Citrus Sinensis ID: 017569


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------37
MVISTTETDSREILSSTFASRYVRAAIPRFKMPDNSMPKEAAYQVINDELMLDGNPRLNLASFVTTWMEPECDKLVMASINKNYVDMDEYPVTTELQNRCVNMIAHLFNTPVADDKTAVGVGTVGSSEAIMLAGLAFKRKWQQKRKEQGKPYDKPNIVTGANVQVCWEKFARYFEVELKEVKLEEGYYVMNPVKAVELVDENTICVAAILGSTLTGEFEDVKLLHDLLTKKNEETGWDTPIHVDAASGGFIAPFLYPDLEWDFRLPLVKSINVSGHKYGLVYAGVGWVVWRTKDDLPDELVFHINYLGSDQPTFTLNFSKGSSQIIAQYYQFIRLGFEVIPSFCCVDHKKLSSFFVIHSSYFYDTLHVL
ccccccccccccccccccccHHHcccccccccccccccHHHHHHHHHHHHHcccccccccEEEEEccccHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHccccccccccCEEECccHHHHHHHHHHHHHHHHHHHHHHccccccccCEEEcccHHHHHHHHccccEEEEEEEEcccccEEEcHHHHHHHcccccEEEEEEcccccccccccHHHHHHHHHHHHHHccccccEEEEccccccccccccccccccccccccEEEEcccccccccccccEEEEEcccccccccEEEEccccccccccccEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHccc
******************ASRYVRAAIPRF*****SMPKEAAYQVINDELMLDGNPRLNLASFVTTWMEPECDKLVMASINKNYVDMDEYPVTTELQNRCVNMIAHLFNTPVADDKTAVGVGTVGSSEAIMLAGLAFKRKWQQKRKEQGKPYDKPNIVTGANVQVCWEKFARYFEVELKEVKLEEGYYVMNPVKAVELVDENTICVAAILGSTLTGEFEDVKLLHDLLTKKNEETGWDTPIHVDAASGGFIAPFLYPDLEWDFRLPLVKSINVSGHKYGLVYAGVGWVVWRTKDDLPDELVFHINYLGSDQPTFTLNFSKGSSQIIAQYYQFIRLGFEVIPSFCCVDHKKLSSFFVIHSSYFYDTLHVL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVISTTETDSREILSSTFASRYVRAAIPRFKMPDNSMPKEAAYQVINDELMLDGNPRLNLASFVTTWMEPECDKLVMASINKNYVDMDEYPVTTELQNRCVNMIAHLFNTPVADDKTAVGVGTVGSSEAIMLAGLAFKRKWQQKRKEQGKPYDKPNIVTGANVQVCWEKFARYFEVELKEVKLEEGYYVMNPVKAVELVDENTICVAAILGSTLTGEFEDVKLLHDLLTKKNEETGWDTPIHVDAASGGFIAPFLYPDLEWDFRLPLVKSINVSGHKYGLVYAGVGWVVWRTKDDLPDELVFHINYLGSDQPTFTLNFSKGSSQIIAQYYQFIRLGFEVIPSFCCVDHKKLSSFFVIHSSYFYDTLHVL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Glutamate decarboxylase 4 Catalyzes the production of GABA. The calmodulin-binding is calcium-dependent and it is proposed that this may, directly or indirectly, form a calcium regulated control of GABA biosynthesis.probableQ9ZPS3
Glutamate decarboxylase Catalyzes the production of GABA. The calmodulin-binding is calcium-dependent and it is proposed that this may, directly or indirectly, form a calcium regulated control of GABA biosynthesis.probableP54767
Glutamate decarboxylase Catalyzes the production of GABA. The calmodulin-binding is calcium-dependent and it is proposed that this may, directly or indirectly, form a calcium regulated control of GABA biosynthesis.probableQ07346

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
4.-.-.-Lyases.probable
4.1.-.-Carbon-carbon lyases.probable
4.1.1.-Carboxy-lyases.probable
4.1.1.15Glutamate decarboxylase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3HBX, chain A
Confidence level:very confident
Coverage over the Query: 12-363
View the alignment between query and template
View the model in PyMOL