Citrus Sinensis ID: 017755


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360------
MSSLPLDLISDILSRLPVKPLLRFRCVSKCFCGLIDSQDFVKLHLNQAIETNSGLSLIVPTLTSDNKFFSLELDSVDNPVEIEYPFKKYNRGHTSVIGCCHGLLAMFNRRLGMSVFNPTTKKFKLFPQFWSDCYTDYMTNNFHFDGFGYDASTDDYKLVRIIQSYKVDYLEVIIYSLKADTWRRTREFPYYILDDRCNGVFIAGALHWLAARGSVRTGQNMILAFDLKSEKFYEVQQPHGMKGGFCSQVGVLRGCLWINSYYHDEPRCDIWVMKEYGSQQSWSKLCSFSKMLHETCYYTEAFAFSKDGDKALIYQHSRCLHWYNLKDHKQDVIEIRNENQSFWDAFICMGSLASIDAYTTVGVDTV
cccccHHHHHHHcccccHHHHHHHccccccHHHHcccHHHHHHHHHHHccccccEEEEEEccccccEEEEECccccccccCECccccccccccEEEEEEEccEEEEEEcccEEEEEccccccEEEccccccccccccccccEEEEEEEECcccccEEEEEEEEEcccccEEEEEEEcccccEEEcccccccccccccccEEEcccEEEEEEEccccccccEEEEEEccccCEEECcccccccccCEEEEEEEccEEEEEEECccccEEEEEEEECccccccEEEEEEEcccccccccccCEEEEECcccEEEEEEcccEEEEEEccccEEEEEEEEccccccEEEEEEEcccccccccccccEEEc
MSSLPLDLISDILSRLPVKPLLRFRCVSKCFCGLIDSQDFVKLHLNQAIETNSGLSLIVPTLTSDNKFFSLELDSVDNPVEIEYPFKKYNRGHTSVIGCCHGLLAMFNRRLGMSVFNPTTKKFKLFPQFWSDCYTDYMTNNFHFDGFGYDASTDDYKLVRIIQSYKVDYLEVIIYSLKADTWRRTREFPYYILDDRCNGVFIAGALHWLAARGSVRTGQNMILAFDLKSEKFYEVQQPHGMKGGFCSQVGVLRGCLWINSYYHDEPRCDIWVMKEYGSQQSWSKLCSFSKMLHETCYYTEAFAFSKDGDKALIYQHSRCLHWYNLKDHKQDVIEIRNENQSFWDAFICMGSLASIDAYTTVGV***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSLPLDLISDILSRLPVKPLLRFRCVSKCFCGLIDSQDFVKLHLNQAIETNSGLSLIVPTLTSDNKFFSLELDSVDNPVEIEYPFKKYNRGHTSVIGCCHGLLAMFNRRLGMSVFNPTTKKFKLFPQFWSDCYTDYMTNNFHFDGFGYDASTDDYKLVRIIQSYKVDYLEVIIYSLKADTWRRTREFPYYILDDRCNGVFIAGALHWLAARGSVRTGQNMILAFDLKSEKFYEVQQPHGMKGGFCSQVGVLRGCLWINSYYHDEPRCDIWVMKEYGSQQSWSKLCSFSKMLHETCYYTEAFAFSKDGDKALIYQHSRCLHWYNLKDHKQDVIEIRNENQSFWDAFICMGSLASIDAYTTVGVDTV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
F-box protein CPR30 Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins (By similarity). Regulates negatively both salicylic acid (SA)-dependent and SA-independent defense signaling.probableQ9SU30

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2UVK, chain A
Confidence level:confident
Coverage over the Query: 101-334
View the alignment between query and template
View the model in PyMOL
Template: 2E31, chain A
Confidence level:confident
Coverage over the Query: 1-48
View the alignment between query and template
View the model in PyMOL
Template: 1P22, chain A
Confidence level:probable
Coverage over the Query: 2-131,142-331
View the alignment between query and template
View the model in PyMOL
Template: 3M0C, chain C
Confidence level:probable
Coverage over the Query: 144-352
View the alignment between query and template
View the model in PyMOL