Citrus Sinensis ID: 017575

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------37
MGRALFAVTNVATEVNSVEQAQKRSKESQRPVYPFTAIVGQEEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPVIKVVVGDPYNSDPEDPEAMGIEVRESVVKGEELSITFSKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILYVDEVNLLDDHLVDVLLDSAASGWNTVEREGISISHPARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERARFDKNPKEFRDSYKAEQAKLQQQIASARSSLPAVQIDHDLKVKISKVCAELNVDGLRGDIVSNRAAKALAALKGRDKVSAEDIATVMPNCLRHRLRKDPLESIDSGLLIIEKFYEVFS
ccccccEEEccccccccHHHHHHHHcccccccccccHHcccHHHHHHHHHHHcccccccEEEEccccccHHHHHHHHHHccccEEEEccccccccccccccHHHHHHHHHHccccccccccccccEEcccccccccccccccHHHHHHHccccccccccccccccEEEEEccccccHHHHHHHHHHHHcccCEEEcccccccccccEEEEECcccccccccHHHHcHcccEEEEcccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHc
*******************************VYPFTAIVGQEEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPVIKVVVGDPYNSDPEDPEAMGIEVRESVVKGEELSITFSKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILYVDEVNLLDDHLVDVLLDSAASGWNTVEREGISISHPARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERARF****KE****YKAEQAKLQQQIASARSSLPAVQIDHDLKVKISKVCAELNVDGLRGDIVSNRAAKALAALKGRDKVSAEDIATVMPNCLRHRLRKDPLESIDSGLLIIEKFYEVFS
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGRALFAVTNVATEVNSVEQAQKRSKESQRPVYPFTAIVGQEEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPVIKVVVGDPYNSDPEDPEAMGIEVRESVVKGEELSITFSKINMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILYVDEVNLLDDHLVDVLLDSAASGWNTVEREGISISHPARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERARFDKNPKEFxxxxxxxxxxxxxxxxxxxxxLPAVQIDHDLKVKISKVCAELNVDGLRGDIVSNRAAKALAALKGRDKVSAEDIATVMPNCLRHRLRKDPLESIDSGLLIIEKFYEVFS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Magnesium-chelatase subunit ChlI, chloroplastic Involved in chlorophyll biosynthesis; introduces a magnesium ion into protoporphyrin IX to yield Mg-protoporphyrin IX.confidentP93162
Magnesium-chelatase subunit ChlI-2, chloroplastic Involved in chlorophyll biosynthesis. Catalyzes the insertion of magnesium ion into protoporphyrin IX to yield Mg-protoporphyrin IX. The reaction takes place in two steps, with an ATP-dependent activation followed by an ATP-dependent chelation step. Possesses low affinity for ATP and may play a limited role in chlorophyll biosynthesis, and contributes to the assembly of the Mg-chelatase complex.confidentQ5XF33
Magnesium-chelatase subunit ChlI, chloroplastic Involved in chlorophyll biosynthesis. Catalyzes the insertion of magnesium ion into protoporphyrin IX to yield Mg-protoporphyrin IX. The reaction takes place in two steps, with an ATP-dependent activation followed by an ATP-dependent chelation step.confidentQ53RM0

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
6.-.-.-Ligases.probable
6.6.-.-Forming nitrogen-metal bonds.probable
6.6.1.-Forming coordination complexes.probable
6.6.1.1Magnesium chelatase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1G8P, chain A
Confidence level:very confident
Coverage over the Query: 30-346,359-368
View the alignment between query and template
View the model in PyMOL