein; DSRM do | 2e-08 | |
| 1x47_A | 98 | DGCR8 protein; structural genomics, DSRM domain, N | 3e-08 | |
| 1x47_A | 98 | DGCR8 protein; structural genomics, DSRM domain, N | 6e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-07 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-05 | |
| 2l3j_A | 236 | Double-stranded RNA-specific editase 1; editing, d | 6e-06 | |
| 2l3j_A | 236 | Double-stranded RNA-specific editase 1; editing, d | 3e-05 |
| >3c4b_A Endoribonuclease dicer; RNAse, dsRNA binding protein, ATP-binding, endonuclease, HEL hydrolase, nucleotide-binding, phosphoprotein, RN binding; HET: MSE; 1.68A {Mus musculus} PDB: 3c4t_A 2eb1_A Length = 265 | Back alignment and structure |
|---|
Score = 215 bits (548), Expect = 3e-68
Identities = 69/255 (27%), Positives = 116/255 (45%), Gaps = 21/255 (8%)
Query: 31 EMEDAVFYVENIINYNFKNKRLLEEALTHSSYTDST---SYQRLEFIGDAALGLALSNYV 87
+ E INY FKNK L +A TH+SY +T YQRLEF+GDA L ++ ++
Sbjct: 10 HLISGFETFEKKINYRFKNKAYLLQAFTHASYHYNTITDCYQRLEFLGDAILDYLITKHL 69
Query: 88 FLAYPQLDPGQLSLLRAANISTEKLARVAVKHGFYKFVRHSAAALDDKVKEFAEAVSQED 147
+ Q PG L+ LR+A ++ A +AVK+ ++K+ + + L + +F + +++
Sbjct: 70 YEDPRQHSPGVLTDLRSALVNNTIFASLAVKYDYHKYFKAVSPELFHVIDDFVKFQLEKN 129
Query: 148 NTAVYG-------------GSIKAPKVLADIVESIAAAIYVDIDFDLQKLWMIFRGLLEP 194
I+ PK + DI ES+A AIY+D L+ +W ++ +++P
Sbjct: 130 EMQGMDSELRRSEEDEEKEEDIEVPKAMGDIFESLAGAIYMDSGMSLEVVWQVYYPMMQP 189
Query: 195 IVTLEELQQQPQPVTLLFKLCQKNGKQVDIKHW--RKNRKNIASVYVDGSFVASASSEQK 252
++ P + + +L + + + K +V V G
Sbjct: 190 LIEKFSAN---VPRSPVRELLEMEPETAKFSPAERTYDGKVRVTVEVVGKGKFKGVGRSY 246
Query: 253 EIAKLNAAREALEKL 267
IAK AAR AL L
Sbjct: 247 RIAKSAAARRALRSL 261
|
| >3c4b_A Endoribonuclease dicer; RNAse, dsRNA binding protein, ATP-binding, endonuclease, HEL hydrolase, nucleotide-binding, phosphoprotein, RN binding; HET: MSE; 1.68A {Mus musculus} PDB: 3c4t_A 2eb1_A Length = 265 | Back alignment and structure |
|---|
| >3n3w_A Ribonuclease III; nuclease domain, ribonuclase III, IDP90862, csgid, structura genomics; 2.21A {Campylobacter jejuni subsp} Length = 248 | Back alignment and structure |
|---|
| >3n3w_A Ribonuclease III; nuclease domain, ribonuclase III, IDP90862, csgid, structura genomics; 2.21A {Campylobacter jejuni subsp} Length = 248 | Back alignment and structure |
|---|
| >2nug_A Ribonuclease III, RNAse III; dsRNA, RNA interference, endonucleolytic cleavage, hydrolase/RNA complex; 1.70A {Aquifex aeolicus} SCOP: a.149.1.1 d.50.1.1 PDB: 1yyw_A 2nue_A 2nuf_A 1yyk_A 1yz9_A 1yyo_A 2ez6_A 1rc7_A 1i4s_A 1jfz_A 1rc5_A Length = 221 | Back alignment and structure |
|---|
| >2nug_A Ribonuclease III, RNAse III; dsRNA, RNA interference, endonucleolytic cleavage, hydrolase/RNA complex; 1.70A {Aquifex aeolicus} SCOP: a.149.1.1 d.50.1.1 PDB: 1yyw_A 2nue_A 2nuf_A 1yyk_A 1yz9_A 1yyo_A 2ez6_A 1rc7_A 1i4s_A 1jfz_A 1rc5_A Length = 221 | Back alignment and structure |
|---|
| >1o0w_A Ribonuclease III, RNAse III; TM1102, structural genomics, JCSG, PSI, protein structure initiative, joint center for structural genomics; 2.00A {Thermotoga maritima} SCOP: a.149.1.1 d.50.1.1 Length = 252 | Back alignment and structure |
|---|
| >1o0w_A Ribonuclease III, RNAse III; TM1102, structural genomics, JCSG, PSI, protein structure initiative, joint center for structural genomics; 2.00A {Thermotoga maritima} SCOP: a.149.1.1 d.50.1.1 Length = 252 | Back alignment and structure |
|---|
| >3o2r_A Ribonuclease III; structural genomics, center for structural genomics of infec diseases, csgid, nuclease domain, ribonuclase III; HET: MLZ; 1.25A {Campylobacter jejuni subsp} PDB: 3o2r_B* Length = 170 | Back alignment and structure |
|---|
| >2a11_A Ribonuclease III, RNAse III; nuclease domain, structural genomic protein structure initiative; 2.10A {Mycobacterium tuberculosis} Length = 242 | Back alignment and structure |
|---|
| >2a11_A Ribonuclease III, RNAse III; nuclease domain, structural genomic protein structure initiative; 2.10A {Mycobacterium tuberculosis} Length = 242 | Back alignment and structure |
|---|
| >3rv0_A K. polysporus DCR1; RNAse III enzyme, RNA binding protein; 2.29A {Vanderwaltozyma polyspora} Length = 341 | Back alignment and structure |
|---|
| >3rv0_A K. polysporus DCR1; RNAse III enzyme, RNA binding protein; 2.29A {Vanderwaltozyma polyspora} Length = 341 | Back alignment and structure |
|---|
| >3rv1_A K. polysporus DCR1; RNAse III enzyme, RNA binding protein; 1.98A {Vanderwaltozyma polyspora} Length = 246 | Back alignment and structure |
|---|
| >2qvw_A GLP_546_48378_50642; dicer, RNAI,pseudo-merohedral twin, hydrolase; 3.00A {Giardia intestinalis} PDB: 2ffl_A Length = 756 | Back alignment and structure |
|---|
| >2qvw_A GLP_546_48378_50642; dicer, RNAI,pseudo-merohedral twin, hydrolase; 3.00A {Giardia intestinalis} PDB: 2ffl_A Length = 756 | Back alignment and structure |
|---|
| >2qvw_A GLP_546_48378_50642; dicer, RNAI,pseudo-merohedral twin, hydrolase; 3.00A {Giardia intestinalis} PDB: 2ffl_A Length = 756 | Back alignment and structure |
|---|
| >1qu6_A Protein kinase PKR; dsRNA-binding domain, solution structure, transferase; NMR {Homo sapiens} SCOP: d.50.1.1 d.50.1.1 Length = 179 | Back alignment and structure |
|---|
| >1qu6_A Protein kinase PKR; dsRNA-binding domain, solution structure, transferase; NMR {Homo sapiens} SCOP: d.50.1.1 d.50.1.1 Length = 179 | Back alignment and structure |
|---|
| >2yt4_A Protein DGCR8; DSRBD, RNA binding domain, RNA binding protein; 2.60A {Homo sapiens} Length = 232 | Back alignment and structure |
|---|
| >3adj_A F21M12.9 protein; HYL1, miRNA processing, RNA binding protein, gene regulation; 3.00A {Arabidopsis thaliana} PDB: 2l2m_A Length = 76 | Back alignment and structure |
|---|
| >3adl_A RISC-loading complex subunit tarbp2; TRBP2, miRNA processing, gene regulation-RNA complex; 2.20A {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >3adg_A F21M12.9 protein; HYL1, miRNA processing mechanism, RNA binding protein, gene regulation; 1.70A {Arabidopsis thaliana} PDB: 3adi_A Length = 73 | Back alignment and structure |
|---|
| >1di2_A XLRBPA, double stranded RNA binding protein A; protein-RNA complex, protein-RNA interactions, RNA-bining protein; 1.90A {Xenopus laevis} SCOP: d.50.1.1 Length = 69 | Back alignment and structure |
|---|
| >2cpn_A TAR RNA-binding protein 2; double-stranded RNA binding domain, DSRBD, DSRM., structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.50.1.1 Length = 89 | Back alignment and structure |
|---|
| >1whn_A Hypothetical protein riken cDNA 2310016K04; double-stranded RNA binding domain, DSRBD, DSRM, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.50.1.1 Length = 128 | Back alignment and structure |
|---|
| >2l2n_A Hyponastic leave 1; DSRBD, miRNA, RNA binding protein, plant protein; NMR {Arabidopsis thaliana} Length = 103 | Back alignment and structure |
|---|
| >3llh_A RISC-loading complex subunit tarbp2; DSRBD, DSRM, microrna, RNA binding protein; 2.14A {Homo sapiens} Length = 90 | Back alignment and structure |
|---|
| >1x49_A Interferon-induced, double-stranded RNA- activated protein kinase; structure genomics, DSRM domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.50.1.1 Length = 97 | Back alignment and structure |
|---|
| >1ekz_A DSRBDIII, maternal effect protein (staufen); structure, protein/RNA, protein DSRBD, RNA hairpin; NMR {Drosophila melanogaster} SCOP: d.50.1.1 PDB: 1stu_A Length = 76 | Back alignment and structure |
|---|
| >2dix_A Interferon-inducible double stranded RNA- dependent protein kinase activator A; structure genomics, DSRM domain, hypothetical protein PRKRA; NMR {Homo sapiens} SCOP: d.50.1.1 Length = 84 | Back alignment and structure |
|---|
| >1uhz_A Staufen (RNA binding protein) homolog 2; DSRM, staufen homolog 2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.50.1.1 Length = 89 | Back alignment and structure |
|---|
| >1whq_A RNA helicase A; double-stranded RNA binding domain, DSRBD, DSRM, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Mus musculus} SCOP: d.50.1.1 PDB: 2rs6_A Length = 99 | Back alignment and structure |
|---|
| >2b7v_A Double-stranded RNA-specific editase 1; RNA editing, RNA-binding protein, hydrolase; NMR {Rattus norvegicus} SCOP: d.50.1.1 PDB: 2l2k_B Length = 71 | Back alignment and structure |
|---|
| >2b7v_A Double-stranded RNA-specific editase 1; RNA editing, RNA-binding protein, hydrolase; NMR {Rattus norvegicus} SCOP: d.50.1.1 PDB: 2l2k_B Length = 71 | Back alignment and structure |
|---|
| >1uil_A Double-stranded RNA-binding motif; structural genomics, DSRM, riken structural genomics/proteomics initiative, RSGI RNA binding protein; NMR {Mus musculus} SCOP: d.50.1.1 PDB: 2rs7_A Length = 113 | Back alignment and structure |
|---|
| >2khx_A Ribonuclease 3; drosha, RNA binding domain, hydrolase, gene regulation, NUCL protein, gene regulation,nuclear protein; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >2l33_A Interleukin enhancer-binding factor 3; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, DRBM; NMR {Homo sapiens} Length = 91 | Back alignment and structure |
|---|
| >2l33_A Interleukin enhancer-binding factor 3; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, DRBM; NMR {Homo sapiens} Length = 91 | Back alignment and structure |
|---|
| >3p1x_A Interleukin enhancer-binding factor 3; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.90A {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >3p1x_A Interleukin enhancer-binding factor 3; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.90A {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >2b7t_A Double-stranded RNA-specific editase 1; RNA editing, RNA-binding protein, hydrolase; NMR {Rattus norvegicus} SCOP: d.50.1.1 PDB: 2l3c_A Length = 73 | Back alignment and structure |
|---|
| >2ljh_A Double-stranded RNA-specific editase ADAR; DSRBD, DSRBM, editing, hydrolase; NMR {Drosophila melanogaster} Length = 114 | Back alignment and structure |
|---|
| >2dmy_A Spermatid perinuclear RNA-binding protein; DSRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.50.1.1 Length = 97 | Back alignment and structure |
|---|
| >1x47_A DGCR8 protein; structural genomics, DSRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.50.1.1 Length = 98 | Back alignment and structure |
|---|
| >1x47_A DGCR8 protein; structural genomics, DSRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.50.1.1 Length = 98 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2l3j_A Double-stranded RNA-specific editase 1; editing, dsRNA recognition, DSRBM, hydrolase-RNA complex; NMR {Rattus norvegicus} Length = 236 | Back alignment and structure |
|---|
| >2l3j_A Double-stranded RNA-specific editase 1; editing, dsRNA recognition, DSRBM, hydrolase-RNA complex; NMR {Rattus norvegicus} Length = 236 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 370 | |||
| 2nug_A | 221 | Ribonuclease III, RNAse III; dsRNA, RNA interferen | 100.0 | |
| 3n3w_A | 248 | Ribonuclease III; nuclease domain, ribonuclase III | 100.0 | |
| 1o0w_A | 252 | Ribonuclease III, RNAse III; TM1102, structural ge | 100.0 | |
| 3c4b_A | 265 | Endoribonuclease dicer; RNAse, dsRNA binding prote | 100.0 | |
| 2a11_A | 242 | Ribonuclease III, RNAse III; nuclease domain, stru | 100.0 | |
| 3rv0_A | 341 | K. polysporus DCR1; RNAse III enzyme, RNA binding | 100.0 | |
| 3o2r_A | 170 | Ribonuclease III; structural genomics, center for | 100.0 | |
| 3rv1_A | 246 | K. polysporus DCR1; RNAse III enzyme, RNA binding | 100.0 | |
| 1qu6_A | 179 | Protein kinase PKR; dsRNA-binding domain, solution | 99.96 | |
| 2qvw_A | 756 | GLP_546_48378_50642; dicer, RNAI,pseudo-merohedral | 99.95 | |
| 2yt4_A | 232 | Protein DGCR8; DSRBD, RNA binding domain, RNA bind | 99.95 | |
| 2qvw_A | 756 | GLP_546_48378_50642; dicer, RNAI,pseudo-merohedral | 99.94 | |
| 2l3j_A | 236 | Double-stranded RNA-specific editase 1; editing, d | 99.9 | |
| 3adj_A | 76 | F21M12.9 protein; HYL1, miRNA processing, RNA bind | 99.82 | |
| 1u61_A | 138 | Hypothetical protein; structural genomics, PSI, pr | 99.82 | |
| 3adg_A | 73 | F21M12.9 protein; HYL1, miRNA processing mechanism | 99.8 | |
| 1di2_A | 69 | XLRBPA, double stranded RNA binding protein A; pro | 99.8 | |
| 2cpn_A | 89 | TAR RNA-binding protein 2; double-stranded RNA bin | 99.8 | |
| 3adl_A | 88 | RISC-loading complex subunit tarbp2; TRBP2, miRNA | 99.79 | |
| 1ekz_A | 76 | DSRBDIII, maternal effect protein (staufen); struc | 99.78 | |
| 1uhz_A | 89 | Staufen (RNA binding protein) homolog 2; DSRM, sta | 99.78 | |
| 2dix_A | 84 | Interferon-inducible double stranded RNA- dependen | 99.77 | |
| 3llh_A | 90 | RISC-loading complex subunit tarbp2; DSRBD, DSRM, | 99.77 | |
| 2khx_A | 85 | Ribonuclease 3; drosha, RNA binding domain, hydrol | 99.77 | |
| 2l2n_A | 103 | Hyponastic leave 1; DSRBD, miRNA, RNA binding prot | 99.75 | |
| 2gsl_A | 137 | Hypothetical protein; alpha-helical protein, struc | 99.75 | |
| 1x49_A | 97 | Interferon-induced, double-stranded RNA- activated | 99.74 | |
| 1whq_A | 99 | RNA helicase A; double-stranded RNA binding domain | 99.74 | |
| 1uil_A | 113 | Double-stranded RNA-binding motif; structural geno | 99.73 | |
| 2b7t_A | 73 | Double-stranded RNA-specific editase 1; RNA editin | 99.73 | |
| 1t4n_A | 94 | Ribonuclease III; DSRBD, RNA-binding, hydrolase; N | 99.71 | |
| 1x48_A | 88 | Interferon-induced, double-stranded RNA- activated | 99.69 | |
| 2dmy_A | 97 | Spermatid perinuclear RNA-binding protein; DSRM do | 99.69 | |
| 1x47_A | 98 | DGCR8 protein; structural genomics, DSRM domain, N | 99.69 | |
| 2l33_A | 91 | Interleukin enhancer-binding factor 3; structural | 99.68 | |
| 1t4o_A | 117 | Ribonuclease III; RNT1P, DSRBD, RNA-binding, hydro | 99.67 | |
| 2ljh_A | 114 | Double-stranded RNA-specific editase ADAR; DSRBD, | 99.66 | |
| 1whn_A | 128 | Hypothetical protein riken cDNA 2310016K04; double | 99.64 | |
| 2b7v_A | 71 | Double-stranded RNA-specific editase 1; RNA editin | 99.64 | |
| 1qu6_A | 179 | Protein kinase PKR; dsRNA-binding domain, solution | 99.58 | |
| 3adl_A | 88 | RISC-loading complex subunit tarbp2; TRBP2, miRNA | 99.57 | |
| 3adj_A | 76 | F21M12.9 protein; HYL1, miRNA processing, RNA bind | 99.55 | |
| 3p1x_A | 75 | Interleukin enhancer-binding factor 3; structural | 99.55 | |
| 1di2_A | 69 | XLRBPA, double stranded RNA binding protein A; pro | 99.55 | |
| 3adg_A | 73 | F21M12.9 protein; HYL1, miRNA processing mechanism | 99.54 | |
| 3llh_A | 90 | RISC-loading complex subunit tarbp2; DSRBD, DSRM, | 99.54 | |
| 2dix_A | 84 | Interferon-inducible double stranded RNA- dependen | 99.53 | |
| 1x48_A | 88 | Interferon-induced, double-stranded RNA- activated | 99.53 | |
| 2cpn_A | 89 | TAR RNA-binding protein 2; double-stranded RNA bin | 99.52 | |
| 1x49_A | 97 | Interferon-induced, double-stranded RNA- activated | 99.52 | |
| 1uhz_A | 89 | Staufen (RNA binding protein) homolog 2; DSRM, sta | 99.51 | |
| 1ekz_A | 76 | DSRBDIII, maternal effect protein (staufen); struc | 99.5 | |
| 2khx_A | 85 | Ribonuclease 3; drosha, RNA binding domain, hydrol | 99.48 | |
| 1x47_A | 98 | DGCR8 protein; structural genomics, DSRM domain, N | 99.47 | |
| 2yt4_A | 232 | Protein DGCR8; DSRBD, RNA binding domain, RNA bind | 99.47 | |
| 1t4n_A | 94 | Ribonuclease III; DSRBD, RNA-binding, hydrolase; N | 99.45 | |
| 1whq_A | 99 | RNA helicase A; double-stranded RNA binding domain | 99.45 | |
| 2b7t_A | 73 | Double-stranded RNA-specific editase 1; RNA editin | 99.45 | |
| 2l2n_A | 103 | Hyponastic leave 1; DSRBD, miRNA, RNA binding prot | 99.44 | |
| 2l33_A | 91 | Interleukin enhancer-binding factor 3; structural | 99.41 | |
| 1whn_A | 128 | Hypothetical protein riken cDNA 2310016K04; double | 99.41 | |
| 1uil_A | 113 | Double-stranded RNA-binding motif; structural geno | 99.4 | |
| 1t4o_A | 117 | Ribonuclease III; RNT1P, DSRBD, RNA-binding, hydro | 99.39 | |
| 2dmy_A | 97 | Spermatid perinuclear RNA-binding protein; DSRM do | 99.38 | |
| 2ljh_A | 114 | Double-stranded RNA-specific editase ADAR; DSRBD, | 99.33 | |
| 2b7v_A | 71 | Double-stranded RNA-specific editase 1; RNA editin | 99.28 | |
| 2l3j_A | 236 | Double-stranded RNA-specific editase 1; editing, d | 99.2 | |
| 3p1x_A | 75 | Interleukin enhancer-binding factor 3; structural | 99.18 | |
| 1o0w_A | 252 | Ribonuclease III, RNAse III; TM1102, structural ge | 99.16 | |
| 2nug_A | 221 | Ribonuclease III, RNAse III; dsRNA, RNA interferen | 99.16 | |
| 3rv0_A | 341 | K. polysporus DCR1; RNAse III enzyme, RNA binding | 98.99 | |
| 3n3w_A | 248 | Ribonuclease III; nuclease domain, ribonuclase III | 98.97 | |
| 2a11_A | 242 | Ribonuclease III, RNAse III; nuclease domain, stru | 98.91 | |
| 3c4b_A | 265 | Endoribonuclease dicer; RNAse, dsRNA binding prote | 98.64 | |
| 2kou_A | 102 | Dicer-like protein 4; ATP-binding, endonuclease, h | 97.29 | |
| 2kou_A | 102 | Dicer-like protein 4; ATP-binding, endonuclease, h | 95.52 | |
| 2db2_A | 119 | KIAA0890 protein; DSRM domain, structural genomics | 94.58 | |
| 2db2_A | 119 | KIAA0890 protein; DSRM domain, structural genomics | 92.83 | |
| 3htx_A | 950 | HEN1; HEN1, small RNA methyltransferase, protein-R | 91.01 | |
| 3htx_A | 950 | HEN1; HEN1, small RNA methyltransferase, protein-R | 89.92 | |
| 1ztd_A | 133 | Hypothetical protein PFU-631545-001; structural ge | 83.27 |
| >2nug_A Ribonuclease III, RNAse III; dsRNA, RNA interference, endonucleolytic cleavage, hydrolase/RNA complex; 1.70A {Aquifex aeolicus} SCOP: a.149.1.1 d.50.1.1 PDB: 1yyw_A 2nue_A 2nuf_A 1yyk_A 1yz9_A 1yyo_A 2ez6_A 1rc7_A 1i4s_A 1jfz_A 1rc5_A | Back alignment and structure |
|---|
Probab=100.00 E-value=1.5e-50 Score=364.89 Aligned_cols=217 Identities=32% Similarity=0.446 Sum_probs=194.0
Q ss_pred HHHHHHHHcCcccCChhHHHHHhcCCCCCCCCCcchhhhhhHHHHHHHHHHHHHHHCCCCCcchhhHHHHHhcChHHHHH
Q 017515 35 AVFYVENIINYNFKNKRLLEEALTHSSYTDSTSYQRLEFIGDAALGLALSNYVFLAYPQLDPGQLSLLRAANISTEKLAR 114 (370)
Q Consensus 35 ~~~~le~~lgy~f~~~~Ll~~AlTh~s~~~~~~~erLe~LGdavL~~~v~~~l~~~~p~~~~~~l~~lr~~lvsn~~La~ 114 (370)
.+..|+++|||+|+|++||.+||||+|+....+|||||||||+||++++++|||.+||+.++|.|+.+|+.+||+.+|+.
T Consensus 3 ~~~~l~~~lg~~f~~~~ll~~AlTh~S~~~~~~nerLefLGDavL~~~v~~~L~~~~p~~~~g~Ls~~r~~lV~~~~la~ 82 (221)
T 2nug_A 3 MLEQLEKKLGYTFKDKSLLEKALTHVSYSKKEHYETLEFLGDALVNFFIVDLLVQYSPNKREGFLSPLKAYLISEEFFNL 82 (221)
T ss_dssp CHHHHHHHHTCCCSSHHHHHHHHBCTTTCSSSCSHHHHHHHHHHHHHHHHHHHHHTCTTCCHHHHHHHHHHHTSHHHHHH
T ss_pred HHHHHHHHhCCCcCCHHHHHHHhCCCCCCCCCCchHHHHHHHHHHHHHHHHHHHHhCCCCCHHHHHHHHHHHHCHHHHHH
Confidence 35789999999999999999999999998767999999999999999999999999999999999999999999999999
Q ss_pred HHHHcChhHHHhhccchhhHHHHHHHHHhhccccccccCCCcCCchHHHHHHHHHHHHHhhcCCcChHHHHHHHHHhhhh
Q 017515 115 VAVKHGFYKFVRHSAAALDDKVKEFAEAVSQEDNTAVYGGSIKAPKVLADIVESIAAAIYVDIDFDLQKLWMIFRGLLEP 194 (370)
Q Consensus 115 ~a~~~gL~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~k~lad~feAliGAIyld~g~~~~~~~~v~~~ll~~ 194 (370)
+|.++||++|++.++.. ..+++++|+|||+|||||+|+|++.+.+++|+..++.|
T Consensus 83 ~a~~l~l~~~l~~~~~~-------------------------~~~~~lad~~EAliGAiyld~g~~~~~~~~~i~~~~~~ 137 (221)
T 2nug_A 83 LAQKLELHKFIRIKRGK-------------------------INETIIGDVFEALWAAVYIDSGRDANFTRELFYKLFKE 137 (221)
T ss_dssp HHHTTTGGGTCBSCTTC-------------------------CCHHHHHHHHHHHHHHHHHHTTSCHHHHHHHHHHHHHH
T ss_pred HHHHcChHHhhccCCCc-------------------------ccchHHHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHH
Confidence 99999999999887432 12899999999999999999999985566889988887
Q ss_pred hhh-hhhhccCCchHHHHHHHHHhcCCceeEEEeecCCeEEEEEEECCeeEEEEeccCHHHHHHHHHHHHHHHhhhcCCC
Q 017515 195 IVT-LEELQQQPQPVTLLFKLCQKNGKQVDIKHWRKNRKNIASVYVDGSFVASASSEQKEIAKLNAAREALEKLAQSMPV 273 (370)
Q Consensus 195 ~i~-~~~~~~~~~p~~~L~e~~~k~~~~~~y~~~~~~~~f~~~v~v~g~~~~~g~g~skk~Ak~~AA~~AL~~L~~~~~~ 273 (370)
.++ .....
T Consensus 138 ~~~~~~~~~----------------------------------------------------------------------- 146 (221)
T 2nug_A 138 DILSAIKEG----------------------------------------------------------------------- 146 (221)
T ss_dssp HHHHHHHTT-----------------------------------------------------------------------
T ss_pred HHhhhhhcc-----------------------------------------------------------------------
Confidence 765 32110
Q ss_pred cccccccccCCchhhhhhhHHHHHHHHHHhcCCCCCceEEecccCCCCCcceEEEEEEEecCCeEEEeecCCCchhHHHH
Q 017515 274 NCDVCEIFDDIDEKFEIEAAKQKLHELCGKKKWPKPSYKIEKDEGPSHDKKFMSAVQIATTDGVLFITGDEKSRVKDAEN 353 (370)
Q Consensus 274 ~~~~~~~~~~~~~~~~~~~~ks~L~e~~~k~~~~~P~y~~~~~~g~~~~~~f~~~v~v~~~~~~~~~~g~g~skkk~A~~ 353 (370)
....|||+.||||||++++..|.|.++.++||+|.+.|+|+|.| +|. ++.|.|+|| |+|||
T Consensus 147 --------------~~~~~pks~LqE~~q~~~~~~p~Y~~~~~~G~~h~~~F~v~v~v---~~~-~~~G~G~sk-K~Ae~ 207 (221)
T 2nug_A 147 --------------RVKKDYKTILQEITQKRWKERPEYRLISVEGPHHKKKFIVEAKI---KEY-RTLGEGKSK-KEAEQ 207 (221)
T ss_dssp --------------CSCCCHHHHHHHHHHHHHSCCCEEEEEEEESCGGGCEEEEEEEE---TTE-EEEEEESSH-HHHHH
T ss_pred --------------ccccCHHHHHHHHHHHcCCCCceEEEEEeeCCCCCceEEEEEEE---CCE-EEEEecCCH-HHHHH
Confidence 01348999999999999999999999989999999999999999 688 999999999 99999
Q ss_pred HHHHHHHHHHhhc
Q 017515 354 SAASMMLRALRES 366 (370)
Q Consensus 354 ~AA~~~l~~l~~~ 366 (370)
.||+.||..|+++
T Consensus 208 ~AA~~AL~~L~~~ 220 (221)
T 2nug_A 208 RAAEELIKLLEES 220 (221)
T ss_dssp HHHHHHHHHHC--
T ss_pred HHHHHHHHHhhcc
Confidence 9999999999754
|
| >3n3w_A Ribonuclease III; nuclease domain, ribonuclase III, IDP90862, csgid, structura genomics; 2.21A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >1o0w_A Ribonuclease III, RNAse III; TM1102, structural genomics, JCSG, PSI, protein structure initiative, joint center for structural genomics; 2.00A {Thermotoga maritima} SCOP: a.149.1.1 d.50.1.1 | Back alignment and structure |
|---|
| >3c4b_A Endoribonuclease dicer; RNAse, dsRNA binding protein, ATP-binding, endonuclease, HEL hydrolase, nucleotide-binding, phosphoprotein, RN binding; HET: MSE; 1.68A {Mus musculus} PDB: 3c4t_A 2eb1_A | Back alignment and structure |
|---|
| >2a11_A Ribonuclease III, RNAse III; nuclease domain, structural genomic protein structure initiative; 2.10A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3rv0_A K. polysporus DCR1; RNAse III enzyme, RNA binding protein; 2.29A {Vanderwaltozyma polyspora} | Back alignment and structure |
|---|
| >3o2r_A Ribonuclease III; structural genomics, center for structural genomics of infec diseases, csgid, nuclease domain, ribonuclase III; HET: MLZ; 1.25A {Campylobacter jejuni subsp} PDB: 3o2r_B* | Back alignment and structure |
|---|
| >3rv1_A K. polysporus DCR1; RNAse III enzyme, RNA binding protein; 1.98A {Vanderwaltozyma polyspora} | Back alignment and structure |
|---|
| >1qu6_A Protein kinase PKR; dsRNA-binding domain, solution structure, transferase; NMR {Homo sapiens} SCOP: d.50.1.1 d.50.1.1 | Back alignment and structure |
|---|
| >2qvw_A GLP_546_48378_50642; dicer, RNAI,pseudo-merohedral twin, hydrolase; 3.00A {Giardia intestinalis} PDB: 2ffl_A | Back alignment and structure |
|---|
| >2yt4_A Protein DGCR8; DSRBD, RNA binding domain, RNA binding protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2qvw_A GLP_546_48378_50642; dicer, RNAI,pseudo-merohedral twin, hydrolase; 3.00A {Giardia intestinalis} PDB: 2ffl_A | Back alignment and structure |
|---|
| >2l3j_A Double-stranded RNA-specific editase 1; editing, dsRNA recognition, DSRBM, hydrolase-RNA complex; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >3adj_A F21M12.9 protein; HYL1, miRNA processing, RNA binding protein, gene regulation; 3.00A {Arabidopsis thaliana} PDB: 2l2m_A | Back alignment and structure |
|---|
| >1u61_A Hypothetical protein; structural genomics, PSI, protein STRU initiative, midwest center for structural genomics, MCSG, U function; 2.15A {Bacillus cereus} SCOP: a.149.1.1 | Back alignment and structure |
|---|
| >3adg_A F21M12.9 protein; HYL1, miRNA processing mechanism, RNA binding protein, gene regulation; 1.70A {Arabidopsis thaliana} PDB: 3adi_A | Back alignment and structure |
|---|
| >1di2_A XLRBPA, double stranded RNA binding protein A; protein-RNA complex, protein-RNA interactions, RNA-bining protein; 1.90A {Xenopus laevis} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >2cpn_A TAR RNA-binding protein 2; double-stranded RNA binding domain, DSRBD, DSRM., structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >3adl_A RISC-loading complex subunit tarbp2; TRBP2, miRNA processing, gene regulation-RNA complex; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1ekz_A DSRBDIII, maternal effect protein (staufen); structure, protein/RNA, protein DSRBD, RNA hairpin; NMR {Drosophila melanogaster} SCOP: d.50.1.1 PDB: 1stu_A | Back alignment and structure |
|---|
| >1uhz_A Staufen (RNA binding protein) homolog 2; DSRM, staufen homolog 2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >2dix_A Interferon-inducible double stranded RNA- dependent protein kinase activator A; structure genomics, DSRM domain, hypothetical protein PRKRA; NMR {Homo sapiens} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >3llh_A RISC-loading complex subunit tarbp2; DSRBD, DSRM, microrna, RNA binding protein; 2.14A {Homo sapiens} | Back alignment and structure |
|---|
| >2khx_A Ribonuclease 3; drosha, RNA binding domain, hydrolase, gene regulation, NUCL protein, gene regulation,nuclear protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l2n_A Hyponastic leave 1; DSRBD, miRNA, RNA binding protein, plant protein; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2gsl_A Hypothetical protein; alpha-helical protein, structural genomics, PSI, protein STR initiative; 2.60A {Fusobacterium nucleatum subsp} | Back alignment and structure |
|---|
| >1x49_A Interferon-induced, double-stranded RNA- activated protein kinase; structure genomics, DSRM domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >1whq_A RNA helicase A; double-stranded RNA binding domain, DSRBD, DSRM, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Mus musculus} SCOP: d.50.1.1 PDB: 2rs6_A | Back alignment and structure |
|---|
| >1uil_A Double-stranded RNA-binding motif; structural genomics, DSRM, riken structural genomics/proteomics initiative, RSGI RNA binding protein; NMR {Mus musculus} SCOP: d.50.1.1 PDB: 2rs7_A | Back alignment and structure |
|---|
| >2b7t_A Double-stranded RNA-specific editase 1; RNA editing, RNA-binding protein, hydrolase; NMR {Rattus norvegicus} SCOP: d.50.1.1 PDB: 2l3c_A | Back alignment and structure |
|---|
| >1t4n_A Ribonuclease III; DSRBD, RNA-binding, hydrolase; NMR {Saccharomyces cerevisiae} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >1x48_A Interferon-induced, double-stranded RNA- activated protein kinase; structure genomics, DSRM domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >2dmy_A Spermatid perinuclear RNA-binding protein; DSRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >1x47_A DGCR8 protein; structural genomics, DSRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >2l33_A Interleukin enhancer-binding factor 3; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, DRBM; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1t4o_A Ribonuclease III; RNT1P, DSRBD, RNA-binding, hydrolase; 2.50A {Saccharomyces cerevisiae} SCOP: d.50.1.1 PDB: 1t4l_B 2lbs_B | Back alignment and structure |
|---|
| >2ljh_A Double-stranded RNA-specific editase ADAR; DSRBD, DSRBM, editing, hydrolase; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1whn_A Hypothetical protein riken cDNA 2310016K04; double-stranded RNA binding domain, DSRBD, DSRM, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >2b7v_A Double-stranded RNA-specific editase 1; RNA editing, RNA-binding protein, hydrolase; NMR {Rattus norvegicus} SCOP: d.50.1.1 PDB: 2l2k_B | Back alignment and structure |
|---|
| >1qu6_A Protein kinase PKR; dsRNA-binding domain, solution structure, transferase; NMR {Homo sapiens} SCOP: d.50.1.1 d.50.1.1 | Back alignment and structure |
|---|
| >3adl_A RISC-loading complex subunit tarbp2; TRBP2, miRNA processing, gene regulation-RNA complex; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3adj_A F21M12.9 protein; HYL1, miRNA processing, RNA binding protein, gene regulation; 3.00A {Arabidopsis thaliana} PDB: 2l2m_A | Back alignment and structure |
|---|
| >3p1x_A Interleukin enhancer-binding factor 3; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1di2_A XLRBPA, double stranded RNA binding protein A; protein-RNA complex, protein-RNA interactions, RNA-bining protein; 1.90A {Xenopus laevis} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >3adg_A F21M12.9 protein; HYL1, miRNA processing mechanism, RNA binding protein, gene regulation; 1.70A {Arabidopsis thaliana} PDB: 3adi_A | Back alignment and structure |
|---|
| >3llh_A RISC-loading complex subunit tarbp2; DSRBD, DSRM, microrna, RNA binding protein; 2.14A {Homo sapiens} | Back alignment and structure |
|---|
| >2dix_A Interferon-inducible double stranded RNA- dependent protein kinase activator A; structure genomics, DSRM domain, hypothetical protein PRKRA; NMR {Homo sapiens} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >1x48_A Interferon-induced, double-stranded RNA- activated protein kinase; structure genomics, DSRM domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >2cpn_A TAR RNA-binding protein 2; double-stranded RNA binding domain, DSRBD, DSRM., structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >1x49_A Interferon-induced, double-stranded RNA- activated protein kinase; structure genomics, DSRM domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >1uhz_A Staufen (RNA binding protein) homolog 2; DSRM, staufen homolog 2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >1ekz_A DSRBDIII, maternal effect protein (staufen); structure, protein/RNA, protein DSRBD, RNA hairpin; NMR {Drosophila melanogaster} SCOP: d.50.1.1 PDB: 1stu_A | Back alignment and structure |
|---|
| >2khx_A Ribonuclease 3; drosha, RNA binding domain, hydrolase, gene regulation, NUCL protein, gene regulation,nuclear protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x47_A DGCR8 protein; structural genomics, DSRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >2yt4_A Protein DGCR8; DSRBD, RNA binding domain, RNA binding protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1t4n_A Ribonuclease III; DSRBD, RNA-binding, hydrolase; NMR {Saccharomyces cerevisiae} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >1whq_A RNA helicase A; double-stranded RNA binding domain, DSRBD, DSRM, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Mus musculus} SCOP: d.50.1.1 PDB: 2rs6_A | Back alignment and structure |
|---|
| >2b7t_A Double-stranded RNA-specific editase 1; RNA editing, RNA-binding protein, hydrolase; NMR {Rattus norvegicus} SCOP: d.50.1.1 PDB: 2l3c_A | Back alignment and structure |
|---|
| >2l2n_A Hyponastic leave 1; DSRBD, miRNA, RNA binding protein, plant protein; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2l33_A Interleukin enhancer-binding factor 3; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, DRBM; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1whn_A Hypothetical protein riken cDNA 2310016K04; double-stranded RNA binding domain, DSRBD, DSRM, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >1uil_A Double-stranded RNA-binding motif; structural genomics, DSRM, riken structural genomics/proteomics initiative, RSGI RNA binding protein; NMR {Mus musculus} SCOP: d.50.1.1 PDB: 2rs7_A | Back alignment and structure |
|---|
| >1t4o_A Ribonuclease III; RNT1P, DSRBD, RNA-binding, hydrolase; 2.50A {Saccharomyces cerevisiae} SCOP: d.50.1.1 PDB: 1t4l_B 2lbs_B | Back alignment and structure |
|---|
| >2dmy_A Spermatid perinuclear RNA-binding protein; DSRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >2ljh_A Double-stranded RNA-specific editase ADAR; DSRBD, DSRBM, editing, hydrolase; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2b7v_A Double-stranded RNA-specific editase 1; RNA editing, RNA-binding protein, hydrolase; NMR {Rattus norvegicus} SCOP: d.50.1.1 PDB: 2l2k_B | Back alignment and structure |
|---|
| >2l3j_A Double-stranded RNA-specific editase 1; editing, dsRNA recognition, DSRBM, hydrolase-RNA complex; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >3p1x_A Interleukin enhancer-binding factor 3; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1o0w_A Ribonuclease III, RNAse III; TM1102, structural genomics, JCSG, PSI, protein structure initiative, joint center for structural genomics; 2.00A {Thermotoga maritima} SCOP: a.149.1.1 d.50.1.1 | Back alignment and structure |
|---|
| >2nug_A Ribonuclease III, RNAse III; dsRNA, RNA interference, endonucleolytic cleavage, hydrolase/RNA complex; 1.70A {Aquifex aeolicus} SCOP: a.149.1.1 d.50.1.1 PDB: 1yyw_A 2nue_A 2nuf_A 1yyk_A 1yz9_A 1yyo_A 2ez6_A 1rc7_A 1i4s_A 1jfz_A 1rc5_A | Back alignment and structure |
|---|
| >3rv0_A K. polysporus DCR1; RNAse III enzyme, RNA binding protein; 2.29A {Vanderwaltozyma polyspora} | Back alignment and structure |
|---|
| >3n3w_A Ribonuclease III; nuclease domain, ribonuclase III, IDP90862, csgid, structura genomics; 2.21A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >2a11_A Ribonuclease III, RNAse III; nuclease domain, structural genomic protein structure initiative; 2.10A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3c4b_A Endoribonuclease dicer; RNAse, dsRNA binding protein, ATP-binding, endonuclease, HEL hydrolase, nucleotide-binding, phosphoprotein, RN binding; HET: MSE; 1.68A {Mus musculus} PDB: 3c4t_A 2eb1_A | Back alignment and structure |
|---|
| >2kou_A Dicer-like protein 4; ATP-binding, endonuclease, helicase, hydrolase, nuclease, nucleotide-binding, nucleus, RNA- binding; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2kou_A Dicer-like protein 4; ATP-binding, endonuclease, helicase, hydrolase, nuclease, nucleotide-binding, nucleus, RNA- binding; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2db2_A KIAA0890 protein; DSRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2db2_A KIAA0890 protein; DSRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1ztd_A Hypothetical protein PFU-631545-001; structural genomics, southeast collaboratory for structural genomics, secsg; 2.00A {Pyrococcus furiosus} SCOP: a.149.1.2 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 370 | ||||
| d2nuga1 | 148 | a.149.1.1 (A:3-150) RNase III endonuclease catalyt | 3e-19 | |
| d1o0wa1 | 169 | a.149.1.1 (A:-1-167) RNase III endonuclease cataly | 3e-18 | |
| d1u61a_ | 127 | a.149.1.1 (A:) Hypothetical protein BC0111 {Bacill | 1e-12 | |
| d1o0wa2 | 69 | d.50.1.1 (A:168-236) RNase III, C-terminal domain | 4e-12 | |
| d1o0wa2 | 69 | d.50.1.1 (A:168-236) RNase III, C-terminal domain | 3e-04 | |
| d1ekza_ | 76 | d.50.1.1 (A:) Staufen, domain III {Fruit fly (Dros | 6e-10 | |
| d1ekza_ | 76 | d.50.1.1 (A:) Staufen, domain III {Fruit fly (Dros | 1e-04 | |
| d2nuga2 | 68 | d.50.1.1 (A:151-218) RNase III, C-terminal domain | 6e-10 | |
| d1di2a_ | 69 | d.50.1.1 (A:) Double-stranded RNA-binding protein | 1e-09 | |
| d1x48a1 | 76 | d.50.1.1 (A:8-83) dsRNA-dependent protein kinase p | 1e-08 | |
| d1x48a1 | 76 | d.50.1.1 (A:8-83) dsRNA-dependent protein kinase p | 3e-08 | |
| d2b7va1 | 71 | d.50.1.1 (A:1-71) dsRNA-specific editase 1 {Rat (R | 1e-08 | |
| d1uila_ | 113 | d.50.1.1 (A:) ATP-dependent RNA helicase A, Dhx9 { | 1e-08 | |
| d1x47a1 | 85 | d.50.1.1 (A:8-92) Dgcr8 protein {Human (Homo sapie | 2e-08 | |
| d1x47a1 | 85 | d.50.1.1 (A:8-92) Dgcr8 protein {Human (Homo sapie | 2e-07 | |
| d1qu6a1 | 90 | d.50.1.1 (A:1-90) dsRNA-dependent protein kinase p | 2e-08 | |
| d1qu6a1 | 90 | d.50.1.1 (A:1-90) dsRNA-dependent protein kinase p | 0.004 | |
| d2dmya1 | 84 | d.50.1.1 (A:8-91) Spermatid perinuclear RNA-bindin | 3e-08 | |
| d1x49a1 | 85 | d.50.1.1 (A:8-92) dsRNA-dependent protein kinase p | 4e-08 | |
| d2b7ta1 | 73 | d.50.1.1 (A:1-73) dsRNA-specific editase 1 {Rat (R | 7e-08 | |
| d2cpna1 | 76 | d.50.1.1 (A:150-225) TAR RNA-binding protein 2 {Hu | 7e-07 | |
| d2cpna1 | 76 | d.50.1.1 (A:150-225) TAR RNA-binding protein 2 {Hu | 0.003 | |
| d2dixa1 | 73 | d.50.1.1 (A:7-79) Interferon-inducible double stra | 9e-07 | |
| d2dixa1 | 73 | d.50.1.1 (A:7-79) Interferon-inducible double stra | 8e-05 | |
| d1qu6a2 | 89 | d.50.1.1 (A:91-179) dsRNA-dependent protein kinase | 2e-06 | |
| d1qu6a2 | 89 | d.50.1.1 (A:91-179) dsRNA-dependent protein kinase | 5e-06 | |
| d1uhza_ | 89 | d.50.1.1 (A:) staufen homolog 2 {Mouse (Mus muscul | 2e-06 | |
| d1uhza_ | 89 | d.50.1.1 (A:) staufen homolog 2 {Mouse (Mus muscul | 0.001 | |
| d1whna_ | 128 | d.50.1.1 (A:) tRNA-dihydrouridine synthase 2-like, | 2e-06 | |
| d1whna_ | 128 | d.50.1.1 (A:) tRNA-dihydrouridine synthase 2-like, | 2e-04 | |
| d1t4oa_ | 81 | d.50.1.1 (A:) RNase III, C-terminal domain {Baker' | 4e-05 | |
| d1whqa_ | 99 | d.50.1.1 (A:) ATP-dependent RNA helicase A, Dhx9 { | 4e-05 | |
| d1whqa_ | 99 | d.50.1.1 (A:) ATP-dependent RNA helicase A, Dhx9 { | 0.003 |
| >d2nuga1 a.149.1.1 (A:3-150) RNase III endonuclease catalytic domain {Aquifex aeolicus [TaxId: 63363]} Length = 148 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: RNase III domain-like superfamily: RNase III domain-like family: RNase III catalytic domain-like domain: RNase III endonuclease catalytic domain species: Aquifex aeolicus [TaxId: 63363]
Score = 81.0 bits (199), Expect = 3e-19
Identities = 44/158 (27%), Positives = 71/158 (44%), Gaps = 25/158 (15%)
Query: 39 VENIINYNFKNKRLLEEALTHSSYTDSTSYQRLEFIGDAALGLALSNYVFLAYPQLDPGQ 98
+E + Y FK+K LLE+ALTH SY+ Y+ LEF+GDA + + + + P G
Sbjct: 5 LEKKLGYTFKDKSLLEKALTHVSYSKKEHYETLEFLGDALVNFFIVDLLVQYSPNKREGF 64
Query: 99 LSLLRAANISTEKLARVAVKHGFYKFVRHSAAALDDKVKEFAEAVSQEDNTAVYGGSIKA 158
LS L+A IS E +A K +KF+R +++ +
Sbjct: 65 LSPLKAYLISEEFFNLLAQKLELHKFIRIKRGKINETII--------------------- 103
Query: 159 PKVLADIVESIAAAIYVDIDFDLQKLWMIFRGLLEPIV 196
D+ E++ AA+Y+D D +F L + +
Sbjct: 104 ----GDVFEALWAAVYIDSGRDANFTRELFYKLFKEDI 137
|
| >d1o0wa1 a.149.1.1 (A:-1-167) RNase III endonuclease catalytic domain {Thermotoga maritima [TaxId: 2336]} Length = 169 | Back information, alignment and structure |
|---|
| >d1u61a_ a.149.1.1 (A:) Hypothetical protein BC0111 {Bacillus cereus [TaxId: 1396]} Length = 127 | Back information, alignment and structure |
|---|
| >d1o0wa2 d.50.1.1 (A:168-236) RNase III, C-terminal domain {Thermotoga maritima [TaxId: 2336]} Length = 69 | Back information, alignment and structure |
|---|
| >d1o0wa2 d.50.1.1 (A:168-236) RNase III, C-terminal domain {Thermotoga maritima [TaxId: 2336]} Length = 69 | Back information, alignment and structure |
|---|
| >d1ekza_ d.50.1.1 (A:) Staufen, domain III {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 76 | Back information, alignment and structure |
|---|
| >d1ekza_ d.50.1.1 (A:) Staufen, domain III {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 76 | Back information, alignment and structure |
|---|
| >d2nuga2 d.50.1.1 (A:151-218) RNase III, C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Length = 68 | Back information, alignment and structure |
|---|
| >d1di2a_ d.50.1.1 (A:) Double-stranded RNA-binding protein A, second dsRBD {Xenopus laevis [TaxId: 8355]} Length = 69 | Back information, alignment and structure |
|---|
| >d1x48a1 d.50.1.1 (A:8-83) dsRNA-dependent protein kinase pkr {Mouse (Mus musculus) [TaxId: 10090]} Length = 76 | Back information, alignment and structure |
|---|
| >d1x48a1 d.50.1.1 (A:8-83) dsRNA-dependent protein kinase pkr {Mouse (Mus musculus) [TaxId: 10090]} Length = 76 | Back information, alignment and structure |
|---|
| >d2b7va1 d.50.1.1 (A:1-71) dsRNA-specific editase 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 71 | Back information, alignment and structure |
|---|
| >d1uila_ d.50.1.1 (A:) ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 113 | Back information, alignment and structure |
|---|
| >d1x47a1 d.50.1.1 (A:8-92) Dgcr8 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 85 | Back information, alignment and structure |
|---|
| >d1x47a1 d.50.1.1 (A:8-92) Dgcr8 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 85 | Back information, alignment and structure |
|---|
| >d1qu6a1 d.50.1.1 (A:1-90) dsRNA-dependent protein kinase pkr {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1qu6a1 d.50.1.1 (A:1-90) dsRNA-dependent protein kinase pkr {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d2dmya1 d.50.1.1 (A:8-91) Spermatid perinuclear RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 84 | Back information, alignment and structure |
|---|
| >d1x49a1 d.50.1.1 (A:8-92) dsRNA-dependent protein kinase pkr {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 | Back information, alignment and structure |
|---|
| >d2b7ta1 d.50.1.1 (A:1-73) dsRNA-specific editase 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 73 | Back information, alignment and structure |
|---|
| >d2cpna1 d.50.1.1 (A:150-225) TAR RNA-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 | Back information, alignment and structure |
|---|
| >d2cpna1 d.50.1.1 (A:150-225) TAR RNA-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 | Back information, alignment and structure |
|---|
| >d2dixa1 d.50.1.1 (A:7-79) Interferon-inducible double stranded RNA-dependent protein kinase activator A {Human (Homo sapiens) [TaxId: 9606]} Length = 73 | Back information, alignment and structure |
|---|
| >d2dixa1 d.50.1.1 (A:7-79) Interferon-inducible double stranded RNA-dependent protein kinase activator A {Human (Homo sapiens) [TaxId: 9606]} Length = 73 | Back information, alignment and structure |
|---|
| >d1qu6a2 d.50.1.1 (A:91-179) dsRNA-dependent protein kinase pkr {Human (Homo sapiens) [TaxId: 9606]} Length = 89 | Back information, alignment and structure |
|---|
| >d1qu6a2 d.50.1.1 (A:91-179) dsRNA-dependent protein kinase pkr {Human (Homo sapiens) [TaxId: 9606]} Length = 89 | Back information, alignment and structure |
|---|
| >d1uhza_ d.50.1.1 (A:) staufen homolog 2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 | Back information, alignment and structure |
|---|
| >d1uhza_ d.50.1.1 (A:) staufen homolog 2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 | Back information, alignment and structure |
|---|
| >d1whna_ d.50.1.1 (A:) tRNA-dihydrouridine synthase 2-like, Dus2l (2310016k04Rik) {Mouse (Mus musculus) [TaxId: 10090]} Length = 128 | Back information, alignment and structure |
|---|
| >d1whna_ d.50.1.1 (A:) tRNA-dihydrouridine synthase 2-like, Dus2l (2310016k04Rik) {Mouse (Mus musculus) [TaxId: 10090]} Length = 128 | Back information, alignment and structure |
|---|
| >d1t4oa_ d.50.1.1 (A:) RNase III, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 | Back information, alignment and structure |
|---|
| >d1whqa_ d.50.1.1 (A:) ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 | Back information, alignment and structure |
|---|
| >d1whqa_ d.50.1.1 (A:) ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 370 | |||
| d2nuga1 | 148 | RNase III endonuclease catalytic domain {Aquifex a | 100.0 | |
| d1o0wa1 | 169 | RNase III endonuclease catalytic domain {Thermotog | 100.0 | |
| d1u61a_ | 127 | Hypothetical protein BC0111 {Bacillus cereus [TaxI | 99.83 | |
| d1o0wa2 | 69 | RNase III, C-terminal domain {Thermotoga maritima | 99.8 | |
| d2dixa1 | 73 | Interferon-inducible double stranded RNA-dependent | 99.79 | |
| d1di2a_ | 69 | Double-stranded RNA-binding protein A, second dsRB | 99.79 | |
| d2nuga2 | 68 | RNase III, C-terminal domain {Aquifex aeolicus [Ta | 99.79 | |
| d2cpna1 | 76 | TAR RNA-binding protein 2 {Human (Homo sapiens) [T | 99.79 | |
| d1ekza_ | 76 | Staufen, domain III {Fruit fly (Drosophila melanog | 99.76 | |
| d1uhza_ | 89 | staufen homolog 2 {Mouse (Mus musculus) [TaxId: 10 | 99.75 | |
| d1qu6a1 | 90 | dsRNA-dependent protein kinase pkr {Human (Homo sa | 99.75 | |
| d1x49a1 | 85 | dsRNA-dependent protein kinase pkr {Mouse (Mus mus | 99.75 | |
| d1uila_ | 113 | ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus mus | 99.73 | |
| d1x48a1 | 76 | dsRNA-dependent protein kinase pkr {Mouse (Mus mus | 99.72 | |
| d1whqa_ | 99 | ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus mus | 99.72 | |
| d1x47a1 | 85 | Dgcr8 protein {Human (Homo sapiens) [TaxId: 9606]} | 99.69 | |
| d1qu6a2 | 89 | dsRNA-dependent protein kinase pkr {Human (Homo sa | 99.67 | |
| d2b7va1 | 71 | dsRNA-specific editase 1 {Rat (Rattus norvegicus) | 99.63 | |
| d1whna_ | 128 | tRNA-dihydrouridine synthase 2-like, Dus2l (231001 | 99.59 | |
| d1o0wa2 | 69 | RNase III, C-terminal domain {Thermotoga maritima | 99.57 | |
| d2dixa1 | 73 | Interferon-inducible double stranded RNA-dependent | 99.56 | |
| d1x48a1 | 76 | dsRNA-dependent protein kinase pkr {Mouse (Mus mus | 99.56 | |
| d1t4oa_ | 81 | RNase III, C-terminal domain {Baker's yeast (Sacch | 99.54 | |
| d1qu6a2 | 89 | dsRNA-dependent protein kinase pkr {Human (Homo sa | 99.54 | |
| d1x47a1 | 85 | Dgcr8 protein {Human (Homo sapiens) [TaxId: 9606]} | 99.52 | |
| d1x49a1 | 85 | dsRNA-dependent protein kinase pkr {Mouse (Mus mus | 99.52 | |
| d2b7ta1 | 73 | dsRNA-specific editase 1 {Rat (Rattus norvegicus) | 99.52 | |
| d1qu6a1 | 90 | dsRNA-dependent protein kinase pkr {Human (Homo sa | 99.51 | |
| d2nuga2 | 68 | RNase III, C-terminal domain {Aquifex aeolicus [Ta | 99.5 | |
| d2dmya1 | 84 | Spermatid perinuclear RNA-binding protein {Human ( | 99.49 | |
| d1di2a_ | 69 | Double-stranded RNA-binding protein A, second dsRB | 99.48 | |
| d2cpna1 | 76 | TAR RNA-binding protein 2 {Human (Homo sapiens) [T | 99.48 | |
| d1whqa_ | 99 | ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus mus | 99.47 | |
| d1ekza_ | 76 | Staufen, domain III {Fruit fly (Drosophila melanog | 99.46 | |
| d1uhza_ | 89 | staufen homolog 2 {Mouse (Mus musculus) [TaxId: 10 | 99.44 | |
| d1uila_ | 113 | ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus mus | 99.39 | |
| d1whna_ | 128 | tRNA-dihydrouridine synthase 2-like, Dus2l (231001 | 99.34 | |
| d2b7va1 | 71 | dsRNA-specific editase 1 {Rat (Rattus norvegicus) | 99.3 | |
| d1t4oa_ | 81 | RNase III, C-terminal domain {Baker's yeast (Sacch | 99.24 | |
| d2b7ta1 | 73 | dsRNA-specific editase 1 {Rat (Rattus norvegicus) | 99.09 | |
| d2dmya1 | 84 | Spermatid perinuclear RNA-binding protein {Human ( | 99.0 | |
| d1ztda1 | 124 | Hypothetical protein PF0609 {Pyrococcus furiosus [ | 80.6 |
| >d2nuga1 a.149.1.1 (A:3-150) RNase III endonuclease catalytic domain {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: RNase III domain-like superfamily: RNase III domain-like family: RNase III catalytic domain-like domain: RNase III endonuclease catalytic domain species: Aquifex aeolicus [TaxId: 63363]
Probab=100.00 E-value=2.7e-36 Score=252.61 Aligned_cols=137 Identities=32% Similarity=0.459 Sum_probs=128.7
Q ss_pred HHHHHHHcCcccCChhHHHHHhcCCCCCCCCCcchhhhhhHHHHHHHHHHHHHHHCCCCCcchhhHHHHHhcChHHHHHH
Q 017515 36 VFYVENIINYNFKNKRLLEEALTHSSYTDSTSYQRLEFIGDAALGLALSNYVFLAYPQLDPGQLSLLRAANISTEKLARV 115 (370)
Q Consensus 36 ~~~le~~lgy~f~~~~Ll~~AlTh~s~~~~~~~erLe~LGdavL~~~v~~~l~~~~p~~~~~~l~~lr~~lvsn~~La~~ 115 (370)
++.||++|||+|+|++||.+||||+|+....+|||||||||+||+++++.|+|.+||+.++|.|+.+|+.+|||.+|+.+
T Consensus 2 l~~le~~igy~F~n~~LL~~Alth~S~~~~~~~erLeflGDavl~~~v~~~l~~~~p~~~~g~lt~~r~~lvsn~~La~~ 81 (148)
T d2nuga1 2 LEQLEKKLGYTFKDKSLLEKALTHVSYSKKEHYETLEFLGDALVNFFIVDLLVQYSPNKREGFLSPLKAYLISEEFFNLL 81 (148)
T ss_dssp HHHHHHHHTCCCSSHHHHHHHHBCTTTCSSSCSHHHHHHHHHHHHHHHHHHHHHTCTTCCHHHHHHHHHHHTSHHHHHHH
T ss_pred HHHHHHHHCCccCCHHHHHHHhcCcCcCCCcchHHHHHHHHHHHhhhhHHHHHhhCCCcchHHHHHHHHHhhhhhHhhhH
Confidence 57899999999999999999999999998889999999999999999999999999999999999999999999999999
Q ss_pred HHHcChhHHHhhccchhhHHHHHHHHHhhccccccccCCCcCCchHHHHHHHHHHHHHhhcCCcChHHHHHHHHHhhhhh
Q 017515 116 AVKHGFYKFVRHSAAALDDKVKEFAEAVSQEDNTAVYGGSIKAPKVLADIVESIAAAIYVDIDFDLQKLWMIFRGLLEPI 195 (370)
Q Consensus 116 a~~~gL~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~k~lad~feAliGAIyld~g~~~~~~~~v~~~ll~~~ 195 (370)
|.++||++|++.++. ...+++++|+|||+|||||+|+|++...+++++.+++.+.
T Consensus 82 a~~lgl~~~i~~~~~-------------------------~~~~kilad~~EAiiGAiylD~g~~~~~~~~~i~~l~~~~ 136 (148)
T d2nuga1 82 AQKLELHKFIRIKRG-------------------------KINETIIGDVFEALWAAVYIDSGRDANFTRELFYKLFKED 136 (148)
T ss_dssp HHTTTGGGTCBSCTT-------------------------CCCHHHHHHHHHHHHHHHHHHTTSCHHHHHHHHHHHHHHH
T ss_pred HHHhhHHHHHHhccc-------------------------cchhhhhHHHHHHHHHHhhhccCCCHHHHHHHHHHHHHHH
Confidence 999999999987642 3468999999999999999999999988889999999887
Q ss_pred hh
Q 017515 196 VT 197 (370)
Q Consensus 196 i~ 197 (370)
+.
T Consensus 137 i~ 138 (148)
T d2nuga1 137 IL 138 (148)
T ss_dssp HH
T ss_pred HH
Confidence 75
|
| >d1u61a_ a.149.1.1 (A:) Hypothetical protein BC0111 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1o0wa2 d.50.1.1 (A:168-236) RNase III, C-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2dixa1 d.50.1.1 (A:7-79) Interferon-inducible double stranded RNA-dependent protein kinase activator A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1di2a_ d.50.1.1 (A:) Double-stranded RNA-binding protein A, second dsRBD {Xenopus laevis [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d2nuga2 d.50.1.1 (A:151-218) RNase III, C-terminal domain {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d2cpna1 d.50.1.1 (A:150-225) TAR RNA-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ekza_ d.50.1.1 (A:) Staufen, domain III {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1uhza_ d.50.1.1 (A:) staufen homolog 2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1qu6a1 d.50.1.1 (A:1-90) dsRNA-dependent protein kinase pkr {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x49a1 d.50.1.1 (A:8-92) dsRNA-dependent protein kinase pkr {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1uila_ d.50.1.1 (A:) ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x48a1 d.50.1.1 (A:8-83) dsRNA-dependent protein kinase pkr {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1whqa_ d.50.1.1 (A:) ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x47a1 d.50.1.1 (A:8-92) Dgcr8 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qu6a2 d.50.1.1 (A:91-179) dsRNA-dependent protein kinase pkr {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b7va1 d.50.1.1 (A:1-71) dsRNA-specific editase 1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1whna_ d.50.1.1 (A:) tRNA-dihydrouridine synthase 2-like, Dus2l (2310016k04Rik) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1o0wa2 d.50.1.1 (A:168-236) RNase III, C-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2dixa1 d.50.1.1 (A:7-79) Interferon-inducible double stranded RNA-dependent protein kinase activator A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x48a1 d.50.1.1 (A:8-83) dsRNA-dependent protein kinase pkr {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1t4oa_ d.50.1.1 (A:) RNase III, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1qu6a2 d.50.1.1 (A:91-179) dsRNA-dependent protein kinase pkr {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x47a1 d.50.1.1 (A:8-92) Dgcr8 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x49a1 d.50.1.1 (A:8-92) dsRNA-dependent protein kinase pkr {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2b7ta1 d.50.1.1 (A:1-73) dsRNA-specific editase 1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1qu6a1 d.50.1.1 (A:1-90) dsRNA-dependent protein kinase pkr {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2nuga2 d.50.1.1 (A:151-218) RNase III, C-terminal domain {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d2dmya1 d.50.1.1 (A:8-91) Spermatid perinuclear RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1di2a_ d.50.1.1 (A:) Double-stranded RNA-binding protein A, second dsRBD {Xenopus laevis [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d2cpna1 d.50.1.1 (A:150-225) TAR RNA-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1whqa_ d.50.1.1 (A:) ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ekza_ d.50.1.1 (A:) Staufen, domain III {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1uhza_ d.50.1.1 (A:) staufen homolog 2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1uila_ d.50.1.1 (A:) ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1whna_ d.50.1.1 (A:) tRNA-dihydrouridine synthase 2-like, Dus2l (2310016k04Rik) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2b7va1 d.50.1.1 (A:1-71) dsRNA-specific editase 1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1t4oa_ d.50.1.1 (A:) RNase III, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2b7ta1 d.50.1.1 (A:1-73) dsRNA-specific editase 1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2dmya1 d.50.1.1 (A:8-91) Spermatid perinuclear RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ztda1 a.149.1.2 (A:2-125) Hypothetical protein PF0609 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|