Citrus Sinensis ID: 017671

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------37

MEDNSNVMASVHSTVFKESESLEGKGTKIEGYDFNQGVNYSQLLKSMVSTGFQASNFGDAIEVVNQMLDWRLADEVIPEDCDERERDPEYRKSVRCKVFLGFTSNLISSGVRDTVRYLVQHHMVDVVVTTAGGIEEDLVKCLAPTFKGDFALPGAYLRSKGLNRIGNLLVPNDNYCKFEDWIIPIFDQMLKEQNEEEISWTPSKVIARLGKEINDESSYLYWAYKNNIPVFCPGLTDGSLGDMLYFHSFRSPGLIIDIVQDIRAINGEAVHASPRKTGLIILGGGLPKHHICNANMMRNGADYAVFINTAQEFDGSDSGARPDEAVSWGKIRGSAKTVKVHCDATIAFPLLVAETFASRRNKFVETER

ccccccccHHHHHccccccccccccccccccccccccccHHHHHHHHHHcccccccHHHHHHHHHHHHHHccccccccccccccccccHHccccccEEEEEEcccccccHHHHHHHHHHHcccccEEEEcccHHHHHHHHHHccccccccccccHHHHHccccccccEEccccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHccccccccHHHHHHHHccccEEcccccccHHHHHHHHHHccccccEEcHHHHHHHHHHHHHHcccccCEEEEEcccccHHHHHHcccccccccEEEEEEcccccccccccccccccccccccccccccEEEEEEHHHHHHHHHHHHHHccccccccccc

**************************TKIEGYDFNQGVNYSQLLKSMVSTGFQASNFGDAIEVVNQMLDWRLADE********RERDPEYRKSVRCKVFLGFTSNLISSGVRDTVRYLVQHHMVDVVVTTAGGIEEDLVKCLAPTFKGDFALPGAYLRSKGLNRIGNLLVPNDNYCKFEDWIIPIFDQMLKEQNEEEISWTPSKVIARLGKEINDESSYLYWAYKNNIPVFCPGLTDGSLGDMLYFHSFRSPGLIIDIVQDIRAINGEAVHASPRKTGLIILGGGLPKHHICNANMMRNGADYAVFINTAQEFDGSDSGARPDEAVSWGKIRGSAKTVKVHCDATIAFPLLVAETFA***********

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Deoxyhypusine synthase	Catalyzes the NAD-dependent oxidative cleavage of spermidine and the subsequent transfer of the butylamine moiety of spermidine to the epsilon-amino group of a specific lysine residue of the eIF-5A precursor protein to form the intermediate deoxyhypusine residue. Also able to produce homospermidine from putrescine.	confident	Q9FI94
Probable deoxyhypusine synthase	Catalyzes the NAD-dependent oxidative cleavage of spermidine and the subsequent transfer of the butylamine moiety of spermidine to the epsilon-amino group of a specific lysine residue of the eIF-5A precursor protein to form the intermediate deoxyhypusine residue.	probable	Q9VSF4
Deoxyhypusine synthase	Catalyzes the NAD-dependent oxidative cleavage of spermidine and the subsequent transfer of the butylamine moiety of spermidine to the epsilon-amino group of a specific lysine residue of the eIF-5A precursor protein to form the intermediate deoxyhypusine residue. Also able to produce homospermidine from putrescine.	probable	Q9SC80

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
2.-.-.-	Transferases.	probable
2.5.-.-	Transferring alkyl or aryl groups, other than methyl groups.	probable
2.5.1.-	5,10-methenyltetrahydromethanopterin hydrogenase.	probable
2.5.1.46	Transferred entry: 2.5.1.46.	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1RLZ, chain A
Confidence level:very confident
Coverage over the Query: 7-75,94-365
View the alignment between query and template
View the model in PyMOL