Citrus Sinensis ID: 017611

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------37

MVRYDDAGGAAATTPTQLLESLGSFMRRCLFRVLAVGPIPHHFAFIMDGNRRYAKKLNVEEGAGHKEGFSSLISVLKYCYELGVKYVTIYAFSIDNFQRKPAEVQNLMDLLLEKINELLKEQSIVNLYGIRVYFIGNLKFLSEPVRVAAEEVMMATARNSKVVLLVCLAYTSADEIVHAVQESFKNKSDESLAVNANQVSNGVINGAEKVEKIYSLTVPSIEESCKEKASRVCNGAIERVKGTEDINGATVCTDGVSCDYKSEAQALRAGRIGNGVTEGFEEKQGNNPIINLVDVEKHMYMAVAPDPDILMRSSGETRLSNFLLWQTSNCLLDSPAALWPEIGLWHLVWAVLKFQRNHSFLEKKKKQL

ccCECccccccccccHHHHHHHHHHHHHHHHHHccccccccEEEEEEcccHHHHHHcccccHHHHHHHHHHHHHHHHHHHHccccEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEccccccHHHHHHHHHHHHHHcccccEEEEEEEccccHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHcccccccccccccccccccccHHHHHHHHcccccccccccccccccccccHHHHHHHHHcccccHHHHHccccccccccHHHHHHcccccccccccEEEEccccccccccHHHHHcccEEEEcccccccccHHHHHHHHHHHHHHHHHccHHcccc

**************PTQLLESLGSFMRRCLFRVLAVGPIPHHFAFIMDGNRRYAKKLNVEEGAGHKEGFSSLISVLKYCYELGVKYVTIYAFSIDNFQRKPAEVQNLMDLLLEKINELLKEQSIVNLYGIRVYFIGNLKFLSEPVRVAAEEVMMATARNSKVVLLVCLAYTSADEIVHAVQESFKNKSDESLAVNANQVSNGVINGAEKVEKIYSLTVPSIEE*******RVCNGAIERVKGTEDINGATVCTDGVSCDYKSEAQALRAGRIGNGVTEGFEEKQGNNPIINLVDVEKHMYMAVAPDPDILMRSSGETRLSNFLLWQTSNCLLDSPAALWPEIGLWHLVWAVLKFQRNHSFLEK*****

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Dehydrodolichyl diphosphate synthase 6	Catalyzes cis-prenyl chain elongation to produce the polyprenyl backbone of dolichol, a glycosyl carrier-lipid required for the biosynthesis of several classes of glycoprotein.	probable	Q8S2T1

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1F75, chain A
Confidence level:very confident
Coverage over the Query: 33-92,105-188,201-204,286-357
View the alignment between query and template
View the model in PyMOL

Template: 2VFW, chain A
Confidence level:probable
Coverage over the Query: 39-181,197-224
View the alignment between query and template
View the model in PyMOL