Citrus Sinensis ID: 017683


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------37
MAAKKLSETFSKSLIEEVGRWGCMKQTGVSLRYMMEFGSKPTDKNLLISAQFLHKELPIRIARRAIELETLPYGLSEKPAVLKVRDWYLDSFRDLRSFPDIRSTSDERDFTQMIKAIKVRHNNVVPMMALGLQQLKKEMDPKIVYEDLDEIHQFLDRFYMSRIGIRMLIGQHVELHNPNPPPHCIGYIDTKMSPVQVARNASEHARCVCLREYGSAPDFNIYGDPSFTFPYVPSHLHLMVFELVKNSLRAVEERYMDSDKVAPPIRIIVADGLEDVTIKVSDEGGGIPRSGLPKIFTYLYSTARNPLDENTDLAADKGTMAGYGYGLPISRLYARYFGGDLQIISMEGYGELNMFSVLLYSYCLYINK
cccccccHHHHHHHHHHHHHHcccccccccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEEccccEEEEEEccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccEEEEEEEccccEEEEEEEEEccccccccc
*************LIEEVGRWGCMKQTGVSLRYMMEFGSKPTDKNLLISAQFLHKELPIRIARRAIELETLPYGLSEKPAVLKVRDWYLDSFRDLRSFPDIRSTSDERDFTQMIKAIKVRHNNVVPMMALGLQQLKKEMDPKIVYEDLDEIHQFLDRFYMSRIGIRMLIGQHVELHNPNPPPHCIGYIDTKMSPVQVARNASEHARCVCLREYGSAPDFNIYGDPSFTFPYVPSHLHLMVFELVKNSLRAVEERYMDSDKVAPPIRIIVADGLEDVTIKVSDEGGGIPRSGLPKIFTYLYSTARN**********DKGTMAGYGYGLPISRLYARYFGGDLQIISMEGYGELNMFSVLLYSYCLYI**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAAKKLSETFSKSLIEEVGRWGCMKQTGVSLRYMMEFGSKPTDKNLLISAQFLHKELPIRIARRAIELETLPYGLSEKPAVLKVRDWYLDSFRDLRSFPDIRSTSDERDFTQMIKAIKVRHNNVVPMMALGLQQLKKEMDPKIVYEDLDEIHQFLDRFYMSRIGIRMLIGQHVELHNPNPPPHCIGYIDTKMSPVQVARNASEHARCVCLREYGSAPDFNIYGDPSFTFPYVPSHLHLMVFELVKNSLRAVEERYMDSDKVAPPIRIIVADGLEDVTIKVSDEGGGIPRSGLPKIFTYLYSTARNPLDENTDLAADKGTMAGYGYGLPISRLYARYFGGDLQIISMEGYGELNMFSVLLYSYCLYINK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
[Pyruvate dehydrogenase (acetyl-transferring)] kinase, mitochondrial Serine protein kinase that inhibits the mitochondrial pyruvate dehydrogenase (PDH) complex (mtPDC) by phosphorylation of the E1 alpha subunit on Ser residues, thus contributing to the regulation of glucose metabolism.confidentQ9SBJ1
Probable [pyruvate dehydrogenase [lipoamide]] kinase, mitochondrial Inhibits the mitochondrial pyruvate dehydrogenase complex by phosphorylation of the E1 alpha subunit, thus contributing to the regulation of glucose metabolism.probableQ02332

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.11.-Protein-serine/threonine kinases.probable
2.7.11.2Transferred entry: 2.7.11.2.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2E0A, chain A
Confidence level:very confident
Coverage over the Query: 14-306,317-361
View the alignment between query and template
View the model in PyMOL
Template: 3VAD, chain A
Confidence level:confident
Coverage over the Query: 24-303,321-336
View the alignment between query and template
View the model in PyMOL