Citrus Sinensis ID: 017706

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------

MAGVSLKCGDCGALLRSVQEAQEHAELTSHSNFSESTEAVLNLVCATCGKPCRSKTETDLHRKRTGHTDFVDKTSEAAKPISLEVPKATADSEEAIDVDMSGSQPEEMVEPEVDKELLKELEAMGFPVARATRALHYSGNANVEAAVNWVVEHENDPDIDEMPMVPVSGGGGASKSSLTPEEIKLKAQELRERARKKKEEEEKRMEREREKERIRIGKELLEAKRIEEENERKRILALRKAEKEEEKRAREKIRQKLEEDKAERRRRLGLPPEDPATTKSSAPVVEEKKSMLPIRPATKVEQMRECLRSLKQNHKDDDAKVKRAFQTLLTYIGNVAKNPNEEKFRKIRLSNQTFQVWNFFTIDLDTC

ccccccccccHHHHHHHHHHHHHHHHHHcccccccHHHHHHccccccccccccccccccccccccccccccHHHHccccccccccccccccccHHcccccccccccccccccccHHHHHHHHHccccHHHHHHHHHHHccccHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHccccccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccEEccccc

ccEEEEEccccHHHHHHHHHHHHHHHHcccccHHHcHHHHHHccccHccccccccccccccccccccccccccEEEccccEEEEccccccccccHcccccccccccccccccccHHHHHHHHHccccHHHHHHHHHHcccccHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHccccccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccHHHHHEEEcccccEEEEEEEEEEcccc

magvslkcgdcGALLRSVQEAQEHaeltshsnfseSTEAVLNLVCAtcgkpcrsktetdlhrkrtghtdfvdktseaakpislevpkatadseeaidvdmsgsqpeemvepEVDKELLKELEAMGFPVARATRALHYSGNANVEAAVNWVVEhendpdidempmvpvsggggaskssltPEEIKLKAQELRERARKKKEEEEKRMEREREKERIRIGKELLEAKRIEEENERKRILALRKAEKEEEKRAREKIRQKLEEDKAERrrrlglppedpattkssapvveekksmlpirpatKVEQMRECLRSLKQNHKDDDAKVKRAFQTLLTYIGNvaknpneekfRKIRLSNQTFQVWNFFTIDLDTC

magvslkcgdCGALLRSVQEAQEHAELtshsnfsesTEAVLNLVCATCGKpcrsktetdlhrkrtghtdfvdktseaakpislevpkatadseeaIDVDmsgsqpeemvEPEVDKELLKELEAMGFPVARATRALHYSGNANVEAAVNWVVEHENDPDIDEMPMVPVSGGggaskssltpeeIKLKAQELRerarkkkeeeekrmererekeririgkelleakrieeenerkrilalrkaekeeekrAREKIrqkleedkaerrrrlglppedpattkssapvveekksmlpirpatkvEQMRECLRSLkqnhkdddakVKRAFQTLLTYignvaknpneEKFRkirlsnqtfqvwNFFTIDLDTC

MAGVSLKCGDCGALLRSVQEAQEHAELTSHSNFSESTEAVLNLVCATCGKPCRSKTETDLHRKRTGHTDFVDKTSEAAKPISLEVPKATADSEEAIDVDMSGSQPEEMVEPEVDKELLKELEAMGFPVARATRALHYSGnanveaavnwvvehenDPDIDEMPMVPVSGGGGASKSSLTPEEIKLKAQelrerarkkkeeeekrmererekeririgkelleakrieeenerkrilalrkaekeeekrarekirQKLEEDKAERRRRLGLPPEDPATTKSSAPVVEEKKSMLPIRPATKVEQMRECLRSLKQNHKDDDAKVKRAFQTLLTYIGNVAKNPNEEKFRKIRLSNQTFQVWNFFTIDLDTC

*******CGDCGALL**********************EAVLNLVCATCGKPC********************************************************************LEAMGFPVARATRALHYSGNANVEAAVNWVVE************************************************************************************************************************************************************************VKRAFQTLLTYIGNVAKNPNEEKFRKIRLSNQTFQVWNFFTIDL***

****SLKCGDCGALLR******************ESTEAVLNLVCATCGKPCRSKTETDLHRKRTGHTDFVDKTSEAAKPISLEVPKATADS**********************KELLKELEAMGFPVARATRALHYSGNANVEAAVNWVVEHE********************************************************************************************************************************************************LRS*********AKVKRAFQTLLTYIGNVAKNPNEEKFRKIRLSNQTFQVWNFFTIDLDTC

MAGVSLKCGDCGALLRSVQEA**************STEAVLNLVCATCGKPCRSKTETDLHRKRTGHTDFVDKTSEAAKPISLEVPKATADSEEAIDV***************DKELLKELEAMGFPVARATRALHYSGNANVEAAVNWVVEHENDPDIDEMPMVPVSG*********TPEEIKLKAQEL*********************ERIRIGKELLEAKRIEEENERKRILALRK***********KIRQKLEEDKAERRRRLGLPPE***************KSMLPIRPATKVEQMRECLRSLKQNHKDDDAKVKRAFQTLLTYIGNVAKNPNEEKFRKIRLSNQTFQVWNFFTIDLDTC

*AGVSLKCGDCGALLRSVQEAQEHAELTSHSNFSESTEAVLNLVCATCGKPCR**TETDLHRKRTGHTDFVDKTSEAAKPISLEVPKA*******************MVEPEVDKELLKELEAMGFPVARATRALHYSGNANVEAAVNWVVEHENDPDIDEMPMVP************************RERARKKK************KERIRIGKELLEAKRIEEENERKRILALRKAEKEEEKRAREKIRQKLEEDKAERRRRLG************************IRPATKVEQMRECLRSLKQNHKDDDAKVKRAFQTLLTYIGNVAKNPNEEKFRKIRLSNQTFQVWNFFTIDLDTC

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MAGVSLKCGDCGALLRSVQEAQEHAELTSHSNFSESTEAVLNLVCATCGKPCRSKTETDLHRKRTGHTDFVDKTSEAAKPISLEVPKATADSEEAIDVDMSGSQPEEMVEPEVDKELLKELEAMGFPVARATRALHYSGNANVEAAVNWVVEHENDPDIDEMPMVPVSGGGGASKSSLTPEEIxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxIGKELLEAKRxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxRRRRLGLPPEDPATTKSSAPVVEEKKSMLPIRPATKVEQMRECLRSLKQNHKDDDAKVKRAFQTLLTYIGNVAKNPNEEKFRKIRLSNQTFQVWNFFTIDLDTC

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		367	2.2.26 [Sep-21-2011]
Q6IP50		296	UBX domain-containing pro	N/A	no	0.457	0.567	0.367	3e-17
Q6GL77		287	UBX domain-containing pro	yes	no	0.441	0.564	0.378	1e-16
Q6NXA9		294	UBX domain-containing pro	yes	no	0.408	0.510	0.333	2e-15
Q6GLV4		290	UBX domain-containing pro	N/A	no	0.471	0.596	0.339	2e-14
Q499N6		297	UBX domain-containing pro	yes	no	0.446	0.552	0.381	1e-13
Q922Y1		297	UBX domain-containing pro	yes	no	0.446	0.552	0.376	2e-13
P56399		858	Ubiquitin carboxyl-termin	no	no	0.190	0.081	0.371	8e-10
P45974		858	Ubiquitin carboxyl-termin	yes	no	0.190	0.081	0.371	8e-10
Q5R407		858	Ubiquitin carboxyl-termin	yes	no	0.190	0.081	0.371	9e-10
Q32KW2		297	UBX domain-containing pro	yes	no	0.452	0.558	0.359	9e-10

>sp\|Q6IP50\|UBX1A_XENLA UBX domain-containing protein 1-A OS=Xenopus laevis GN=ubxn1-a PE=2 SV=1	Back alignment and function desciption

 Score = 89.7 bits (221), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 75/204 (36%), Positives = 106/204 (51%), Gaps = 36/204 (17%)

Query: 118 LKELEAMGFPVARATRALHYSGNANVEAAVNWVVEHENDPDIDEMPMVPVSGGGGASKSS 177
           L+ L  MGF   RA +AL  +GN  +E A++W+VEHE+DPDIDE P V V  G     + 
Sbjct: 7   LESLIEMGFSSTRAEKALTATGNQGIEPAMDWLVEHEDDPDIDE-PSVVVPEGSSTDTAD 65

Query: 178 LTPEEIKLKAQELRERARK------KKEEEEKRM------------------EREREKER 213
            T        Q +   A +      +KE++ KRM                    E+EK+R
Sbjct: 66  TTDTTDTTDTQGMDTSAERLPLTEEEKEKQTKRMMELVAQKQNEREEREKKERIEQEKQR 125

Query: 214 IRIGKELLEAKRIEEENERKRILALRKAEKEEEKRAREKIRQKLEEDKAERRRRLG---- 269
            + G+EL   K+  +E E ++    R+ EK+EEK ARE++R+K+  DKA+R RR G    
Sbjct: 126 RKHGQELSAIKQKMQEQEMQKAAEDRRREKQEEKMARERVREKIARDKADRARRFGGASS 185

Query: 270 ---LPPED---PATTKS-SAPVVE 286
               PP +   PATT S S+PV E
Sbjct: 186 EPISPPAETSIPATTPSPSSPVQE 209

Component of a complex required to couple deglycosylation and proteasome-mediated degradation of misfolded proteins in the endoplasmic reticulun that are retrotranslocated in the cytosol. Involved in ubiquitin-proteasome systems.
Xenopus laevis (taxid: 8355)

>sp\|Q6GL77\|UBXN1_XENTR UBX domain-containing protein 1 OS=Xenopus tropicalis GN=ubxn1 PE=2 SV=1	Back alignment and function description

>sp\|Q6NXA9\|UBXN1_DANRE UBX domain-containing protein 1 OS=Danio rerio GN=ubxn1 PE=2 SV=1	Back alignment and function description

>sp\|Q6GLV4\|UBX1B_XENLA UBX domain-containing protein 1-B OS=Xenopus laevis GN=ubxn1-b PE=2 SV=1	Back alignment and function description

>sp\|Q499N6\|UBXN1_RAT UBX domain-containing protein 1 OS=Rattus norvegicus GN=Ubxn1 PE=2 SV=2	Back alignment and function description

>sp\|Q922Y1\|UBXN1_MOUSE UBX domain-containing protein 1 OS=Mus musculus GN=Ubxn1 PE=1 SV=1	Back alignment and function description

>sp\|P56399\|UBP5_MOUSE Ubiquitin carboxyl-terminal hydrolase 5 OS=Mus musculus GN=Usp5 PE=1 SV=1	Back alignment and function description

>sp\|P45974\|UBP5_HUMAN Ubiquitin carboxyl-terminal hydrolase 5 OS=Homo sapiens GN=USP5 PE=1 SV=2	Back alignment and function description

>sp\|Q5R407\|UBP5_PONAB Ubiquitin carboxyl-terminal hydrolase 5 OS=Pongo abelii GN=UBP5 PE=2 SV=1	Back alignment and function description

>sp\|Q32KW2\|UBXN1_BOVIN UBX domain-containing protein 1 OS=Bos taurus GN=UBXN1 PE=2 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		367
225433606		413	PREDICTED: uncharacterized protein LOC10	0.967	0.859	0.830	1e-170
224140845		414	predicted protein [Populus trichocarpa]	0.967	0.857	0.853	1e-154
224060373		415	predicted protein [Populus trichocarpa]	0.953	0.843	0.831	1e-149
427199320		411	ubiquitin-associated/TS-N domain-contain	0.961	0.858	0.836	1e-147
356525231		415	PREDICTED: UBX domain-containing protein	0.964	0.853	0.807	1e-145
356512473		415	PREDICTED: UBX domain-containing protein	0.964	0.853	0.801	1e-137
449442391		411	PREDICTED: uncharacterized protein LOC10	0.961	0.858	0.802	1e-136
18390444		413	ubiquitin-associated (UBA)/TS-N domain-c	0.961	0.854	0.803	1e-136
297848730		413	ubiquitin-associated /TS-N domain-contai	0.961	0.854	0.798	1e-136
388495734		410	unknown [Lotus japonicus]	0.959	0.858	0.791	1e-134

>gi\|225433606\|ref\|XP_002273725.1\| PREDICTED: uncharacterized protein LOC100248761 [Vitis vinifera] gi\|298205155\|emb\|CBI17214.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

 Score =  604 bits (1557), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 295/355 (83%), Positives = 327/355 (92%)

Query: 1   MAGVSLKCGDCGALLRSVQEAQEHAELTSHSNFSESTEAVLNLVCATCGKPCRSKTETDL 60
           MAGVSLKCGDCGALL+SV+EAQEHAELTSHSNFSESTEAVLNL+C  C KPCRSKTE+DL
Sbjct: 1   MAGVSLKCGDCGALLKSVEEAQEHAELTSHSNFSESTEAVLNLICTICSKPCRSKTESDL 60

Query: 61  HRKRTGHTDFVDKTSEAAKPISLEVPKATADSEEAIDVDMSGSQPEEMVEPEVDKELLKE 120
           H KRTGHT+FVDKTSEAAKPISLEVPKAT +S+E +D   S SQP+EM+ PEVDK+LL+E
Sbjct: 61  HTKRTGHTEFVDKTSEAAKPISLEVPKATDESQEVVDASGSSSQPQEMIAPEVDKKLLEE 120

Query: 121 LEAMGFPVARATRALHYSGNANVEAAVNWVVEHENDPDIDEMPMVPVSGGGGASKSSLTP 180
           LEAMGFP ARATRALHYSGN ++EAAVNWVVEHEND DIDEMP+VPV+    A K SLTP
Sbjct: 121 LEAMGFPTARATRALHYSGNTSLEAAVNWVVEHENDSDIDEMPLVPVNTKVEAPKPSLTP 180

Query: 181 EEIKLKAQELRERARKKKEEEEKRMEREREKERIRIGKELLEAKRIEEENERKRILALRK 240
           EE+K+KAQELRERARKKKEEE+KRMERE+EKERIR+GKELLEAKRIEEENERKRILALR+
Sbjct: 181 EEMKIKAQELRERARKKKEEEDKRMEREKEKERIRVGKELLEAKRIEEENERKRILALRR 240

Query: 241 AEKEEEKRAREKIRQKLEEDKAERRRRLGLPPEDPATTKSSAPVVEEKKSMLPIRPATKV 300
           AEKEEE+RAREKIRQKLEEDKAERRR+LGLPPEDPA  K SA VV+EKK+ LP++P TKV
Sbjct: 241 AEKEEEQRAREKIRQKLEEDKAERRRKLGLPPEDPAAVKPSASVVQEKKTFLPVKPVTKV 300

Query: 301 EQMRECLRSLKQNHKDDDAKVKRAFQTLLTYIGNVAKNPNEEKFRKIRLSNQTFQ 355
           EQMRECLRSLKQNHKD+DAKVKRAF TLLTYIGNVAKNP+EEKFRKIRL+N +FQ
Sbjct: 301 EQMRECLRSLKQNHKDEDAKVKRAFHTLLTYIGNVAKNPDEEKFRKIRLTNPSFQ 355

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|224140845\|ref\|XP_002323789.1\| predicted protein [Populus trichocarpa] gi\|222866791\|gb\|EEF03922.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|224060373\|ref\|XP_002300167.1\| predicted protein [Populus trichocarpa] gi\|118482259\|gb\|ABK93057.1\| unknown [Populus trichocarpa] gi\|222847425\|gb\|EEE84972.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|427199320\|gb\|AFY26887.1\| ubiquitin-associated/TS-N domain-containing protein [Morella rubra]	Back alignment and taxonomy information

>gi\|356525231\|ref\|XP_003531230.1\| PREDICTED: UBX domain-containing protein 1-A-like [Glycine max]	Back alignment and taxonomy information

>gi\|356512473\|ref\|XP_003524943.1\| PREDICTED: UBX domain-containing protein 1-A-like [Glycine max]	Back alignment and taxonomy information

>gi\|449442391\|ref\|XP_004138965.1\| PREDICTED: uncharacterized protein LOC101215434 [Cucumis sativus] gi\|449505284\|ref\|XP_004162425.1\| PREDICTED: uncharacterized LOC101215434 [Cucumis sativus]	Back alignment and taxonomy information

>gi|18390444|ref|NP_563718.1| ubiquitin-associated (UBA)/TS-N domain-containing protein [Arabidopsis thaliana] gi|7211981|gb|AAF40452.1|AC004809_10 ESTs gb|N65605, gb|N38087, gb|T20485, gb|T13726, gb|N38339, gb|F15440 and gb|N97201 come from this gene [Arabidopsis thaliana] gi|17065066|gb|AAL32687.1| Unknown protein [Arabidopsis thaliana] gi|21594053|gb|AAM65971.1| unknown [Arabidopsis thaliana] gi|23197878|gb|AAN15466.1| Unknown protein [Arabidopsis thaliana] gi|332189630|gb|AEE27751.1| ubiquitin-associated (UBA)/TS-N domain-containing protein [Arabidopsis thaliana]

Back alignment and taxonomy information

>gi\|297848730\|ref\|XP_002892246.1\| ubiquitin-associated /TS-N domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi\|297338088\|gb\|EFH68505.1\| ubiquitin-associated /TS-N domain-containing protein [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|388495734\|gb\|AFK35933.1\| unknown [Lotus japonicus]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		367
TAIR\|locus:2010637		413	AT1G04850 [Arabidopsis thalian	0.506	0.450	0.654	1.2e-106
TAIR\|locus:2156489		323	AT5G48690 "AT5G48690" [Arabido	0.267	0.303	0.485	1.1e-29
UNIPROTKB\|G4MXB0		787	MGG_08270 "Ubiquitin carboxyl-	0.405	0.189	0.282	5.3e-05
UNIPROTKB\|G4N023		316	MGG_06184 "Uncharacterized pro	0.307	0.357	0.302	0.00015
WB\|WBGene00017733		299	ubxn-1 [Caenorhabditis elegans	0.242	0.297	0.315	0.00059
UNIPROTKB\|Q9TXH9		299	ubxn-1 "Protein UBXN-1" [Caeno	0.242	0.297	0.315	0.00059

TAIR\|locus:2010637 AT1G04850 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 628 (226.1 bits), Expect = 1.2e-106, Sum P(2) = 1.2e-106
 Identities = 123/188 (65%), Positives = 140/188 (74%)

Query:     1 MAGVSLKCGDCGALLRSVQEAQEHAELTSHSNFSESTEAVLNLVCATCGKPCRSKTETDL 60
             MAGVSLKCGDCG LL+SV+EAQEHAELTSHSNF+ESTEAVLNLVC TC KPCRSK E+DL
Sbjct:     1 MAGVSLKCGDCGTLLKSVEEAQEHAELTSHSNFAESTEAVLNLVCTTCTKPCRSKIESDL 60

Query:    61 HRKRTGHTDFVDKTSEAAKPISLEVPKATADSEEAIDVDMSGSQPEEMVEPEVDKELLKE 120
             H KRTGHT+FVDKT E  KPISLE PK   + ++  +   SG   EEMV P+VD  +L+E
Sbjct:    61 HTKRTGHTEFVDKTLETIKPISLEAPKVAMEIDD--NASGSGEAAEEMVVPDVDNNILEE 118

Query:   121 LEAMGFPVARATRALHYSGXXXXXXXXXXXXXXXXDPDIDEMPMVPVSGGGGASKSSLTP 180
             LEAMGFP ARATRALHYSG                DPD+DEMP VP +   G +K +LTP
Sbjct:   119 LEAMGFPKARATRALHYSGNASLEAAVNWVVEHENDPDVDEMPKVPSNSNVGPAKPALTP 178

Query:   181 EEIKLKAQ 188
             EE+KLKAQ
Sbjct:   179 EEVKLKAQ 186

GO:0005737 "cytoplasm" evidence=ISM

GO:0008150 "biological_process" evidence=ND

GO:0008270 "zinc ion binding" evidence=IEA

GO:0005829 "cytosol" evidence=IDA

GO:0006486 "protein glycosylation" evidence=RCA

GO:0006623 "protein targeting to vacuole" evidence=RCA

TAIR\|locus:2156489 AT5G48690 "AT5G48690" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|G4MXB0 MGG_08270 "Ubiquitin carboxyl-terminal hydrolase" [Magnaporthe oryzae 70-15 (taxid:242507)]	Back alignment and assigned GO terms

UNIPROTKB\|G4N023 MGG_06184 "Uncharacterized protein" [Magnaporthe oryzae 70-15 (taxid:242507)]	Back alignment and assigned GO terms

WB\|WBGene00017733 ubxn-1 [Caenorhabditis elegans (taxid:6239)]	Back alignment and assigned GO terms

UNIPROTKB\|Q9TXH9 ubxn-1 "Protein UBXN-1" [Caenorhabditis elegans (taxid:6239)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	GSVIVG00038843001	SubName- Full=Chromosome chr5 scaffold_98, whole genome shotgun sequence; (413 aa)
		(Vitis vinifera)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		367
cd10461		107	cd10461, PUB_UBA_plant, PNGase/UBA or UBX (PUB) do	6e-24
cd09212		96	cd09212, PUB, PNGase/UBA or UBX (PUB) domain of p9	1e-11
pfam09409		85	pfam09409, PUB, PUB domain	2e-10
cd10460		102	cd10460, PUB_UBXD1, PNGase/UBA or UBX (PUB) domain	3e-09
cd10463		96	cd10463, PUB_WLM, PNGase/UBA or UBX (PUB) domain o	9e-08
cd10462		100	cd10462, PUB_UBA, PNGase/UBA or UBX (PUB) domain o	1e-07
COG5207		749	COG5207, UBP14, Isopeptidase T [Posttranslational	1e-07
cd00194		38	cd00194, UBA, Ubiquitin Associated domain	5e-07
cd10459		93	cd10459, PUB_PNGase, PNGase/UBA or UBX (PUB) domai	7e-07
pfam00627		37	pfam00627, UBA, UBA/TS-N domain	1e-05
smart00165		37	smart00165, UBA, Ubiquitin associated domain	1e-04
PTZ00121		2084	PTZ00121, PTZ00121, MAEBL; Provisional	2e-04
pfam07946		322	pfam07946, DUF1682, Protein of unknown function (D	4e-04
pfam07227		446	pfam07227, DUF1423, Protein of unknown function (D	4e-04
PTZ00266		1021	PTZ00266, PTZ00266, NIMA-related protein kinase; P	5e-04
PRK12704		520	PRK12704, PRK12704, phosphodiesterase; Provisional	6e-04
PTZ00121		2084	PTZ00121, PTZ00121, MAEBL; Provisional	8e-04
PTZ00121		2084	PTZ00121, PTZ00121, MAEBL; Provisional	0.001
PTZ00121		2084	PTZ00121, PTZ00121, MAEBL; Provisional	0.002
pfam07767		387	pfam07767, Nop53, Nop53 (60S ribosomal biogenesis)	0.002
PTZ00121		2084	PTZ00121, PTZ00121, MAEBL; Provisional	0.003
PRK12705		508	PRK12705, PRK12705, hypothetical protein; Provisio	0.003
PTZ00121		2084	PTZ00121, PTZ00121, MAEBL; Provisional	0.004

>gnl\|CDD\|198419 cd10461, PUB_UBA_plant, PNGase/UBA or UBX (PUB) domain of plant Ubiquitin-associated (UBA) domain containing proteins	Back alignment and domain information

 Score = 94.4 bits (235), Expect = 6e-24
 Identities = 35/49 (71%), Positives = 40/49 (81%)

Query: 307 LRSLKQNHKDDDAKVKRAFQTLLTYIGNVAKNPNEEKFRKIRLSNQTFQ 355
           L  LK+ HKDD   VK AFQTLLTY+GNVAKNP+EEKFR+IRL+N  FQ
Sbjct: 1   LVDLKKAHKDDPDAVKTAFQTLLTYLGNVAKNPDEEKFRRIRLTNAAFQ 49

The PUB domain functions as a p97 (also known as valosin-containing protein or VCP) adaptor by interacting with the D1 and/or D2 ATPase domains. The type II AAA+ ATPase p97 is involved in a variety of cellular processes such as the deglycosylation of ERAD substrates, membrane fusion, transcription factor activation and cell cycle regulation through differential binding to specific adaptor proteins. The UBA domain, along with UBL (ubiquitin-like) domain, has been implicated in proteasomal degradation by associating with substrates destined for degradation as well as with subunits of the proteasome, thus regulating protein turnover. This family contains only plant UBA domain-containing proteins. Length = 107

>gnl\|CDD\|198416 cd09212, PUB, PNGase/UBA or UBX (PUB) domain of p97 adaptor proteins	Back alignment and domain information

>gnl\|CDD\|220225 pfam09409, PUB, PUB domain	Back alignment and domain information

>gnl\|CDD\|198418 cd10460, PUB_UBXD1, PNGase/UBA or UBX (PUB) domain of UBXD1	Back alignment and domain information

>gnl\|CDD\|198421 cd10463, PUB_WLM, PNGase/UBA or UBX (PUB) domain of the Wss1p-like metalloprotease (WLM) family	Back alignment and domain information

>gnl\|CDD\|198420 cd10462, PUB_UBA, PNGase/UBA or UBX (PUB) domain of Ubiquitin-associated (UBA) domain containing proteins	Back alignment and domain information

>gnl\|CDD\|227532 COG5207, UBP14, Isopeptidase T [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|238116 cd00194, UBA, Ubiquitin Associated domain	Back alignment and domain information

>gnl\|CDD\|198417 cd10459, PUB_PNGase, PNGase/UBA or UBX (PUB) domain of the P97 adaptor protein Peptide:N-glycanase (PNGase)	Back alignment and domain information

>gnl\|CDD\|201355 pfam00627, UBA, UBA/TS-N domain	Back alignment and domain information

>gnl\|CDD\|197551 smart00165, UBA, Ubiquitin associated domain	Back alignment and domain information

>gnl\|CDD\|173412 PTZ00121, PTZ00121, MAEBL; Provisional	Back alignment and domain information

>gnl\|CDD\|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682)	Back alignment and domain information

>gnl\|CDD\|219342 pfam07227, DUF1423, Protein of unknown function (DUF1423)	Back alignment and domain information

>gnl\|CDD\|173502 PTZ00266, PTZ00266, NIMA-related protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|237177 PRK12704, PRK12704, phosphodiesterase; Provisional	Back alignment and domain information

>gnl\|CDD\|173412 PTZ00121, PTZ00121, MAEBL; Provisional	Back alignment and domain information

>gnl\|CDD\|173412 PTZ00121, PTZ00121, MAEBL; Provisional	Back alignment and domain information

>gnl\|CDD\|173412 PTZ00121, PTZ00121, MAEBL; Provisional	Back alignment and domain information

>gnl\|CDD\|219563 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis)	Back alignment and domain information

>gnl\|CDD\|173412 PTZ00121, PTZ00121, MAEBL; Provisional	Back alignment and domain information

>gnl\|CDD\|237178 PRK12705, PRK12705, hypothetical protein; Provisional	Back alignment and domain information

>gnl\|CDD\|173412 PTZ00121, PTZ00121, MAEBL; Provisional	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		367
KOG0944		763	consensus Ubiquitin-specific protease UBP14 [Postt	99.97
KOG2689		290	consensus Predicted ubiquitin regulatory protein [	99.96
COG5207		749	UBP14 Isopeptidase T [Posttranslational modificati	99.94
KOG2507		506	consensus Ubiquitin regulatory protein UBXD2, cont	99.7
KOG2699		407	consensus Predicted ubiquitin regulatory protein [	99.56
PF09409		87	PUB: PUB domain; InterPro: IPR018997 The PUB (also	99.03
PF00627		37	UBA: UBA/TS-N domain; InterPro: IPR000449 UBA doma	98.94
cd00194		38	UBA Ubiquitin Associated domain. The UBA domain is	98.77
smart00165		37	UBA Ubiquitin associated domain. Present in Rad23,	98.76
KOG0944		763	consensus Ubiquitin-specific protease UBP14 [Postt	98.46
smart00580		58	PUG domain in protein kinases, N-glycanases and ot	97.89
cd02664		327	Peptidase_C19H A subfamily of Peptidase C19. Pepti	97.81
cd02668		324	Peptidase_C19L A subfamily of Peptidase C19. Pepti	97.77
cd02667		279	Peptidase_C19K A subfamily of Peptidase C19. Pepti	97.72
cd02660		328	Peptidase_C19D A subfamily of Peptidase C19. Pepti	97.7
cd02663		300	Peptidase_C19G A subfamily of Peptidase C19. Pepti	97.54
cd02657		305	Peptidase_C19A A subfamily of Peptidase C19. Pepti	97.49
cd02658		311	Peptidase_C19B A subfamily of Peptidase C19. Pepti	97.46
cd02661		304	Peptidase_C19E A subfamily of Peptidase C19. Pepti	97.45
cd02659		334	peptidase_C19C A subfamily of Peptidase C19. Pepti	97.4
cd02674		230	Peptidase_C19R A subfamily of peptidase C19. Pepti	97.27
cd02673		245	Peptidase_C19Q A subfamily of Peptidase C19. Pepti	97.13
TIGR00601		378	rad23 UV excision repair protein Rad23. All protei	97.01
KOG1865		545	consensus Ubiquitin carboxyl-terminal hydrolase [P	96.84
COG5207		749	UBP14 Isopeptidase T [Posttranslational modificati	96.69
cd02671		332	Peptidase_C19O A subfamily of Peptidase C19. Pepti	96.64
KOG4598		1203	consensus Putative ubiquitin-specific protease [Po	95.9
COG5533		415	UBP5 Ubiquitin C-terminal hydrolase [Posttranslati	95.85
cd02662		240	Peptidase_C19F A subfamily of Peptidase C19. Pepti	95.77
KOG2561		568	consensus Adaptor protein NUB1, contains UBA domai	95.45
TIGR00601		378	rad23 UV excision repair protein Rad23. All protei	95.35
KOG0011		340	consensus Nucleotide excision repair factor NEF2,	94.68
cd02257		255	Peptidase_C19 Peptidase C19 contains ubiquitinyl h	94.58
cd02672		268	Peptidase_C19P A subfamily of Peptidase C19. Pepti	94.55
KOG0011		340	consensus Nucleotide excision repair factor NEF2,	94.5
KOG1866		944	consensus Ubiquitin carboxyl-terminal hydrolase [P	93.5
PF09288		55	UBA_3: Fungal ubiquitin-associated domain ; InterP	93.41
cd02669		440	Peptidase_C19M A subfamily of Peptidase C19. Pepti	93.4
KOG0163		1259	consensus Myosin class VI heavy chain [Cytoskeleto	92.36
PTZ00266		1021	NIMA-related protein kinase; Provisional	91.94
smart00546		43	CUE Domain that may be involved in binding ubiquit	91.2
COG1773		55	Rubredoxin [Energy production and conversion]	90.35
KOG2561		568	consensus Adaptor protein NUB1, contains UBA domai	90.15
COG5560		823	UBP12 Ubiquitin C-terminal hydrolase [Posttranslat	89.97
PF08882		112	Acetone_carb_G: Acetone carboxylase gamma subunit;	89.87
PF00443		269	UCH: Ubiquitin carboxyl-terminal hydrolase; InterP	89.76
PF02845		42	CUE: CUE domain; InterPro: IPR003892 This domain m	89.14
PF14555		43	UBA_4: UBA-like domain; PDB: 2DAL_A 3BQ3_A 2L4E_A	88.17
PF12756		100	zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB:	88.02
cd00730		50	rubredoxin Rubredoxin; nonheme iron binding domain	87.57
KOG1029		1118	consensus Endocytic adaptor protein intersectin [S	87.3
KOG0163		1259	consensus Myosin class VI heavy chain [Cytoskeleto	87.23
PF05672		171	MAP7: MAP7 (E-MAP-115) family; InterPro: IPR008604	87.2
KOG1868		653	consensus Ubiquitin C-terminal hydrolase [Posttran	86.51
KOG0418		200	consensus Ubiquitin-protein ligase [Posttranslatio	86.13
cd00350		33	rubredoxin_like Rubredoxin_like; nonheme iron bind	85.93
KOG2699		407	consensus Predicted ubiquitin regulatory protein [	85.8
KOG1029		1118	consensus Endocytic adaptor protein intersectin [S	85.47
cd02670		241	Peptidase_C19N A subfamily of Peptidase C19. Pepti	85.23
PF07499		47	RuvA_C: RuvA, C-terminal domain; InterPro: IPR0111	85.19
PF00301		47	Rubredoxin: Rubredoxin; InterPro: IPR004039 Rubred	84.48
PRK03824		135	hypA hydrogenase nickel incorporation protein; Pro	80.17

>KOG0944 consensus Ubiquitin-specific protease UBP14 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

Probab=99.97  E-value=2.9e-31  Score=274.81  Aligned_cols=158  Identities=29%  Similarity=0.431  Sum_probs=131.7

Q ss_pred             CceeecCCCcccccchHHHHH---------------HHhhhccCCCCcchhhhhhcccccCCCCCCCccccccccccccc
Q 017706            3 GVSLKCGDCGALLRSVQEAQE---------------HAELTSHSNFSESTEAVLNLVCATCGKPCRSKTETDLHRKRTGH   67 (367)
Q Consensus         3 ~~~l~C~~C~~v~~g~~~aq~---------------h~~~tgh~~F~e~~e~v~~~~C~~Cg~~~~~~~e~~~a~K~t~f   67 (367)
                      .-|++|..|+.|.+....-.-               -..+...++|..   .+.+|+|++||.+       +.|+|+|+|
T Consensus       438 e~Rv~C~~c~kVrYs~~~~~~i~lpv~~~~~v~~~v~~~~cleaff~p---q~~df~s~ac~~K-------~~a~kt~~~  507 (763)
T KOG0944|consen  438 EDRVSCLGCRKVRYSYESEYLIQLPVPMTNEVREKVPISACLEAFFEP---QVDDFWSTACGEK-------KGATKTTRF  507 (763)
T ss_pred             hhhhhhhccccccccchhheeeEeeccccccccccCCHHHHHHHhcCC---cchhhhhHhhcCc-------ccccccccc
Confidence            348999999999955443211               011122334444   3789999999988       899999999


Q ss_pred             cccccchhcccccccccc--Cccc---cCCccccccCCC---CC-CCCcc--------cccccCHHHHHHHHhCCCCHHH
Q 017706           68 TDFVDKTSEAAKPISLEV--PKAT---ADSEEAIDVDMS---GS-QPEEM--------VEPEVDKELLKELEAMGFPVAR  130 (367)
Q Consensus        68 ~tFP~~L~v~~~r~~l~~--p~K~---~~~~~~ldl~~~---g~-~~ee~--------~~~~~d~~~l~~L~~MGF~~~~  130 (367)
                      +|||+||+||+.||.|.+  |+|+   +.||+.|||+.|   |+ |+|+.        +.+.+|+.++.+|++||||.++
T Consensus       508 ksfP~yLiiqv~rf~~~dw~pkKld~~iempe~ldls~~rs~g~~p~ee~lpde~~~~~~~~~d~s~i~qL~~MGFp~ea  587 (763)
T KOG0944|consen  508 KSFPDYLIIQVGRFTLQDWVPKKLDVSIEMPEELDLSSYRSKGLQPGEEALPDEAPETSEFAADRSVISQLVEMGFPEEA  587 (763)
T ss_pred             ccCCceEEEEeeEEEecCceeeeeccceecchhhchhhhhhcCCCCcccccCCcCcccCccchhHHHHHHHHHcCCCHHH
Confidence            999999999999999986  9999   779999999987   65 66642        4455899999999999999999


Q ss_pred             HHHHHHHhCCCCHHHHHHHHHHhcCCCCCCCCCCCCCCCC
Q 017706          131 ATRALHYSGNANVEAAVNWVVEHENDPDIDEMPMVPVSGG  170 (367)
Q Consensus       131 a~kAL~~tgn~~~E~A~~Wl~~h~dd~d~dep~~~~~~~~  170 (367)
                      |.|||++|||+++|+|++||++||+|||+++|+.+|+++.
T Consensus       588 c~rAly~tgN~~aEaA~NWl~~HMdDpd~~~p~vvp~~~~  627 (763)
T KOG0944|consen  588 CRRALYYTGNSGAEAASNWLMEHMDDPDIDDPFVVPGNSP  627 (763)
T ss_pred             HHHHHhhhcCccHHHHHHHHHHhccCcccCCceecCCCCC
Confidence            9999999999999999999999999999999999988653

>KOG2689 consensus Predicted ubiquitin regulatory protein [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG5207 UBP14 Isopeptidase T [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2507 consensus Ubiquitin regulatory protein UBXD2, contains UAS and UBX domains [General function prediction only]	Back alignment and domain information

>KOG2699 consensus Predicted ubiquitin regulatory protein [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF09409 PUB: PUB domain; InterPro: IPR018997 The PUB (also known as PUG) domain is found in peptide N-glycanase where it functions as a AAA ATPase binding domain []	Back alignment and domain information

>PF00627 UBA: UBA/TS-N domain; InterPro: IPR000449 UBA domains are a commonly occurring sequence motif of approximately 45 amino acid residues that are found in diverse proteins involved in the ubiquitin/proteasome pathway, DNA excision-repair, and cell signalling via protein kinases []	Back alignment and domain information

>cd00194 UBA Ubiquitin Associated domain	Back alignment and domain information

>smart00165 UBA Ubiquitin associated domain	Back alignment and domain information

>KOG0944 consensus Ubiquitin-specific protease UBP14 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>smart00580 PUG domain in protein kinases, N-glycanases and other nuclear proteins	Back alignment and domain information

>cd02664 Peptidase_C19H A subfamily of Peptidase C19	Back alignment and domain information

>cd02668 Peptidase_C19L A subfamily of Peptidase C19	Back alignment and domain information

>cd02667 Peptidase_C19K A subfamily of Peptidase C19	Back alignment and domain information

>cd02660 Peptidase_C19D A subfamily of Peptidase C19	Back alignment and domain information

>cd02663 Peptidase_C19G A subfamily of Peptidase C19	Back alignment and domain information

>cd02657 Peptidase_C19A A subfamily of Peptidase C19	Back alignment and domain information

>cd02658 Peptidase_C19B A subfamily of Peptidase C19	Back alignment and domain information

>cd02661 Peptidase_C19E A subfamily of Peptidase C19	Back alignment and domain information

>cd02659 peptidase_C19C A subfamily of Peptidase C19	Back alignment and domain information

>cd02674 Peptidase_C19R A subfamily of peptidase C19	Back alignment and domain information

>cd02673 Peptidase_C19Q A subfamily of Peptidase C19	Back alignment and domain information

>TIGR00601 rad23 UV excision repair protein Rad23	Back alignment and domain information

>KOG1865 consensus Ubiquitin carboxyl-terminal hydrolase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG5207 UBP14 Isopeptidase T [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd02671 Peptidase_C19O A subfamily of Peptidase C19	Back alignment and domain information

>KOG4598 consensus Putative ubiquitin-specific protease [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG5533 UBP5 Ubiquitin C-terminal hydrolase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd02662 Peptidase_C19F A subfamily of Peptidase C19	Back alignment and domain information

>KOG2561 consensus Adaptor protein NUB1, contains UBA domain [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms]	Back alignment and domain information

>TIGR00601 rad23 UV excision repair protein Rad23	Back alignment and domain information

>KOG0011 consensus Nucleotide excision repair factor NEF2, RAD23 component [Replication, recombination and repair]	Back alignment and domain information

>cd02257 Peptidase_C19 Peptidase C19 contains ubiquitinyl hydrolases	Back alignment and domain information

>cd02672 Peptidase_C19P A subfamily of Peptidase C19	Back alignment and domain information

>KOG0011 consensus Nucleotide excision repair factor NEF2, RAD23 component [Replication, recombination and repair]	Back alignment and domain information

>KOG1866 consensus Ubiquitin carboxyl-terminal hydrolase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF09288 UBA_3: Fungal ubiquitin-associated domain ; InterPro: IPR015368 This C-terminal domain is found in ubiquitin binding proteins, it adopts a structure consisting of a three alpha-helix bundle	Back alignment and domain information

>cd02669 Peptidase_C19M A subfamily of Peptidase C19	Back alignment and domain information

>KOG0163 consensus Myosin class VI heavy chain [Cytoskeleton]	Back alignment and domain information

>PTZ00266 NIMA-related protein kinase; Provisional	Back alignment and domain information

>smart00546 CUE Domain that may be involved in binding ubiquitin-conjugating enzymes (UBCs)	Back alignment and domain information

>COG1773 Rubredoxin [Energy production and conversion]	Back alignment and domain information

>KOG2561 consensus Adaptor protein NUB1, contains UBA domain [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms]	Back alignment and domain information

>COG5560 UBP12 Ubiquitin C-terminal hydrolase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF08882 Acetone_carb_G: Acetone carboxylase gamma subunit; InterPro: IPR014979 Acetone carboxylase is the key enzyme of bacterial acetone metabolism, catalysing the condensation of acetone and CO2 to form acetoacetate [] according to the following reaction: CH3COCH3 + CO2 + ATP = CH3COCH2COO- + AMP + 2P(i) + H+ It has the subunit composition: (alpha(2)beta(2)gamma(2) multimers of 85kDa, 78kDa, and 20kDa subunits)

Back alignment and domain information

>PF00443 UCH: Ubiquitin carboxyl-terminal hydrolase; InterPro: IPR001394 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families	Back alignment and domain information

>PF02845 CUE: CUE domain; InterPro: IPR003892 This domain may be involved in binding ubiquitin-conjugating enzymes (UBCs)	Back alignment and domain information

>PF14555 UBA_4: UBA-like domain; PDB: 2DAL_A 3BQ3_A 2L4E_A 2L4F_A 2DZL_A 2L2D_A 2DAM_A 1V92_A 3E21_A	Back alignment and domain information

>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A	Back alignment and domain information

>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center	Back alignment and domain information

>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0163 consensus Myosin class VI heavy chain [Cytoskeleton]	Back alignment and domain information

>PF05672 MAP7: MAP7 (E-MAP-115) family; InterPro: IPR008604 The organisation of microtubules varies with the cell type and is presumably controlled by tissue-specific microtubule-associated proteins (MAPs)	Back alignment and domain information

>KOG1868 consensus Ubiquitin C-terminal hydrolase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0418 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center	Back alignment and domain information

>KOG2699 consensus Predicted ubiquitin regulatory protein [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>cd02670 Peptidase_C19N A subfamily of Peptidase C19	Back alignment and domain information

>PF07499 RuvA_C: RuvA, C-terminal domain; InterPro: IPR011114 In prokaryotes, RuvA, RuvB, and RuvC process the universal DNA intermediate of homologous recombination, termed Holliday junction	Back alignment and domain information

>PF00301 Rubredoxin: Rubredoxin; InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []	Back alignment and domain information

>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		367
2dag_A		74	Ubiquitin carboxyl-terminal hydrolase 5; isopeptid	4e-23
1vek_A		84	UBP14, ubiquitin-specific protease 14, putative; U	2e-22
1whc_A		64	RSGI RUH-027, UBA/UBX 33.3 kDa protein; UBA domain	7e-22
2crn_A		64	Ubash3A protein; compact three-helix bundle, struc	2e-21
2dai_A		83	Ubadc1, ubiquitin associated domain containing 1;	1e-19
2dak_A		63	Ubiquitin carboxyl-terminal hydrolase 5; isopeptid	7e-16
2cpw_A		64	CBL-interacting protein STS-1 variant; ubiquitin a	4e-15
3ihp_A		854	Ubiquitin carboxyl-terminal hydrolase 5; hydrolase	5e-13
3ihp_A		854	Ubiquitin carboxyl-terminal hydrolase 5; hydrolase	4e-07
1wiv_A		73	UBP14, ubiquitin-specific protease 14; ubiquitin a	1e-11
2ccq_A		99	P97, peptide N-glycanase homolog; glycoprotein; 1.	1e-11
2lbc_A		126	Ubiquitin carboxyl-terminal hydrolase 13; tandem U	2e-11
2lbc_A		126	Ubiquitin carboxyl-terminal hydrolase 13; tandem U	2e-07
2d5u_A		124	N-glycanase 1; pngase, hydrolase; NMR {Mus musculu	6e-11
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	1e-09
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	1e-04
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	8e-04
3by4_A		212	OTU1, ubiquitin thioesterase OTU1; ubiquitin hydro	1e-08
3lvg_D		190	LCB, clathrin light chain B; SELF assembly, coated	1e-07
3lvg_D		190	LCB, clathrin light chain B; SELF assembly, coated	4e-05
2zuo_A		861	MVP, major vault protein; repeat domains, protein-	9e-06
2zuo_A		861	MVP, major vault protein; repeat domains, protein-	3e-04
2zuo_A		861	MVP, major vault protein; repeat domains, protein-	7e-04
1i84_S		1184	Smooth muscle myosin heavy chain; muscle protein,	1e-05
1i84_S		1184	Smooth muscle myosin heavy chain; muscle protein,	1e-04
1i84_S		1184	Smooth muscle myosin heavy chain; muscle protein,	6e-04
4ae4_A		118	Ubiquitin-associated protein 1; protein transport,	3e-05
2dfs_A		1080	Myosin-5A; myosin-V, inhibited state, cryoelectron	4e-05
2dfs_A		1080	Myosin-5A; myosin-V, inhibited state, cryoelectron	4e-05
2dfs_A		1080	Myosin-5A; myosin-V, inhibited state, cryoelectron	6e-05
2dfs_A		1080	Myosin-5A; myosin-V, inhibited state, cryoelectron	8e-05
2dfs_A		1080	Myosin-5A; myosin-V, inhibited state, cryoelectron	1e-04
1g8x_A		1010	Myosin II heavy chain fused to alpha-actinin 3; mo	9e-05
1g8x_A		1010	Myosin II heavy chain fused to alpha-actinin 3; mo	2e-04
1w1w_A		430	Structural maintenance of chromosome 1; cohesin, c	1e-04
2qag_B		427	Septin-6, protein NEDD5; cell cycle, cell division	7e-04

>2dag_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5 (USP 5), UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74	Back alignment and structure

 Score = 90.7 bits (225), Expect = 4e-23
 Identities = 26/68 (38%), Positives = 43/68 (63%)

Query: 110 EPEVDKELLKELEAMGFPVARATRALHYSGNANVEAAVNWVVEHENDPDIDEMPMVPVSG 169
              +D+ ++ +L  MGFP+    +A++Y+GN+  EAA+NWV+ H +DPD     ++P S 
Sbjct: 5   SSGLDESVIIQLVEMGFPMDACRKAVYYTGNSGAEAAMNWVMSHMDDPDFANPLILPGSS 64

Query: 170 GGGASKSS 177
           G G+S  S
Sbjct: 65  GPGSSGPS 72

PyMOL of 2dag

>1vek_A UBP14, ubiquitin-specific protease 14, putative; UBA domain, three helix bundle, ubiquitin associated domain, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Length = 84	Back alignment and structure

>1whc_A RSGI RUH-027, UBA/UBX 33.3 kDa protein; UBA domain, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Mus musculus} SCOP: a.5.2.1 Length = 64	Back alignment and structure

>2crn_A Ubash3A protein; compact three-helix bundle, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 Length = 64	Back alignment and structure

>2dai_A Ubadc1, ubiquitin associated domain containing 1; UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 83	Back alignment and structure

>2dak_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5, USP 5, UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63	Back alignment and structure

>2cpw_A CBL-interacting protein STS-1 variant; ubiquitin associated domain, UBA, compact three helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.1 Length = 64	Back alignment and structure

>3ihp_A Ubiquitin carboxyl-terminal hydrolase 5; hydrolase, protease, thiol protease, UBL conjugation pathway, metal-binding, zinc-finger,structural genomics; 2.80A {Homo sapiens} Length = 854	Back alignment and structure

>3ihp_A Ubiquitin carboxyl-terminal hydrolase 5; hydrolase, protease, thiol protease, UBL conjugation pathway, metal-binding, zinc-finger,structural genomics; 2.80A {Homo sapiens} Length = 854	Back alignment and structure

>1wiv_A UBP14, ubiquitin-specific protease 14; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Length = 73	Back alignment and structure

>2ccq_A P97, peptide N-glycanase homolog; glycoprotein; 1.6A {Homo sapiens} SCOP: d.314.1.1 PDB: 2hpl_A 2hpj_A 2cm0_A Length = 99	Back alignment and structure

>2lbc_A Ubiquitin carboxyl-terminal hydrolase 13; tandem UBA of USP13; NMR {Homo sapiens} Length = 126	Back alignment and structure

>2lbc_A Ubiquitin carboxyl-terminal hydrolase 13; tandem UBA of USP13; NMR {Homo sapiens} Length = 126	Back alignment and structure

>2d5u_A N-glycanase 1; pngase, hydrolase; NMR {Mus musculus} SCOP: d.314.1.1 Length = 124	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>3by4_A OTU1, ubiquitin thioesterase OTU1; ubiquitin hydrolase, deubiquitinase, cell cycle, hydrolase; 1.55A {Saccharomyces cerevisiae} PDB: 3c0r_A Length = 212	Back alignment and structure

>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190	Back alignment and structure

>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190	Back alignment and structure

>2zuo_A MVP, major vault protein; repeat domains, protein-protein complex, cytoplasm, ribonucleoprotein, structural protein; 3.50A {Rattus norvegicus} PDB: 2zv4_N 2zv5_a 2qzv_A Length = 861	Back alignment and structure

>2zuo_A MVP, major vault protein; repeat domains, protein-protein complex, cytoplasm, ribonucleoprotein, structural protein; 3.50A {Rattus norvegicus} PDB: 2zv4_N 2zv5_a 2qzv_A Length = 861	Back alignment and structure

>2zuo_A MVP, major vault protein; repeat domains, protein-protein complex, cytoplasm, ribonucleoprotein, structural protein; 3.50A {Rattus norvegicus} PDB: 2zv4_N 2zv5_a 2qzv_A Length = 861	Back alignment and structure

>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184	Back alignment and structure

>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184	Back alignment and structure

>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184	Back alignment and structure

>4ae4_A Ubiquitin-associated protein 1; protein transport, endosomal sorting, tetherin, VPU, HIV-1, monoubiquitin; HET: NHE; 1.65A {Homo sapiens} PDB: 4ae4_B* Length = 118	Back alignment and structure

>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080	Back alignment and structure

>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080	Back alignment and structure

>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080	Back alignment and structure

>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080	Back alignment and structure

>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080	Back alignment and structure

>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010	Back alignment and structure

>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010	Back alignment and structure

>1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 Length = 430	Back alignment and structure

>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Length = 427	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		367
3ihp_A		854	Ubiquitin carboxyl-terminal hydrolase 5; hydrolase	99.83
2crn_A		64	Ubash3A protein; compact three-helix bundle, struc	99.72
1vek_A		84	UBP14, ubiquitin-specific protease 14, putative; U	99.65
2dag_A		74	Ubiquitin carboxyl-terminal hydrolase 5; isopeptid	99.65
1whc_A		64	RSGI RUH-027, UBA/UBX 33.3 kDa protein; UBA domain	99.6
2dak_A		63	Ubiquitin carboxyl-terminal hydrolase 5; isopeptid	99.6
2dai_A		83	Ubadc1, ubiquitin associated domain containing 1;	99.59
2lbc_A		126	Ubiquitin carboxyl-terminal hydrolase 13; tandem U	99.49
2cpw_A		64	CBL-interacting protein STS-1 variant; ubiquitin a	99.45
1wgn_A		63	UBAP1, ubiquitin associated protein; ubiquitin ass	99.4
1wji_A		63	Tudor domain containing protein 3; UBA domain, str	99.37
2d5u_A		124	N-glycanase 1; pngase, hydrolase; NMR {Mus musculu	99.36
2ccq_A		99	P97, peptide N-glycanase homolog; glycoprotein; 1.	99.36
1wiv_A		73	UBP14, ubiquitin-specific protease 14; ubiquitin a	99.27
2ekk_A		47	UBA domain from E3 ubiquitin-protein ligase HUWE1;	99.27
2dkl_A		85	Trinucleotide repeat containing 6C protein; TNRC6C	99.23
1dv0_A		47	DNA repair protein HHR23A; helical bundle, DNA bin	99.23
2g3q_A		43	Protein YBL047C; endocytosis, solution structure,	99.21
2cos_A		54	Serine/threonine protein kinase LATS2; UBA domain,	99.19
4ae4_A		118	Ubiquitin-associated protein 1; protein transport,	99.18
1veg_A		83	NEDD8 ultimate buster-1; ubiquitin associated doma	99.16
2lbc_A		126	Ubiquitin carboxyl-terminal hydrolase 13; tandem U	99.09
1ify_A		49	HHR23A, UV excision repair protein RAD23 homolog A	99.06
2jy5_A		52	Ubiquilin-1; UBA, alternative splicing, cytoplasm,	98.98
1vg5_A		73	RSGI RUH-014, rhomboid family protein; UBA domain,	98.95
2knz_A		53	Ubiquilin-4; cytoplasm, endoplasmic reticulum, nuc	98.95
1z96_A		40	DNA-damage, UBA-domain protein MUD1; ubiquitin, th	98.84
2dah_A		54	Ubiquilin-3; UBA domain, structural genomics, NPPS	98.75
2bwb_A		46	Ubiquitin-like protein DSK2; UBA, signaling protei	98.75
2dna_A		67	Unnamed protein product; ubiquitin associated doma	98.72
1vej_A		74	Riken cDNA 4931431F19; UBA domain, three helix bun	98.7
1wr1_B		58	Ubiquitin-like protein DSK2; UBA domain, UBA-ubiqu	98.67
4ae4_A		118	Ubiquitin-associated protein 1; protein transport,	98.52
1oqy_A		368	HHR23A, UV excision repair protein RAD23 homolog A	98.38
2ooa_A		52	E3 ubiquitin-protein ligase CBL-B; alpha-helical d	98.31
2cwb_A		108	Chimera of immunoglobulin G binding protein G and	98.21
2d9s_A		53	CBL E3 ubiquitin protein ligase; UBA domain, dimer	98.17
2juj_A		56	E3 ubiquitin-protein ligase CBL; alpha helix, UBA	98.16
1oqy_A		368	HHR23A, UV excision repair protein RAD23 homolog A	98.08
2oo9_A		46	E3 ubiquitin-protein ligase CBL; alpha-helical dom	97.95
3i3t_A		355	Ubiquitin carboxyl-terminal hydrolase 21; hydrolas	97.76
2ayn_A		404	Ubiquitin carboxyl-terminal hydrolase 14; deubiqui	97.68
2cp8_A		54	NEXT to BRCA1 gene 1 protein; UBA domain, structur	97.64
1wiv_A		73	UBP14, ubiquitin-specific protease 14; ubiquitin a	97.62
3ihp_A		854	Ubiquitin carboxyl-terminal hydrolase 5; hydrolase	97.61
3k9o_A		201	Ubiquitin-conjugating enzyme E2 K; E2-25K, complex	97.53
3mhs_A		476	Ubiquitin carboxyl-terminal hydrolase 8; multi-pro	97.51
2qsf_X		171	RAD23, UV excision repair protein RAD23; alpha-bet	97.48
3nhe_A		348	Ubiquitin carboxyl-terminal hydrolase 2; cysteine	97.35
1wj7_A		104	Hypothetical protein (RSGI RUH-015); UBA domain, u	97.21
1vjv_A		415	Ubiquitin carboxyl-terminal hydrolase 6; YFR010W,	97.19
2y6e_A		367	Ubiquitin carboxyl-terminal hydrolase 4; HET: CME;	97.17
1nb8_A		353	Ubiquitin carboxyl-terminal hydrolase 7; UBP, deub	97.11
2gfo_A		396	Ubiquitin carboxyl-terminal hydrolase 8; protease,	96.9
2f1z_A		522	Ubiquitin carboxyl-terminal hydrolase 7; hausp, US	96.22
3e46_A		253	Ubiquitin-conjugating enzyme E2-25 kDa; huntington	95.62
1wgl_A		59	TOLL-interacting protein; CUE domain, structural g	94.11
2cp9_A		64	EF-TS, EF-TSMT, elongation factor TS, mitochondria	93.78
1q02_A		52	Sequestosome 1; helical bundle, protein binding; N	89.86
2drp_A		66	Protein (tramtrack DNA-binding domain); protein-DN	89.28
6rxn_A		46	Rubredoxin; electron transfer(iron-sulfur protein)	88.87
2dhy_A		67	CUE domain-containing protein 1; structural genomi	88.85
2dmi_A		115	Teashirt homolog 3; zinc finger protein 537, struc	88.7
1bbo_A		57	Human enhancer-binding protein MBP-1; DNA-binding	86.9
1yk4_A		52	Rubredoxin, RD; electron transport; 0.69A {Pyrococ	86.79
2ct1_A		77	Transcriptional repressor CTCF; CCCTC-BINDING fact	86.36
2yt9_A		95	Zinc finger-containing protein 1; C2H2, structural	85.77
2eps_A		54	POZ-, at HOOK-, and zinc finger-containing protein	85.57
1e8j_A		52	Rubredoxin; iron-sulfur-protein, zinc-substitution	85.27
4gzn_C		60	ZFP-57, zinc finger protein 57; transcription-DNA	84.65
2kn9_A		81	Rubredoxin; metalloprotein, ssgcid, structural gen	84.63
1x5w_A		70	Zinc finger protein 64, isoforms 1; ZNF338, nuclea	84.32
2v3b_B		55	Rubredoxin 2, rubredoxin; alkane degradation, iron	84.28
2adr_A		60	ADR1; transcription regulation, zinc finger,; NMR	84.25
2ctd_A		96	Zinc finger protein 512; zinc binding, two ZF-C2H2	83.97
3uk3_C		57	Zinc finger protein 217; transcription factor, DNA	83.34
1x6e_A		72	Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca	83.2
1s24_A		87	Rubredoxin 2; electron transport; NMR {Pseudomonas	83.03
4rxn_A		54	Rubredoxin; electron transfer(iron-sulfur protein)	81.93
2lce_A		74	B-cell lymphoma 6 protein; structural genomics, no	81.87
1otr_A		49	Protein CUE2; protein-protein complex, cell cycle;	81.75
1dx8_A		70	Rubredoxin; electron transport, zinc-substitution;	81.7
2pwq_A		216	Ubiquitin conjugating enzyme; structural genomics	80.38
2d9h_A		78	Zinc finger protein 692; ZF-C2H2 domain, structura	80.35
2gqj_A		98	Zinc finger protein KIAA1196; ZF-C2H2 like domain,	80.26
2cot_A		77	Zinc finger protein 435; ADK_LID domain, zinc fing	80.17

>3ihp_A Ubiquitin carboxyl-terminal hydrolase 5; hydrolase, protease, thiol protease, UBL conjugation pathway, metal-binding, zinc-finger,structural genomics; 2.80A {Homo sapiens}	Back alignment and structure

Probab=99.83  E-value=1.2e-21  Score=212.70  Aligned_cols=123  Identities=29%  Similarity=0.484  Sum_probs=104.0

Q ss_pred             hhhhhcccccCCCCCCCccccccccccccccccccchhcccccccccc---Cccc---cCCccccccCCC---CC-CCCc
Q 017706           38 EAVLNLVCATCGKPCRSKTETDLHRKRTGHTDFVDKTSEAAKPISLEV---PKAT---ADSEEAIDVDMS---GS-QPEE  107 (367)
Q Consensus        38 e~v~~~~C~~Cg~~~~~~~e~~~a~K~t~f~tFP~~L~v~~~r~~l~~---p~K~---~~~~~~ldl~~~---g~-~~ee  107 (367)
                      |.+.+|+|+.|+.+       +.++|++.|.+||++|+|+++||.++.   |.|+   |..|..|||+.|   |. ++|+
T Consensus       559 E~Le~y~C~~C~~k-------~~a~K~~~i~~lP~vLiihLkRF~~d~~~~~~Ki~~~V~FP~~LDl~~y~~~~~q~~E~  631 (854)
T 3ihp_A          559 EQVDDFWSTALQAK-------SVAVKTTRFASFPDYLVIQIKKFTFGLDWVPKKLDVSIEMPEELDISQLRGTGLQPGEE  631 (854)
T ss_dssp             EEEEEEEETTTTEE-------EEEEEEEEESSCCSEEEEEECCEEECGGGCEEECCEECCCCSEEECGGGBCCCSCTTCC
T ss_pred             eEeeeeeccccCCc-------ceeeEEEEeeeCCceEEEEeehheecCCCceEECCeEEecCCcEehHHhccCCCCCCce
Confidence            33445999999986       789999999999999999999999963   8888   778999999987   44 5553


Q ss_pred             c--------------cccccCHHHHHHHHhCCCCHHHHHHHHHHhCCCCHHHHHHHHHHhcCCCCCCCCCCCCC
Q 017706          108 M--------------VEPEVDKELLKELEAMGFPVARATRALHYSGNANVEAAVNWVVEHENDPDIDEMPMVPV  167 (367)
Q Consensus       108 ~--------------~~~~~d~~~l~~L~~MGF~~~~a~kAL~~tgn~~~E~A~~Wl~~h~dd~d~dep~~~~~  167 (367)
                      .              ..+.+|+++|++|++|||+.++|.+||+.|||.+++.||+||++||+|+||++|+..+.
T Consensus       632 ~lp~~~~~~~~~~~~~~~~~d~~~l~~L~~mGf~~~~~~kal~~t~n~~~e~a~~wl~~hmdd~di~~p~~~~~  705 (854)
T 3ihp_A          632 ELPDIAPPLVTPDEPKAPMLDESVIIQLVEMGFPMDACRKAVYYTGNSGAEAAMNWVMSHMDDPDFANPLILPG  705 (854)
T ss_dssp             BCCCC----------------CHHHHHHHHHTCCHHHHHHHHHHTTSCCHHHHHHHHHHHTTSCGGGSCCCCC-
T ss_pred             ecccccccccccccccccCcCHHHHHHHHhcCCCHHHHHHHHhhcCCCchHHHhHHHhhccCcccccccccccc
Confidence            2              13457999999999999999999999999999999999999999999999999997654

PyMOL of 3ihp

>2crn_A Ubash3A protein; compact three-helix bundle, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1	Back alignment and structure

>1vek_A UBP14, ubiquitin-specific protease 14, putative; UBA domain, three helix bundle, ubiquitin associated domain, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1	Back alignment and structure

>2dag_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5 (USP 5), UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1whc_A RSGI RUH-027, UBA/UBX 33.3 kDa protein; UBA domain, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Mus musculus} SCOP: a.5.2.1	Back alignment and structure

>2dak_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5, USP 5, UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2dai_A Ubadc1, ubiquitin associated domain containing 1; UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2lbc_A Ubiquitin carboxyl-terminal hydrolase 13; tandem UBA of USP13; NMR {Homo sapiens}	Back alignment and structure

>2cpw_A CBL-interacting protein STS-1 variant; ubiquitin associated domain, UBA, compact three helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.1	Back alignment and structure

>1wgn_A UBAP1, ubiquitin associated protein; ubiquitin associated protein 1 (UBAP1), UBA domain, structural genomics; NMR {Homo sapiens} SCOP: a.5.2.1	Back alignment and structure

>1wji_A Tudor domain containing protein 3; UBA domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.5.2.1	Back alignment and structure

>2d5u_A N-glycanase 1; pngase, hydrolase; NMR {Mus musculus} SCOP: d.314.1.1	Back alignment and structure

>2ccq_A P97, peptide N-glycanase homolog; glycoprotein; 1.6A {Homo sapiens} SCOP: d.314.1.1 PDB: 2hpl_A 2hpj_A 2cm0_A	Back alignment and structure

>1wiv_A UBP14, ubiquitin-specific protease 14; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1	Back alignment and structure

>2ekk_A UBA domain from E3 ubiquitin-protein ligase HUWE1; ubiquitin associated domain, compact three helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2dkl_A Trinucleotide repeat containing 6C protein; TNRC6C, KIAA1582 protein, UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.1	Back alignment and structure

>1dv0_A DNA repair protein HHR23A; helical bundle, DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: a.5.2.1 PDB: 1f4i_A	Back alignment and structure

>2g3q_A Protein YBL047C; endocytosis, solution structure, UBA domain, endocytosis/signaling protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1	Back alignment and structure

>2cos_A Serine/threonine protein kinase LATS2; UBA domain, structure genomics, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.5.2.1	Back alignment and structure

>4ae4_A Ubiquitin-associated protein 1; protein transport, endosomal sorting, tetherin, VPU, HIV-1, monoubiquitin; HET: NHE; 1.65A {Homo sapiens} PDB: 4ae4_B*	Back alignment and structure

>1veg_A NEDD8 ultimate buster-1; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Mus musculus} SCOP: a.5.2.1	Back alignment and structure

>2lbc_A Ubiquitin carboxyl-terminal hydrolase 13; tandem UBA of USP13; NMR {Homo sapiens}	Back alignment and structure

>1ify_A HHR23A, UV excision repair protein RAD23 homolog A; ubiquitin associated domain, UBA domain, ubiquitin proteosome pathway, DNA binding protein; NMR {Homo sapiens} SCOP: a.5.2.1	Back alignment and structure

>2jy5_A Ubiquilin-1; UBA, alternative splicing, cytoplasm, nucleus, phosphoprotein, proteasome, signaling protein; NMR {Homo sapiens} PDB: 2jy6_B	Back alignment and structure

>1vg5_A RSGI RUH-014, rhomboid family protein; UBA domain, cDNA, structural genomics, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.5.2.1	Back alignment and structure

>2knz_A Ubiquilin-4; cytoplasm, endoplasmic reticulum, nucleus, phosphoprotein, protein binding; NMR {Mus musculus}	Back alignment and structure

>1z96_A DNA-damage, UBA-domain protein MUD1; ubiquitin, three-helix bundle, protein transport; 1.80A {Schizosaccharomyces pombe} SCOP: a.5.2.1	Back alignment and structure

>2dah_A Ubiquilin-3; UBA domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1	Back alignment and structure

>2bwb_A Ubiquitin-like protein DSK2; UBA, signaling protein; 2.3A {Saccharomyces cerevisiae} SCOP: a.5.2.1 PDB: 2bwe_A	Back alignment and structure

>2dna_A Unnamed protein product; ubiquitin associated domain, DSK2 protein, proteasome, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.5.2.1	Back alignment and structure

>1vej_A Riken cDNA 4931431F19; UBA domain, three helix bundle, ubiquitin associated domain, structural genomics; NMR {Mus musculus} SCOP: a.5.2.1	Back alignment and structure

>1wr1_B Ubiquitin-like protein DSK2; UBA domain, UBA-ubiquitin complex, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1	Back alignment and structure

>4ae4_A Ubiquitin-associated protein 1; protein transport, endosomal sorting, tetherin, VPU, HIV-1, monoubiquitin; HET: NHE; 1.65A {Homo sapiens} PDB: 4ae4_B*	Back alignment and structure

>1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A	Back alignment and structure

>2ooa_A E3 ubiquitin-protein ligase CBL-B; alpha-helical domain; 1.56A {Homo sapiens} PDB: 2oob_A 2jnh_A 2do6_A	Back alignment and structure

>2cwb_A Chimera of immunoglobulin G binding protein G and ubiquitin-like protein SB132; helical bundle, protein binding; NMR {Streptococcus SP} PDB: 2den_A	Back alignment and structure

>2d9s_A CBL E3 ubiquitin protein ligase; UBA domain, dimer, protein binding, structural genomics, NPPSFA; NMR {Mus musculus}	Back alignment and structure

>2juj_A E3 ubiquitin-protein ligase CBL; alpha helix, UBA domain, calcium, cytoplasm, metal- binding, phosphorylation, proto-oncogene, SH2 domain; NMR {Homo sapiens}	Back alignment and structure

>1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A	Back alignment and structure

>2oo9_A E3 ubiquitin-protein ligase CBL; alpha-helical domain, homodimer; 2.10A {Homo sapiens}	Back alignment and structure

>3i3t_A Ubiquitin carboxyl-terminal hydrolase 21; hydrolase, structural genomics consortium, SGC, activator, alternative splicing, chromatin regulator, nucleus, polymorphism, protease; 2.59A {Homo sapiens} SCOP: d.3.1.0 PDB: 2y5b_A 3mtn_A	Back alignment and structure

>2ayn_A Ubiquitin carboxyl-terminal hydrolase 14; deubiquitinating enzymes, DUB, USP14, proteasome, enzyme mechanism; 3.20A {Homo sapiens} SCOP: d.3.1.9 PDB: 2ayo_A	Back alignment and structure

>2cp8_A NEXT to BRCA1 gene 1 protein; UBA domain, structural genomics, human, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1	Back alignment and structure

>1wiv_A UBP14, ubiquitin-specific protease 14; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1	Back alignment and structure

>3ihp_A Ubiquitin carboxyl-terminal hydrolase 5; hydrolase, protease, thiol protease, UBL conjugation pathway, metal-binding, zinc-finger,structural genomics; 2.80A {Homo sapiens}	Back alignment and structure

>3k9o_A Ubiquitin-conjugating enzyme E2 K; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 3k9p_A 1yla_A 2o25_A	Back alignment and structure

>3mhs_A Ubiquitin carboxyl-terminal hydrolase 8; multi-protein complex, hydrolase-transcription regulator-Pro binding complex, acetylation, cytoplasm; 1.89A {Saccharomyces cerevisiae} PDB: 3mhh_A 4fjc_A 4fk5_A 4fip_A 3m99_A	Back alignment and structure

>3nhe_A Ubiquitin carboxyl-terminal hydrolase 2; cysteine protease, substrate ENZY complex, hydrolase-protein binding complex; HET: CME; 1.26A {Homo sapiens} SCOP: d.3.1.9 PDB: 2hd5_A 3v6c_A 3v6e_A 2ibi_A	Back alignment and structure

>1wj7_A Hypothetical protein (RSGI RUH-015); UBA domain, ubiquitin associated domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.5.2.1	Back alignment and structure

>1vjv_A Ubiquitin carboxyl-terminal hydrolase 6; YFR010W, structural genomics, JCSG, PSI, protein structure initiative; HET: MSE; 1.74A {Saccharomyces cerevisiae} SCOP: d.3.1.9	Back alignment and structure

>2y6e_A Ubiquitin carboxyl-terminal hydrolase 4; HET: CME; 2.40A {Homo sapiens}	Back alignment and structure

>1nb8_A Ubiquitin carboxyl-terminal hydrolase 7; UBP, deubiquitination, hausp, P53 binding; 2.30A {Homo sapiens} SCOP: d.3.1.9 PDB: 1nbf_A	Back alignment and structure

>2gfo_A Ubiquitin carboxyl-terminal hydrolase 8; protease, thiol protease, UBL conjugation pathway deubiquitinating enzyme, DUB, zinc ribbon; 2.00A {Homo sapiens} SCOP: d.3.1.9 PDB: 3n3k_A	Back alignment and structure

>2f1z_A Ubiquitin carboxyl-terminal hydrolase 7; hausp, USP7, UBP, deubiquitinating enzyme, substrate recognition; 3.20A {Homo sapiens}	Back alignment and structure

>3e46_A Ubiquitin-conjugating enzyme E2-25 kDa; huntington interacting, ligase, alternative splicing, cytoplasm, UBL conjugation, UBL conjugation pathway; 1.86A {Homo sapiens} SCOP: a.5.2.1 d.20.1.1 PDB: 3f92_A*	Back alignment and structure

>1wgl_A TOLL-interacting protein; CUE domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, immune system; NMR {Homo sapiens} SCOP: a.5.2.4	Back alignment and structure

>2cp9_A EF-TS, EF-TSMT, elongation factor TS, mitochondrial; UBA, structural genomics, human, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.2	Back alignment and structure

>1q02_A Sequestosome 1; helical bundle, protein binding; NMR {Homo sapiens} SCOP: a.5.2.1 PDB: 2jy7_A 2jy8_A 2k0b_X 2knv_A 2rru_A 3b0f_A	Back alignment and structure

>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1	Back alignment and structure

>6rxn_A Rubredoxin; electron transfer(iron-sulfur protein); 1.50A {Desulfovibrio desulfuricans} SCOP: g.41.5.1	Back alignment and structure

>2dhy_A CUE domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A	Back alignment and structure

>1yk4_A Rubredoxin, RD; electron transport; 0.69A {Pyrococcus abyssi} PDB: 2pya_A 1yk5_A 1bq8_A 1bq9_A* 3kyu_A 3kyv_A 3kyw_A 3kyx_A 3kyy_A 3ryg_A 3rz6_A 3rzt_A 3ss2_A 1brf_A 1caa_A 1cad_A 1vcx_A 1zrp_A 1iu5_A 1iu6_A ...	Back alignment and structure

>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1	Back alignment and structure

>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1	Back alignment and structure

>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1	Back alignment and structure

>1e8j_A Rubredoxin; iron-sulfur-protein, zinc-substitution, thermostability; NMR {Desulfovibrio gigas} SCOP: g.41.5.1 PDB: 1rdg_A 2dsx_A 1spw_A	Back alignment and structure

>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus}	Back alignment and structure

>2kn9_A Rubredoxin; metalloprotein, ssgcid, structural genomics, seattle structural genomics center for infectious electron transport, iron; NMR {Mycobacterium tuberculosis}	Back alignment and structure

>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1	Back alignment and structure

>2v3b_B Rubredoxin 2, rubredoxin; alkane degradation, iron-sulfur protein, oxidoreductase, ELE transfer, electron transport, FAD, NAD, iron; HET: FAD; 2.45A {Pseudomonas aeruginosa}	Back alignment and structure

>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1	Back alignment and structure

>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1	Back alignment and structure

>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens}	Back alignment and structure

>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1	Back alignment and structure

>1s24_A Rubredoxin 2; electron transport; NMR {Pseudomonas oleovorans} SCOP: g.41.5.1	Back alignment and structure

>4rxn_A Rubredoxin; electron transfer(iron-sulfur protein); 1.20A {Clostridium pasteurianum} SCOP: g.41.5.1 PDB: 5rxn_A 1bfy_A 1fhh_A 1fhm_A 1irn_A 1iro_A 1r0f_A 1r0g_A 1r0h_A 1r0i_A 1r0j_A 1t9q_A 1c09_A 1b2j_A 1b13_A 1smm_A 1smu_A 1smw_A 1be7_A 1t9o_A ...	Back alignment and structure

>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens}	Back alignment and structure

>1otr_A Protein CUE2; protein-protein complex, cell cycle; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.4	Back alignment and structure

>1dx8_A Rubredoxin; electron transport, zinc-substitution; NMR {Guillardia theta} SCOP: g.41.5.1 PDB: 1h7v_A	Back alignment and structure

>2pwq_A Ubiquitin conjugating enzyme; structural genomics consortium, SGC, ligase; 1.90A {Plasmodium yoelii}	Back alignment and structure

>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		367
d1whca_		64	a.5.2.1 (A:) UBA/UBX 33.3 kDa protein {Mouse (Mus	6e-21
d1veka_		84	a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress	1e-20
d2crna1		51	a.5.2.1 (A:8-58) Suppressor of T-cell receptor sig	3e-17
d1wjia_		63	a.5.2.1 (A:) Tudor domain containing protein 3, TD	6e-17
d2cpwa1		51	a.5.2.1 (A:8-58) Cbl-interacting protein p70, STS1	3e-12
d2ccqa1		99	d.314.1.1 (A:11-109) N-glycanase 1, N-terminal dom	2e-11
d1wgna_		63	a.5.2.1 (A:) Ubiquitin-associated protein 1, UBAP1	1e-10
d1wiva_		73	a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress	4e-10
d1vg5a_		73	a.5.2.1 (A:) Rhomboid family protein At3g58460 {Th	3e-07
d1oqya1		41	a.5.2.1 (A:160-200) DNA repair protein Hhr23a {Hum	3e-05

>d1whca_ a.5.2.1 (A:) UBA/UBX 33.3 kDa protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 64	Back information, alignment and structure


class: All alpha proteins
fold: RuvA C-terminal domain-like
superfamily: UBA-like
family: UBA domain
domain: UBA/UBX 33.3 kDa protein
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 83.3 bits (206), Expect = 6e-21
 Identities = 27/59 (45%), Positives = 38/59 (64%)

Query: 111 PEVDKELLKELEAMGFPVARATRALHYSGNANVEAAVNWVVEHENDPDIDEMPMVPVSG 169
              +   L+ L  MGFP  RA +AL  +GN  +EAA++W++EHE+DPD+DE    P SG
Sbjct: 6   SGAELTALESLIEMGFPRGRAEKALALTGNQGIEAAMDWLMEHEDDPDVDEPLSGPSSG 64

PyMOL of d1whca_

>d1veka_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 84	Back information, alignment and structure

>d2crna1 a.5.2.1 (A:8-58) Suppressor of T-cell receptor signaling 2 (STS-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 51	Back information, alignment and structure

>d1wjia_ a.5.2.1 (A:) Tudor domain containing protein 3, TDRD3 {Human (Homo sapiens) [TaxId: 9606]} Length = 63	Back information, alignment and structure

>d2cpwa1 a.5.2.1 (A:8-58) Cbl-interacting protein p70, STS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 51	Back information, alignment and structure

>d2ccqa1 d.314.1.1 (A:11-109) N-glycanase 1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 99	Back information, alignment and structure

>d1wgna_ a.5.2.1 (A:) Ubiquitin-associated protein 1, UBAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 63	Back information, alignment and structure

>d1wiva_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 73	Back information, alignment and structure

>d1vg5a_ a.5.2.1 (A:) Rhomboid family protein At3g58460 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 73	Back information, alignment and structure

>d1oqya1 a.5.2.1 (A:160-200) DNA repair protein Hhr23a {Human (Homo sapiens) [TaxId: 9606]} Length = 41	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		367
d2crna1		51	Suppressor of T-cell receptor signaling 2 (STS-2)	99.77
d1veka_		84	Ubiquitin isopeptidase T {Thale cress (Arabidopsis	99.76
d1whca_		64	UBA/UBX 33.3 kDa protein {Mouse (Mus musculus) [Ta	99.75
d1wjia_		63	Tudor domain containing protein 3, TDRD3 {Human (H	99.64
d2cpwa1		51	Cbl-interacting protein p70, STS1 {Human (Homo sap	99.55
d1wiva_		73	Ubiquitin isopeptidase T {Thale cress (Arabidopsis	99.3
d1wgna_		63	Ubiquitin-associated protein 1, UBAP1 {Human (Homo	99.26
d2ccqa1		99	N-glycanase 1, N-terminal domain {Human (Homo sapi	99.14
d1vg5a_		73	Rhomboid family protein At3g58460 {Thale cress (Ar	99.12
d1oqya1		41	DNA repair protein Hhr23a {Human (Homo sapiens) [T	99.05
d2g3qa1		43	Endocytic protein Ede1, YBL047C {Saccharomyces cer	98.4
d2cosa1		41	Serine/threonine protein kinase LATS2 {Mouse (Mus	97.86
d2dnaa1		50	Ubiquilin-like protein Ubqlnl {Mouse (Mus musculus	97.79
d1veja1		61	4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]	97.78
d2bwba1		44	DSK2 {Baker's yeast (Saccharomyces cerevisiae) [Ta	97.75
d1vega_		83	NEDD8 ultimate buster-1 (Nub1) {Mouse (Mus musculu	97.49
d2daha1		41	Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]}	97.48
d1oqya2		44	DNA repair protein Hhr23a {Human (Homo sapiens) [T	96.86
d2ayna1		383	Ubiquitin carboxyl-terminal hydrolase 14 {Human (H	96.39
d1z96a1		38	UBA-domain protein mud1 {Schizosaccharomyces pombe	96.37
d1wiva_		73	Ubiquitin isopeptidase T {Thale cress (Arabidopsis	96.25
d1nbfa_		347	Ubiquitin carboxyl-terminal hydrolase 7 (USP7, HAU	95.86
d1efub3		54	Elongation factor Ts (EF-Ts), N-terminal domain {E	94.02
d1aipc1		52	Elongation factor Ts (EF-Ts), N-terminal domain {T	93.41
d3e46a1		42	Ubiquitin-conjugating enzyme E2-25 kDa, C-terminal	93.25
d1ttea1		55	Ubiquitin-protein ligase ubc1 {Baker's yeast (Sacc	93.14
d2dkla1		72	Trinucleotide repeat containing 6c protein, TNRC6C	92.9
d1xb2b1		56	Elongation factor Ts (EF-Ts), N-terminal domain {C	92.6
d6rxna_		45	Rubredoxin {Desulfovibrio desulfuricans, strain 27	90.59
d1wj7a1		91	Ubiquitin-associated protein 2-like Ubap2l {Mouse	89.96
d1s24a_		56	Two-iron rubredoxin {Pseudomonas oleovorans [TaxId	83.18
d1iroa_		53	Rubredoxin {Clostridium pasteurianum [TaxId: 1501]	83.18
d1brfa_		53	Rubredoxin {Archaeon Pyrococcus furiosus [TaxId: 2	83.07
d2dsxa1		52	Rubredoxin {Desulfovibrio gigas [TaxId: 879]}	82.76
d2cp8a1		41	Migration-inducing protein 19 NBR1 {Human (Homo sa	81.1

>d2crna1 a.5.2.1 (A:8-58) Suppressor of T-cell receptor signaling 2 (STS-2) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

class: All alpha proteins
fold: RuvA C-terminal domain-like
superfamily: UBA-like
family: UBA domain
domain: Suppressor of T-cell receptor signaling 2 (STS-2)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.77  E-value=1.1e-19  Score=131.25  Aligned_cols=50  Identities=42%  Similarity=0.701  Sum_probs=47.8

Q ss_pred             CHHHHHHHHhCCCCHHHHHHHHHHhCCCCHHHHHHHHHHhcCCCCCCCCC
Q 017706          114 DKELLKELEAMGFPVARATRALHYSGNANVEAAVNWVVEHENDPDIDEMP  163 (367)
Q Consensus       114 d~~~l~~L~~MGF~~~~a~kAL~~tgn~~~E~A~~Wl~~h~dd~d~dep~  163 (367)
                      |+++|++|++|||++++|++||++|||.++|.|++|||+|++|||+|+|+
T Consensus         2 ~p~~v~~L~~MGF~~~~a~~Al~~t~n~~ve~A~~Wl~~h~~d~d~d~Pl   51 (51)
T d2crna1           2 SPSLLEPLLAMGFPVHTALKALAATGRKTAEEALAWLHDHCNDPSLDDPI   51 (51)
T ss_dssp             SCSSHHHHHHTSCCHHHHHHHHHHHTSCCHHHHHHHHHHHSSSTTSCCSC
T ss_pred             CHHHHHHHHHcCCCHHHHHHHHHHHCCCCHHHHHHHHHHcCCCcCcCCCC
Confidence            56789999999999999999999999999999999999999999999986

PyMOL of d2crna1

>d1veka_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1whca_ a.5.2.1 (A:) UBA/UBX 33.3 kDa protein {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1wjia_ a.5.2.1 (A:) Tudor domain containing protein 3, TDRD3 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cpwa1 a.5.2.1 (A:8-58) Cbl-interacting protein p70, STS1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wiva_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1wgna_ a.5.2.1 (A:) Ubiquitin-associated protein 1, UBAP1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ccqa1 d.314.1.1 (A:11-109) N-glycanase 1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1vg5a_ a.5.2.1 (A:) Rhomboid family protein At3g58460 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1oqya1 a.5.2.1 (A:160-200) DNA repair protein Hhr23a {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2g3qa1 a.5.2.1 (A:1339-1381) Endocytic protein Ede1, YBL047C {Saccharomyces cerevisiae [TaxId: 4932]}	Back information, alignment and structure

>d2cosa1 a.5.2.1 (A:8-48) Serine/threonine protein kinase LATS2 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2dnaa1 a.5.2.1 (A:12-61) Ubiquilin-like protein Ubqlnl {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1veja1 a.5.2.1 (A:8-68) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2bwba1 a.5.2.1 (A:328-371) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1vega_ a.5.2.1 (A:) NEDD8 ultimate buster-1 (Nub1) {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2daha1 a.5.2.1 (A:8-48) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1oqya2 a.5.2.1 (A:317-360) DNA repair protein Hhr23a {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ayna1 d.3.1.9 (A:100-482) Ubiquitin carboxyl-terminal hydrolase 14 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1z96a1 a.5.2.1 (A:295-332) UBA-domain protein mud1 {Schizosaccharomyces pombe [TaxId: 4896]}	Back information, alignment and structure

>d1wiva_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1nbfa_ d.3.1.9 (A:) Ubiquitin carboxyl-terminal hydrolase 7 (USP7, HAUSP) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1efub3 a.5.2.2 (B:1-54) Elongation factor Ts (EF-Ts), N-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1aipc1 a.5.2.2 (C:2-53) Elongation factor Ts (EF-Ts), N-terminal domain {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d3e46a1 a.5.2.1 (A:157-198) Ubiquitin-conjugating enzyme E2-25 kDa, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ttea1 a.5.2.1 (A:161-215) Ubiquitin-protein ligase ubc1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2dkla1 a.5.2.1 (A:8-79) Trinucleotide repeat containing 6c protein, TNRC6C {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xb2b1 a.5.2.2 (B:56-111) Elongation factor Ts (EF-Ts), N-terminal domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]}	Back information, alignment and structure

>d6rxna_ g.41.5.1 (A:) Rubredoxin {Desulfovibrio desulfuricans, strain 27774 [TaxId: 876]}	Back information, alignment and structure

>d1wj7a1 a.5.2.1 (A:8-98) Ubiquitin-associated protein 2-like Ubap2l {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1s24a_ g.41.5.1 (A:) Two-iron rubredoxin {Pseudomonas oleovorans [TaxId: 301]}	Back information, alignment and structure

>d1iroa_ g.41.5.1 (A:) Rubredoxin {Clostridium pasteurianum [TaxId: 1501]}	Back information, alignment and structure

>d1brfa_ g.41.5.1 (A:) Rubredoxin {Archaeon Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d2dsxa1 g.41.5.1 (A:1-52) Rubredoxin {Desulfovibrio gigas [TaxId: 879]}	Back information, alignment and structure

>d2cp8a1 a.5.2.1 (A:8-48) Migration-inducing protein 19 NBR1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure