Citrus Sinensis ID: 017540


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------37
MGAAGSKLEKALGDQFPEGERYFGLENFGNTCYCNSVLQALYFCVPFREQLLDYYSNNKNLGDAEENLLTCLADLFTQIRAQKKKTGVIAPKRFVQRLKKQNELFRSYMHQDAHEFLNFLLNELVDILEKEEAAKSDPESSSPSEKTANGPTNGLANGVRKEPLVTWVHKNFQGILTNETRCLRCETVTARDETFFDLSLDIEQNSSITSCLKNFSSTETLNAEDKFFCDKCCSLQEAQKRMKIKKSPHTLVIHLKRFKYIEQLGRYKKLSYRVVFPLELKLSNTAEDADIEYSLFAVVVHVGSGPNHGHYVSLVKSHNHWLFFDDENVEMIDESAVQTFFGSAQEYSSNTDHGYILFYESLGAGSNKS
ccccccccccccccccccccccccEECccccccHHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccEEEEEEEEEEEcEEEEcccccccccccccEEEEECccccccHHHHHHHcccccccccccccccccccccEEEEEEEEEcccccEEEEEEcccccccccccccccccEEEcccccccccccccccccEEEEEEEEECccccccccEEEEEEEcccEEEECcccCECccHHHHHHHHccccccccccccEEEEEEEECccccccc
*****************EGERYFGLENFGNTCYCNSVLQALYFCVPFREQLLDYYSNNKNLGDAEENLLTCLADLFTQIRAQKKKTGVIAPKRFVQRLKKQNELFRSYMHQDAHEFLNFLLNELVDIL******************************VRKEPLVTWVHKNFQGILTNETRCLRCETVTARDETFFDLSLDIEQNSSITSCLKNFSSTETLNAEDKFFCDKCCSLQEAQKRMKIKKSPHTLVIHLKRFKYIEQLGRYKKLSYRVVFPLELKLSNTAEDADIEYSLFAVVVHVGSGPNHGHYVSLVKSHNHWLFFDDENVEMIDESAVQTFFGSAQEYSSNTDHGYILFYESLG******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGAAGSKLEKALGDQFPEGERYFGLENFGNTCYCNSVLQALYFCVPFREQLLDYYSNNKNLGDAEENLLTCLADLFTQIRAQKKKTGVIAPKRFVQRLKKQNELFRSYMHQDAHEFLNFLLNELVDILEKEEAAKSDPESSSPSEKTANGPTNGLANGVRKEPLVTWVHKNFQGILTNETRCLRCETVTARDETFFDLSLDIEQNSSITSCLKNFSSTETLNAEDKFFCDKCCSLQEAQKRMKIKKSPHTLVIHLKRFKYIEQLGRYKKLSYRVVFPLELKLSNTAEDADIEYSLFAVVVHVGSGPNHGHYVSLVKSHNHWLFFDDENVEMIDESAVQTFFGSAQEYSSNTDHGYILFYESLGAGSNKS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ubiquitin carboxyl-terminal hydrolase 4 Recognizes and hydrolyzes the peptide bond at the C-terminal Gly of ubiquitin. Involved in the processing of poly-ubiquitin precursors as well as that of ubiquitinated proteins. Required for the correct development of pollen.confidentQ8LAM0
Ubiquitin carboxyl-terminal hydrolase 46 Deubiquitinating enzyme that plays a role in behavior, possibly by regulating GABA action. May act by mediating the deubiquitination of GAD1/GAD67. Has almost no deubiquitinating activity by itself and requires the interaction with WDR48 to have a high activity. Not involved in deubiquitination of monoubiquitinated FANCD2.probableP62068
Ubiquitin carboxyl-terminal hydrolase 46 Deubiquitinating enzyme that plays a role in behavior, possibly by regulating GABA action. May act by mediating the deubiquitination of GAD1/GAD67. Has almost no deubiquitinating activity by itself and requires the interaction with WDR48 to have a high activity. Not involved in deubiquitination of monoubiquitinated FANCD2.probableP62069

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.4.-.-Acting on peptide bonds (peptide hydrolases).probable
3.4.19.-Omega peptidases.probable
3.4.19.12Ubiquitinyl hydrolase 1.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3IHP, chain A
Confidence level:very confident
Coverage over the Query: 19-130,165-286
View the alignment between query and template
View the model in PyMOL
Template: 2Y6E, chain A
Confidence level:very confident
Coverage over the Query: 33-338,351-364
View the alignment between query and template
View the model in PyMOL