Citrus Sinensis ID: 017524

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370

MLMLVDCSKCRTTLQLPPGAQSIRCAICQAITHIADPRSGPPPPSSSSSSSYQPGHVPPSAVAPSPYNHAPPGQPPHAQGRKRALIVGVSYRHTNHELKGCINDARCMKYMLTNRFKFPESSIVMLTEEDPDPLKRPTKYNMRMALYWLIQGCQPGDSLLFHFSGHGSQQRNYNGEEVDGYDETLCPVDFETQGMIVDDEINTTLVRPLPRGARLHAIIDACHSGTVLDLPFLCRMDRQGKYIWEDHRPRSGMWKGTSGGEAISFSGCDDNQTSADTSALSKITSTGAMTYSFIQAIERGHGATYGSMLNSMRSTIRNTDSGSELSGAGGLVTSLVTMLLTGGSLSGGFRQEPQLTANEPFDVYTKPFSL

cccEEEcccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEccccccccccccHHHHHHHHHHHHHHcccccccEEEcccccccccccccHHHHHHHHHHHHHccccccEEEEEEcccccccccccccccccccccccccccccccccccHHHHHHHHcccccccEEEEEEcccccccccccccccccccccccccccccccccccccccccccEEEECccccccccccccccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHcccccccccccccccccccccccccccccc

*LMLVDCSKCRTTLQLPPGAQSIRCAICQAITHI*********************************************GRKRALIVGVSYRHTNHELKGCINDARCMKYMLTNRFKFPESSIVMLTEEDPDPLKRPTKYNMRMALYWLIQGCQPGDSLLFHFSGHGSQQRNYNGEEVDGYDETLCPVDFETQGMIVDDEINTTLVRPLPRGARLHAIIDACHSGTVLDLPFLCRMDRQGKYIWEDHRPRSGMWKGTSGGEAISFSGCDDNQTSADTSALSKITSTGAMTYSFIQAIERGHGATYGSMLNSMRSTI************GGLVTSLVTMLLTGGSLSGGFRQEPQLTANEPFDVYTKPFSL

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Metacaspase-1	Cysteine protease that cleaves specifically after arginine or lysine residues. Does not cleave caspase-specific substrates. Acts as a positive regulator of cell death. Required for both oxidative stress cell death response and hypersensitive cell death response mediated by immune response.	confident	Q7XJE6

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4F6O, chain A
Confidence level:very confident
Coverage over the Query: 73-166,178-243,257-269,285-319,349-370
View the alignment between query and template
View the model in PyMOL

Template: 1GH9, chain A
Confidence level:probable
Coverage over the Query: 1-36
View the alignment between query and template
View the model in PyMOL