Citrus Sinensis ID: 017755

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360------
MSSLPLDLISDILSRLPVKPLLRFRCVSKCFCGLIDSQDFVKLHLNQAIETNSGLSLIVPTLTSDNKFFSLELDSVDNPVEIEYPFKKYNRGHTSVIGCCHGLLAMFNRRLGMSVFNPTTKKFKLFPQFWSDCYTDYMTNNFHFDGFGYDASTDDYKLVRIIQSYKVDYLEVIIYSLKADTWRRTREFPYYILDDRCNGVFIAGALHWLAARGSVRTGQNMILAFDLKSEKFYEVQQPHGMKGGFCSQVGVLRGCLWINSYYHDEPRCDIWVMKEYGSQQSWSKLCSFSKMLHETCYYTEAFAFSKDGDKALIYQHSRCLHWYNLKDHKQDVIEIRNENQSFWDAFICMGSLASIDAYTTVGVDTV
cccccHHHHHHHcccccHHHHHHHccccccHHHHcccHHHHHHHHHHHccccccEEEEEEccccccEEEEEEccccccccEEEccccccccccEEEEEEEccEEEEEEcccEEEEEccccccEEEccccccccccccccccEEEEEEEEEcccccEEEEEEEEEcccccEEEEEEEcccccEEEcccccccccccccccEEEcccEEEEEEEccccccccEEEEEEccccEEEEEcccccccccEEEEEEEEccEEEEEEEEccccEEEEEEEEEccccccEEEEEEEcccccccccccEEEEEEEcccEEEEEEcccEEEEEEccccEEEEEEEEccccccEEEEEEEcccccccccccccEEEc
cccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHcccccccEEEEEEEEccEEEEEEccccccccccccccccccccccEEEEEEcccEEEEEEEcccEEEEEccccccEEEEccccccccccccccEEEEEEEcEccccccEEEEEEEEccccccEEEEEEEcccccEEEEEcccccccccccccEEEEcEEEEEEEEccccccccEEEEEEcccccccccccccccccccEEEEEEEccEEEEEEEcccccEEEEEEEEccccccEEEEEEEEccccccccccccEEEEEccccEEEEEccccEEEEEEccccEEEEEEEEcccccccccEEEcccccccccEEEEccccc
MSSLPLDLISDIlsrlpvkpllrfrcvskcfcglidsqDFVKLHLNQAIetnsglslivptltsdnkffsleldsvdnpveieypfkkynrghtsvigCCHGLLAMFNrrlgmsvfnpttkkfklfpqfwsdcytdymtnnfhfdgfgydastddyKLVRIIQSYKVDYLEVIIYSLKadtwrrtrefpyyilddrcnGVFIAGALHWLAArgsvrtgqNMILAFDlksekfyevqqphgmkggfcsqvgvlRGCLWinsyyhdeprcdiwvmkeygsqqswSKLCSFSKMLHETCYYTeafafskdgdkALIYQHSRCLHWYNLKDHKQDVIEIRNENQSFWDAFICMGSLASIDAYTTVGVDTV
MSSLPLDLISDILSRLPVKPLLRFRCVSKCFCGLIDSQDFVKLHLNQAIETNSGLSLIVPTLTSDNKFFSleldsvdnpVEIEYPFKKYNRGHTSVIGCCHGLLAMFNRRLGMSVFNPTTKKFKLFPQFWSDCYTDYMTNNFHFDGFGYDASTDDYKLVRIIQSYKVDYLEVIIYslkadtwrrtREFPYYILDDRCNGVFIAGALHWLAARGSVRTGQNMILAFDLKSEKFYEVQQPHGMKGGFCSQVGVLRGCLWINSYYHDEPRCDIWVMKEYGSQQSWSKLCSFSKMLHETCYYTEAFAFSKDGDKALIYQHSRCLHWYNLKDHKQDVIEIRNENQSFWDAFICMGSLASIDAYTTVGVDTV
MsslpldlisdilsrlpVKPLLRFRCVSKCFCGLIDSQDFVKLHLNQAIETNSGLSLIVPTLTSDNKFFSLELDSVDNPVEIEYPFKKYNRGHTSVIGCCHGLLAMFNRRLGMSVFNPTTKKFKLFPQFWSDCYTDYMTNNFHFDGFGYDASTDDYKLVRIIQSYKVDYLEVIIYSLKADTWRRTREFPYYILDDRCNGVFIAGALHWLAARGSVRTGQNMILAFDLKSEKFYEVQQPHGMKGGFCSQVGVLRGCLWINSYYHDEPRCDIWVMKEYGSQQSWSKLCSFSKMLHETCYYTEAFAFSKDGDKALIYQHSRCLHWYNLKDHKQDVIEIRNENQSFWDAFICMGSLASIDAYTTVGVDTV
*****LDLISDILSRLPVKPLLRFRCVSKCFCGLIDSQDFVKLHLNQAIETNSGLSLIVPTLTSDNKFFSLELDSVDNPVEIEYPFKKYNRGHTSVIGCCHGLLAMFNRRLGMSVFNPTTKKFKLFPQFWSDCYTDYMTNNFHFDGFGYDASTDDYKLVRIIQSYKVDYLEVIIYSLKADTWRRTREFPYYILDDRCNGVFIAGALHWLAARGSVRTGQNMILAFDLKSEKFYEVQQPHGMKGGFCSQVGVLRGCLWINSYYHDEPRCDIWVMKEYGSQQSWSKLCSFSKMLHETCYYTEAFAFSKDGDKALIYQHSRCLHWYNLKDHKQDVIEIRNENQSFWDAFICMGSLASIDAYTTVGV***
MSSLPLDLISDILSRLPVKPLLRFRCVSKCFCGLIDSQDFVKLHLNQAIETNSGLSLIVPTLTSDNKFFSLELDSVDNPVEIEYPFKKYNRGHTSVIGCCHGLLAMFNRRLGMSVFNPTTKKFKLFPQFWSDCYTDYMTNNFHFDGFGYDASTDDYKLVRIIQSYKVDYLEVIIYSLKADTWRRTREFPYYILDDRCNGVFIAGALHWLAARGSVRTGQNMILAFDLKSEKFYEVQQPHGMKGGFCSQVGVLRGCLWINSYYHDEPRCDIWVMKEYGSQQSWSKLCSFSKMLHETCYYTEAFAFSKDGDKALIYQHSRCLHWYNLKDHKQDVIEIRNENQSFWDAFICMGSLASIDAYTT******
MSSLPLDLISDILSRLPVKPLLRFRCVSKCFCGLIDSQDFVKLHLNQAIETNSGLSLIVPTLTSDNKFFSLELDSVDNPVEIEYPFKKYNRGHTSVIGCCHGLLAMFNRRLGMSVFNPTTKKFKLFPQFWSDCYTDYMTNNFHFDGFGYDASTDDYKLVRIIQSYKVDYLEVIIYSLKADTWRRTREFPYYILDDRCNGVFIAGALHWLAARGSVRTGQNMILAFDLKSEKFYEVQQPHGMKGGFCSQVGVLRGCLWINSYYHDEPRCDIWVMKEYGSQQSWSKLCSFSKMLHETCYYTEAFAFSKDGDKALIYQHSRCLHWYNLKDHKQDVIEIRNENQSFWDAFICMGSLASIDAYTTVGVDTV
*SSLPLDLISDILSRLPVKPLLRFRCVSKCFCGLIDSQDFVKLHLNQAIETNSGLSLIVPTLTSDNKFFSLELDSVDNPVEIEYPFKKYNRGHTSVIGCCHGLLAMFNRRLGMSVFNPTTKKFKLFPQFWSDCYTDYMTNNFHFDGFGYDASTDDYKLVRIIQSYKVDYLEVIIYSLKADTWRRTREFPYYILDDRCNGVFIAGALHWLAARGSVRTGQNMILAFDLKSEKFYEVQQPHGMKGGFCSQVGVLRGCLWINSYYHDEPRCDIWVMKEYGSQQSWSKLCSFSKMLHETCYYTEAFAFSKDGDKALIYQHSRCLHWYNLKDHKQDVIEIRNENQSFWDAFICMGSLASIDAYTTVGVDT*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSLPLDLISDILSRLPVKPLLRFRCVSKCFCGLIDSQDFVKLHLNQAIETNSGLSLIVPTLTSDNKFFSLELDSVDNPVEIEYPFKKYNRGHTSVIGCCHGLLAMFNRRLGMSVFNPTTKKFKLFPQFWSDCYTDYMTNNFHFDGFGYDASTDDYKLVRIIQSYKVDYLEVIIYSLKADTWRRTREFPYYILDDRCNGVFIAGALHWLAARGSVRTGQNMILAFDLKSEKFYEVQQPHGMKGGFCSQVGVLRGCLWINSYYHDEPRCDIWVMKEYGSQQSWSKLCSFSKMLHETCYYTEAFAFSKDGDKALIYQHSRCLHWYNLKDHKQDVIEIRNENQSFWDAFICMGSLASIDAYTTVGVDTV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query366 2.2.26 [Sep-21-2011]
Q9SU30413 F-box protein CPR30 OS=Ar yes no 0.950 0.842 0.314 8e-49
Q8GXC7427 F-box/kelch-repeat protei no no 0.745 0.639 0.337 2e-39
Q9SUY0402 F-box protein At4g22390 O no no 0.942 0.858 0.298 2e-35
Q9LIR8364 F-box/kelch-repeat protei no no 0.770 0.774 0.311 8e-25
Q9SSQ2423 F-box protein At1g52490 O no no 0.874 0.756 0.245 3e-19
Q9LU24360 Putative F-box protein At no no 0.713 0.725 0.288 2e-18
Q9SJ06396 F-box protein At2g21930 O no no 0.868 0.803 0.264 2e-15
Q9S9V1378 Putative F-box only prote no no 0.576 0.558 0.292 4e-15
Q9SFC7417 F-box protein At3g07870 O no no 0.751 0.659 0.258 2e-14
Q9T0J4426 Putative F-box protein At no no 0.726 0.624 0.242 1e-13
>sp|Q9SU30|CPR30_ARATH F-box protein CPR30 OS=Arabidopsis thaliana GN=CPR30 PE=1 SV=2 Back     alignment and function desciption
 Score =  194 bits (493), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 121/385 (31%), Positives = 202/385 (52%), Gaps = 37/385 (9%)

Query: 1   MSSLPLDLISDILSRLPVKPLLRFRCVSKCFCGLIDSQDFVKLHLNQAIETNSGLSLIVP 60
           M+++P+D+++DI  RLP K L+R R +SK    LI+  DF++ HL++ ++T   L ++  
Sbjct: 1   MATIPMDIVNDIFLRLPAKTLVRCRALSKPCYHLINDPDFIESHLHRVLQTGDHLMIL-- 58

Query: 61  TLTSDNKFFSLELDSVDNPVEIEYPFKKYNRGHTSVIGCCHGLLAMFNRRLGMSVFNPTT 120
            L    + +S++LDS+D+  ++E+P K+   G T V G  +GL+ + N    ++VFNP+T
Sbjct: 59  -LRGALRLYSVDLDSLDSVSDVEHPMKR--GGPTEVFGSSNGLIGLSNSPTDLAVFNPST 115

Query: 121 KKFKLFPQFWSDCYTDYMTNNFHFDGFGYDASTDDYKLVRIIQSYKVDY---------LE 171
           ++    P    D      T  + F G GYD+ +DDYK+VR++Q +K+D           E
Sbjct: 116 RQIHRLPPSSIDLPDGSSTRGYVFYGLGYDSVSDDYKVVRMVQ-FKIDSEDELGCSFPYE 174

Query: 172 VIIYSLKADTWRRTRE----------FPYYILDDRCNGVFIAGALHWLAARGSVRTGQNM 221
           V ++SLK ++W+R             F Y++L  R  GV    +LHW+  R       N+
Sbjct: 175 VKVFSLKKNSWKRIESVASSIQLLFYFYYHLLYRRGYGVLAGNSLHWVLPRRPGLIAFNL 234

Query: 222 ILAFDLKSEKFYEVQQPHGMKGGFCS---QVGVLRGCLWINSYYHDEPRCDIWVMKEYGS 278
           I+ FDL  E+F  V+ P  +  G       +GVL GCL +   Y D+   D+W+MKEY  
Sbjct: 235 IVRFDLALEEFEIVRFPEAVANGNVDIQMDIGVLDGCLCLMCNY-DQSYVDVWMMKEYNV 293

Query: 279 QQSWSKLCSFSKMLHETCY-YTEAFAFSKDGDKALIYQHSRCLHWYNLKDHKQDVIEIRN 337
           + SW+K+ +  K      + Y     +SKD  K L+  ++  L W++L+  K   + I++
Sbjct: 294 RDSWTKVFTVQKPKSVKSFSYMRPLVYSKDKKKVLLELNNTKLVWFDLESKKMSTLRIKD 353

Query: 338 ENQSFWDAFI-------CMGSLASI 355
              S+    +       C G L +I
Sbjct: 354 CPSSYSAELVVSSLVLGCKGDLNNI 378
Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins (By similarity). Regulates negatively both salicylic acid (SA)-dependent and SA-independent defense signaling.
Arabidopsis thaliana (taxid: 3702)
>sp|Q8GXC7|FBK50_ARATH F-box/kelch-repeat protein At3g06240 OS=Arabidopsis thaliana GN=At3g06240 PE=2 SV=1 Back     alignment and function description
>sp|Q9SUY0|FB244_ARATH F-box protein At4g22390 OS=Arabidopsis thaliana GN=At4g22390 PE=2 SV=3 Back     alignment and function description
>sp|Q9LIR8|FBK67_ARATH F-box/kelch-repeat protein At3g23880 OS=Arabidopsis thaliana GN=At3g23880 PE=2 SV=1 Back     alignment and function description
>sp|Q9SSQ2|FB55_ARATH F-box protein At1g52490 OS=Arabidopsis thaliana GN=At1g52490 PE=4 SV=1 Back     alignment and function description
>sp|Q9LU24|FB145_ARATH Putative F-box protein At3g16210 OS=Arabidopsis thaliana GN=At3g16210 PE=4 SV=1 Back     alignment and function description
>sp|Q9SJ06|FB115_ARATH F-box protein At2g21930 OS=Arabidopsis thaliana GN=At2g21930 PE=2 SV=1 Back     alignment and function description
>sp|Q9S9V1|FBX15_ARATH Putative F-box only protein 15 OS=Arabidopsis thaliana GN=FBX15 PE=4 SV=1 Back     alignment and function description
>sp|Q9SFC7|FB135_ARATH F-box protein At3g07870 OS=Arabidopsis thaliana GN=At3g07870 PE=2 SV=1 Back     alignment and function description
>sp|Q9T0J4|FB249_ARATH Putative F-box protein At4g38870 OS=Arabidopsis thaliana GN=At4g38870 PE=4 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query366
255583943389 ubiquitin-protein ligase, putative [Rici 0.956 0.899 0.373 9e-55
224053103408 predicted protein [Populus trichocarpa] 0.964 0.865 0.364 6e-53
224089629396 f-box family protein [Populus trichocarp 0.967 0.893 0.372 4e-52
357480485392 F-box family protein [Medicago truncatul 0.923 0.862 0.352 8e-50
30682162413 F-box protein CPR30 [Arabidopsis thalian 0.950 0.842 0.314 5e-47
4725955408 putative protein [Arabidopsis thaliana] 0.950 0.852 0.314 5e-47
110738553413 hypothetical protein [Arabidopsis thalia 0.950 0.842 0.314 6e-47
224089631400 predicted protein [Populus trichocarpa] 0.912 0.835 0.343 8e-47
297809553414 F-box family protein [Arabidopsis lyrata 0.950 0.840 0.308 1e-45
255583935395 conserved hypothetical protein [Ricinus 0.937 0.868 0.351 2e-45
>gi|255583943|ref|XP_002532719.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223527546|gb|EEF29668.1| ubiquitin-protein ligase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  220 bits (560), Expect = 9e-55,   Method: Compositional matrix adjust.
 Identities = 136/364 (37%), Positives = 211/364 (57%), Gaps = 14/364 (3%)

Query: 1   MSSLPLDLISDILSRLPVKPLLRFRCVSKCFCGLIDSQDFVKLHLNQAIETNSGLSLIVP 60
           MS+LPL++I++IL RL  K LL  RCVSK +  LIDS  F+ LHLN +IE+   LS+I+ 
Sbjct: 1   MSNLPLEMIAEILCRLTAKKLLCCRCVSKRWRTLIDSPTFIYLHLNHSIESPCNLSIILK 60

Query: 61  TLTSDNKFFSLELDSVDNPVEIEYPFKKYNRGHTSVIGCCHGLLAMFNRRLGMSVFNPTT 120
           +    ++ +SL  D +DN   +++P   YN G   ++G C+GLL + N    ++++NP+ 
Sbjct: 61  S----SELYSLSFDLLDNIQPLDHPLMCYNHG-VKILGSCNGLLCICNIVDDIALWNPSI 115

Query: 121 KKFKLFPQFWSDC--YTDYMTNNFHFDGFGYDASTDDYKLVRIIQSYKVDYL----EVII 174
           +  ++ P    +   Y    +      GFGYD S DDYKLVRI Q   VD      EV +
Sbjct: 116 RAHRVVPYLPVELKRYFGMCSCRVSVFGFGYDLSNDDYKLVRIAQFGGVDRKSFESEVKV 175

Query: 175 YSLKADTWRRTREFPYYILDDRCNGVFIAGALHWLAARGSVRTGQNMILAFDLKSEKFYE 234
           +SL+ ++WRR  + PY +L    NG++  GALHWL ++    T  + I+A DL  E ++ 
Sbjct: 176 FSLRKNSWRRIADMPYCVLYPGENGIYANGALHWLVSQDPDSTVADTIVALDLGVEDYHV 235

Query: 235 VQQPHGMKGGFCSQVGVLRGCLWINSYYHDEPRCDIWVMKEYGSQQSWSKLCSFSKM-LH 293
           V +P  +       VGVL+GCL + +Y   E R D+WVM+EY  ++SWSKL S +++ + 
Sbjct: 236 VPKPEFVDMNCNMGVGVLQGCLSLLAYARSE-RVDVWVMEEYMVKESWSKLFSVARLEVI 294

Query: 294 ETCYYTEAFAFSKDGDKALIYQHSRCLHWYNLKDHKQDVIEIRNENQSFWDAFICMGSLA 353
                 +  A+SK G++ LI   +  L WY+LK  +   + I+    +F +A IC+GSL 
Sbjct: 295 GILRSLKPLAYSKSGNEVLIEHDNVNLFWYDLKRKEVVNVWIQGVPITF-EAEICVGSLV 353

Query: 354 SIDA 357
            ++A
Sbjct: 354 PLNA 357

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224053103|ref|XP_002297705.1| predicted protein [Populus trichocarpa] gi|222844963|gb|EEE82510.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224089629|ref|XP_002308787.1| f-box family protein [Populus trichocarpa] gi|222854763|gb|EEE92310.1| f-box family protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357480485|ref|XP_003610528.1| F-box family protein [Medicago truncatula] gi|355511583|gb|AES92725.1| F-box family protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|30682162|ref|NP_192993.2| F-box protein CPR30 [Arabidopsis thaliana] gi|145333023|ref|NP_001078377.1| F-box protein CPR30 [Arabidopsis thaliana] gi|142989747|sp|Q9SU30.2|CPR30_ARATH RecName: Full=F-box protein CPR30; AltName: Full=Protein CONSTITUTIVE EXPRESSER OF PR GENES 30 gi|332657747|gb|AEE83147.1| F-box protein CPR30 [Arabidopsis thaliana] gi|332657748|gb|AEE83148.1| F-box protein CPR30 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|4725955|emb|CAB41726.1| putative protein [Arabidopsis thaliana] gi|7267958|emb|CAB78299.1| putative protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|110738553|dbj|BAF01202.1| hypothetical protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|224089631|ref|XP_002308788.1| predicted protein [Populus trichocarpa] gi|222854764|gb|EEE92311.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297809553|ref|XP_002872660.1| F-box family protein [Arabidopsis lyrata subsp. lyrata] gi|297318497|gb|EFH48919.1| F-box family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|255583935|ref|XP_002532715.1| conserved hypothetical protein [Ricinus communis] gi|223527542|gb|EEF29664.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query366
TAIR|locus:2135615413 CPR1 "AT4G12560" [Arabidopsis 0.434 0.384 0.340 2.6e-43
TAIR|locus:2082410427 AT3G06240 "AT3G06240" [Arabido 0.546 0.468 0.360 5.1e-39
TAIR|locus:2076196364 AT3G23880 "AT3G23880" [Arabido 0.718 0.722 0.314 6.6e-26
TAIR|locus:2127465402 AT4G22390 "AT4G22390" [Arabido 0.860 0.783 0.288 1e-22
TAIR|locus:2094947360 AT3G16210 "AT3G16210" [Arabido 0.674 0.686 0.281 3.3e-16
TAIR|locus:2135079378 AT4G04690 "AT4G04690" [Arabido 0.535 0.518 0.297 1.7e-10
TAIR|locus:2077452417 AT3G07870 "AT3G07870" [Arabido 0.341 0.299 0.293 2e-10
TAIR|locus:2141801426 AT4G38870 "AT4G38870" [Arabido 0.683 0.586 0.228 6.4e-10
TAIR|locus:2096079325 AT3G62380 "AT3G62380" [Arabido 0.625 0.704 0.258 7e-10
TAIR|locus:2825822475 AT1G46840 "AT1G46840" [Arabido 0.685 0.528 0.250 1.4e-09
TAIR|locus:2135615 CPR1 "AT4G12560" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 256 (95.2 bits), Expect = 2.6e-43, Sum P(2) = 2.6e-43
 Identities = 60/176 (34%), Positives = 103/176 (58%)

Query:    19 KPLLRFRCVSK-CFCGLIDSQDFVKLHLNQAIETNSGLSLIVPTLTSDNKFFSLELDSVD 77
             K L+R R +SK C+  LI+  DF++ HL++ ++T   L ++   L    + +S++LDS+D
Sbjct:    19 KTLVRCRALSKPCY-HLINDPDFIESHLHRVLQTGDHLMIL---LRGALRLYSVDLDSLD 74

Query:    78 NPVEIEYPFKKYNRGHTSVIGCCHGLLAMFNRRLGMSVFNPTTKKFKLFPQFWSDCYTDY 137
             +  ++E+P K+   G T V G  +GL+ + N    ++VFNP+T++    P    D     
Sbjct:    75 SVSDVEHPMKR--GGPTEVFGSSNGLIGLSNSPTDLAVFNPSTRQIHRLPPSSIDLPDGS 132

Query:   138 MTNNFHFDGFGYDASTDDYKLVRIIQSYKVDY---------LEVIIYSLKADTWRR 184
              T  + F G GYD+ +DDYK+VR++Q +K+D           EV ++SLK ++W+R
Sbjct:   133 STRGYVFYGLGYDSVSDDYKVVRMVQ-FKIDSEDELGCSFPYEVKVFSLKKNSWKR 187
GO:0003674 "molecular_function" evidence=ND
GO:0005737 "cytoplasm" evidence=ISM;IDA
GO:0005515 "protein binding" evidence=IPI
GO:0005634 "nucleus" evidence=IDA
GO:0031348 "negative regulation of defense response" evidence=IMP
GO:0042177 "negative regulation of protein catabolic process" evidence=IMP
TAIR|locus:2082410 AT3G06240 "AT3G06240" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2076196 AT3G23880 "AT3G23880" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2127465 AT4G22390 "AT4G22390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2094947 AT3G16210 "AT3G16210" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2135079 AT4G04690 "AT4G04690" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2077452 AT3G07870 "AT3G07870" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2141801 AT4G38870 "AT4G38870" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2096079 AT3G62380 "AT3G62380" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2825822 AT1G46840 "AT1G46840" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9SU30CPR30_ARATHNo assigned EC number0.31420.95080.8426yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.00010191
hypothetical protein (408 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query366
TIGR01640230 TIGR01640, F_box_assoc_1, F-box protein interactio 8e-28
smart0025641 smart00256, FBOX, A Receptor for Ubiquitination Ta 1e-08
pfam0064648 pfam00646, F-box, F-box domain 2e-07
pfam1293747 pfam12937, F-box-like, F-box-like 0.001
>gnl|CDD|233502 TIGR01640, F_box_assoc_1, F-box protein interaction domain Back     alignment and domain information 
 Score =  108 bits (272), Expect = 8e-28
 Identities = 51/238 (21%), Positives = 90/238 (37%), Gaps = 14/238 (5%)

Query: 97  IGCCHGLLAMFNRRLGMSVFNPTTKKFKLFPQFWSDCYTDYMTNNFHFDGFGYDASTDDY 156
           +  C GL+     +  + V+NP+T + +  P   S                GYD     Y
Sbjct: 1   VVPCDGLICFSYGK-RLVVWNPSTGQSRWLPTPKSRRSNK----ESDTYFLGYDPIEKQY 55

Query: 157 KLVRIIQSYKVDYL-EVIIYSLKADTWRRTREFPYYILDDRCNGVFIAGALHWLAARGSV 215
           K++            E  +Y+L +++WR     P +       GV I G L++LA     
Sbjct: 56  KVLCFSDRSGNRNQSEHQVYTLGSNSWRTIECSPPHHPLKSR-GVCINGVLYYLAYTLKT 114

Query: 216 RTGQNMILAFDLKSEKFYEVQQPH--GMKGGFCSQVGVLRGCLWINSYYHDEPRCDIWVM 273
                 I++FD+ SE+F E                +   +G L +     D    D+WV+
Sbjct: 115 NP-DYFIVSFDVSSERFKEFIPLPCGNSDSVDYLSLINYKGKLAVLKQKKDTNNFDLWVL 173

Query: 274 KEYGSQQSWSKLCSFSKMLHETCYYTEAFA-FSKDGDKALIYQH--SRCLHWYNLKDH 328
            + G Q+ WSKL +               + F+  G+  L  +      + +YN+ ++
Sbjct: 174 NDAGKQE-WSKLFTVPIPPLPDLVDDNFLSGFTDKGEIVLCCEDENPFYIFYYNVGEN 230

This model describes a large family of plant domains, with several hundred members in Arabidopsis thaliana. Most examples are found C-terminal to an F-box (pfam00646), a 60 amino acid motif involved in ubiquitination of target proteins to mark them for degradation. Two-hybid experiments support the idea that most members are interchangeable F-box subunits of SCF E3 complexes. Some members have two copies of this domain. Length = 230
>gnl|CDD|197608 smart00256, FBOX, A Receptor for Ubiquitination Targets Back     alignment and domain information
>gnl|CDD|201368 pfam00646, F-box, F-box domain Back     alignment and domain information
>gnl|CDD|221867 pfam12937, F-box-like, F-box-like Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 366
TIGR01640230 F_box_assoc_1 F-box protein interaction domain. Th 100.0
PF07734164 FBA_1: F-box associated; InterPro: IPR006527 This 99.76
PF08268129 FBA_3: F-box associated domain; InterPro: IPR01318 99.68
PLN03215373 ascorbic acid mannose pathway regulator 1; Provisi 99.52
PHA02713557 hypothetical protein; Provisional 99.3
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 99.25
PHA02713557 hypothetical protein; Provisional 99.21
PHA03098534 kelch-like protein; Provisional 99.2
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 99.2
PHA02790480 Kelch-like protein; Provisional 99.08
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 99.07
PLN02153341 epithiospecifier protein 99.07
PLN02193470 nitrile-specifier protein 98.99
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 98.95
PF1293747 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 98.88
PHA03098534 kelch-like protein; Provisional 98.83
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 98.82
PHA02790480 Kelch-like protein; Provisional 98.73
PF0064648 F-box: F-box domain; InterPro: IPR001810 The F-box 98.68
PLN02153341 epithiospecifier protein 98.68
PLN02193470 nitrile-specifier protein 98.61
smart0025641 FBOX A Receptor for Ubiquitination Targets. 98.57
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 98.53
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 98.39
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 98.2
KOG4693392 consensus Uncharacterized conserved protein, conta 97.84
KOG1230 521 consensus Protein containing repeated kelch motifs 97.83
KOG4693392 consensus Uncharacterized conserved protein, conta 97.7
KOG0379 482 consensus Kelch repeat-containing proteins [Genera 97.34
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.19
KOG0379482 consensus Kelch repeat-containing proteins [Genera 97.12
PF1396450 Kelch_6: Kelch motif 96.51
KOG2997366 consensus F-box protein FBX9 [General function pre 96.35
PF02191250 OLF: Olfactomedin-like domain; InterPro: IPR003112 96.32
smart00284255 OLF Olfactomedin-like domains. 96.26
KOG1230 521 consensus Protein containing repeated kelch motifs 96.23
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 96.15
KOG0281499 consensus Beta-TrCP (transducin repeats containing 95.94
KOG2055514 consensus WD40 repeat protein [General function pr 95.7
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 95.67
PF07893342 DUF1668: Protein of unknown function (DUF1668); In 95.24
PF0764649 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is 95.08
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 94.95
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 94.92
COG3055381 Uncharacterized protein conserved in bacteria [Fun 94.33
KOG4152 830 consensus Host cell transcription factor HCFC1 [Ce 93.15
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 92.66
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 92.52
smart0061247 Kelch Kelch domain. 92.19
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 92.11
KOG0316307 consensus Conserved WD40 repeat-containing protein 91.98
KOG3545249 consensus Olfactomedin and related extracellular m 90.97
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 90.9
PF1396450 Kelch_6: Kelch motif 90.6
PF07762131 DUF1618: Protein of unknown function (DUF1618); In 90.12
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 89.67
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 89.42
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 89.05
KOG0649 325 consensus WD40 repeat protein [General function pr 88.37
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 88.35
PF07893342 DUF1668: Protein of unknown function (DUF1668); In 88.14
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 88.09
cd01207111 Ena-Vasp Enabled-VASP-type homology (EVH1) domain. 87.91
PRK11138 394 outer membrane biogenesis protein BamB; Provisiona 87.35
PLN02772 398 guanylate kinase 87.34
smart0061247 Kelch Kelch domain. 86.83
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 86.67
KOG0647 347 consensus mRNA export protein (contains WD40 repea 86.28
PRK11028 330 6-phosphogluconolactonase; Provisional 85.96
PF1341549 Kelch_3: Galactose oxidase, central domain 85.32
KOG4341483 consensus F-box protein containing LRR [General fu 84.84
TIGR03300 377 assembly_YfgL outer membrane assembly lipoprotein 84.84
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 83.88
KOG1274 933 consensus WD40 repeat protein [General function pr 82.98
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 82.85
PLN00181793 protein SPA1-RELATED; Provisional 82.5
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 80.44
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 80.06
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information 
Probab=100.00  E-value=1.1e-35  Score=257.73  Aligned_cols=223  Identities=23%  Similarity=0.346  Sum_probs=167.8

Q ss_pred             EecccceEEeeecCceEEEEcCCCcceEecCCCCCCCccCCCCCCeeEeEEeecCCCCCeeEEEEEEec-ccceeEEEEE
Q 017755           97 IGCCHGLLAMFNRRLGMSVFNPTTKKFKLFPQFWSDCYTDYMTNNFHFDGFGYDASTDDYKLVRIIQSY-KVDYLEVIIY  175 (366)
Q Consensus        97 ~~s~nGLl~~~~~~~~~~V~NP~t~~~~~lP~~~~~~~~~~~~~~~~~~~~g~d~~~~~ykVv~~~~~~-~~~~~~~~vy  175 (366)
                      ++|||||||+... ..++||||+||+++.||+++... .. .  ....++||||+.+++||||++.... ......++||
T Consensus         1 ~~sCnGLlc~~~~-~~~~V~NP~T~~~~~LP~~~~~~-~~-~--~~~~~~~G~d~~~~~YKVv~~~~~~~~~~~~~~~Vy   75 (230)
T TIGR01640         1 VVPCDGLICFSYG-KRLVVWNPSTGQSRWLPTPKSRR-SN-K--ESDTYFLGYDPIEKQYKVLCFSDRSGNRNQSEHQVY   75 (230)
T ss_pred             CcccceEEEEecC-CcEEEECCCCCCEEecCCCCCcc-cc-c--ccceEEEeecccCCcEEEEEEEeecCCCCCccEEEE
Confidence            3799999999864 78999999999999999876432 10 0  1226799999999999999997642 2245789999


Q ss_pred             EcCCCcEEecCCCCceeecCCCCceEECCeEEEEEeeCCCCCCcceEEEEECCCceeE-EECCCCCCCC-CeeeEEEEEC
Q 017755          176 SLKADTWRRTREFPYYILDDRCNGVFIAGALHWLAARGSVRTGQNMILAFDLKSEKFY-EVQQPHGMKG-GFCSQVGVLR  253 (366)
Q Consensus       176 ss~~~~W~~~~~~p~~~~~~~~~~v~~~G~lyw~~~~~~~~~~~~~i~~fD~~~e~~~-~i~~P~~~~~-~~~~~l~~~~  253 (366)
                      ++++++||.+...+....... .+|++||.+||++....+. ....|++||+.+|+|+ .+++|....+ .....|++++
T Consensus        76 s~~~~~Wr~~~~~~~~~~~~~-~~v~~~G~lyw~~~~~~~~-~~~~IvsFDl~~E~f~~~i~~P~~~~~~~~~~~L~~~~  153 (230)
T TIGR01640        76 TLGSNSWRTIECSPPHHPLKS-RGVCINGVLYYLAYTLKTN-PDYFIVSFDVSSERFKEFIPLPCGNSDSVDYLSLINYK  153 (230)
T ss_pred             EeCCCCccccccCCCCccccC-CeEEECCEEEEEEEECCCC-CcEEEEEEEcccceEeeeeecCccccccccceEEEEEC
Confidence            999999999985443322222 3899999999999765321 1137999999999999 5899976532 1356899999


Q ss_pred             CEEEEEEecCCCCeEEEEEEeecCCCCCeeEEEEecCCCCCCcc-eeEEEEEEeCCCeEEEEEcC--Ce-EEEEECCCC
Q 017755          254 GCLWINSYYHDEPRCDIWVMKEYGSQQSWSKLCSFSKMLHETCY-YTEAFAFSKDGDKALIYQHS--RC-LHWYNLKDH  328 (366)
Q Consensus       254 G~L~~v~~~~~~~~l~iW~l~~~~~~~~W~~~~~i~~~~~~~~~-~~~~~~~~~~g~~i~l~~~~--~~-l~~ydl~t~  328 (366)
                      |+||++.......+++||+|++++. .+|+++++|+...++... ...++++..+|+ |++....  .. +++||++++
T Consensus       154 G~L~~v~~~~~~~~~~IWvl~d~~~-~~W~k~~~i~~~~~~~~~~~~~~~~~~~~g~-I~~~~~~~~~~~~~~y~~~~~  230 (230)
T TIGR01640       154 GKLAVLKQKKDTNNFDLWVLNDAGK-QEWSKLFTVPIPPLPDLVDDNFLSGFTDKGE-IVLCCEDENPFYIFYYNVGEN  230 (230)
T ss_pred             CEEEEEEecCCCCcEEEEEECCCCC-CceeEEEEEcCcchhhhhhheeEeEEeeCCE-EEEEeCCCCceEEEEEeccCC
Confidence            9999999865433699999998864 569999999875443322 255889988888 5554432  33 999999885

This model describes a large family of plant domains, with several hundred members in Arabidopsis thaliana. Most examples are found C-terminal to an F-box (pfam00646), a 60 amino acid motif involved in ubiquitination of target proteins to mark them for degradation. Two-hybid experiments support the idea that most members are interchangeable F-box subunits of SCF E3 complexes. Some members have two copies of this domain.
>PF07734 FBA_1: F-box associated; InterPro: IPR006527 This domain occurs in a diverse superfamily of genes in plants Back     alignment and domain information
>PF08268 FBA_3: F-box associated domain; InterPro: IPR013187 This domain occurs in a diverse superfamily of genes in plants Back     alignment and domain information
>PLN03215 ascorbic acid mannose pathway regulator 1; Provisional Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>PF12937 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 2OVQ_B 1FS1_A 1FS2_C 1FQV_I 1LDK_E 2AST_B 2ASS_B Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PF00646 F-box: F-box domain; InterPro: IPR001810 The F-box domain was first described as a sequence motif found in cyclin-F that interacts with the protein SKP1 [, ] Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>smart00256 FBOX A Receptor for Ubiquitination Targets Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>KOG4693 consensus Uncharacterized conserved protein, contains kelch repeat [General function prediction only] Back     alignment and domain information
>KOG1230 consensus Protein containing repeated kelch motifs [General function prediction only] Back     alignment and domain information
>KOG4693 consensus Uncharacterized conserved protein, contains kelch repeat [General function prediction only] Back     alignment and domain information
>KOG0379 consensus Kelch repeat-containing proteins [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0379 consensus Kelch repeat-containing proteins [General function prediction only] Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>KOG2997 consensus F-box protein FBX9 [General function prediction only] Back     alignment and domain information
>PF02191 OLF: Olfactomedin-like domain; InterPro: IPR003112 The olfactomedin-domain was first identified in olfactomedin, an extracellular matrix protein of the olfactory neuroepithelium [] Back     alignment and domain information
>smart00284 OLF Olfactomedin-like domains Back     alignment and domain information
>KOG1230 consensus Protein containing repeated kelch motifs [General function prediction only] Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function Back     alignment and domain information
>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>COG3055 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG4152 consensus Host cell transcription factor HCFC1 [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG3545 consensus Olfactomedin and related extracellular matrix glycoproteins [Extracellular structures] Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>PF07762 DUF1618: Protein of unknown function (DUF1618); InterPro: IPR011676 The proteins of this entry are mainly hypothetical proteins expressed by Oryza sativa Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>cd01207 Ena-Vasp Enabled-VASP-type homology (EVH1) domain Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PF13415 Kelch_3: Galactose oxidase, central domain Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query366
2e31_A297 FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui 1e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
>2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A Length = 297 Back     alignment and structure
 Score = 42.2 bits (98), Expect = 1e-04
 Identities = 13/48 (27%), Positives = 22/48 (45%), Gaps = 1/48 (2%)

Query: 1  MSSLPLDLISDILSRLPVKPLLRF-RCVSKCFCGLIDSQDFVKLHLNQ 47
          ++ LP  L+  +L+ LP   L++  R V   +  L+D      L   Q
Sbjct: 51 LAELPEPLLLRVLAELPATELVQACRLVCLRWKELVDGAPLWLLKCQQ 98
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query366
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 99.4
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 99.39
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 99.37
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 99.37
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 99.35
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 99.33
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 99.29
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 99.22
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 99.22
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 99.21
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 99.19
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 99.13
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 99.05
1fs1_A53 SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L 99.02
2e31_A297 FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui 99.0
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 98.94
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 98.92
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 98.87
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 98.86
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 98.73
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 98.49
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 98.39
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 98.14
3l2o_B312 F-box only protein 4; small G protein fold, UBL co 97.78
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 97.22
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 96.84
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 96.6
3jrp_A379 Fusion protein of protein transport protein SEC13 96.45
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 96.12
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 96.04
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 95.93
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 95.86
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 95.79
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 95.7
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 95.43
4e54_B435 DNA damage-binding protein 2; beta barrel, double 95.26
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 95.13
3jrp_A379 Fusion protein of protein transport protein SEC13 95.11
3jro_A 753 Fusion protein of protein transport protein SEC13 94.96
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 94.91
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 94.78
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 94.75
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 94.74
3dwl_C 377 Actin-related protein 2/3 complex subunit 1; prope 94.58
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 94.5
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 94.39
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 93.9
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 93.88
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 93.83
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 93.6
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 93.58
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 93.19
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 93.13
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 92.8
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 92.8
4g56_B357 MGC81050 protein; protein arginine methyltransfera 92.73
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 92.61
1k8k_C 372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 92.4
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 92.39
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 92.36
3q7m_A 376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 92.28
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 92.21
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 92.18
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 92.02
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 91.97
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 91.85
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 91.78
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 91.73
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 91.41
3hfq_A 347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 91.29
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 90.95
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 90.67
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 90.37
3ow8_A321 WD repeat-containing protein 61; structural genomi 90.21
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 90.2
4g56_B357 MGC81050 protein; protein arginine methyltransfera 89.96
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 89.85
3dwl_C 377 Actin-related protein 2/3 complex subunit 1; prope 88.65
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 88.32
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 88.29
2xyi_A430 Probable histone-binding protein CAF1; transcripti 88.27
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 88.25
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 88.22
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 88.05
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 87.97
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 87.79
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 87.53
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 87.39
3fm0_A 345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 87.27
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 87.25
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 87.13
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 86.9
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 86.85
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 86.85
2vdu_B 450 TRNA (guanine-N(7)-)-methyltransferase- associated 86.76
3v65_B386 Low-density lipoprotein receptor-related protein; 86.66
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 86.61
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 86.39
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 86.27
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 86.17
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 85.84
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 85.8
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 85.8
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 85.42
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 85.37
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 85.21
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 85.09
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 85.05
3jro_A 753 Fusion protein of protein transport protein SEC13 84.91
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 84.84
3v9f_A 781 Two-component system sensor histidine kinase/RESP 83.77
2dg1_A 333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 83.6
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 83.14
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 82.62
4a2l_A 795 BT_4663, two-component system sensor histidine kin 82.35
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 82.26
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 82.11
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 81.77
2pm7_B297 Protein transport protein SEC13, protein transport 81.76
4e54_B435 DNA damage-binding protein 2; beta barrel, double 81.52
3hrp_A 409 Uncharacterized protein; NP_812590.1, structural g 80.98
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 80.91
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 80.67
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 80.52
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 80.35
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
Probab=99.40  E-value=5.5e-11  Score=106.79  Aligned_cols=195  Identities=13%  Similarity=0.114  Sum_probs=128.9

Q ss_pred             eEEEEcCCCcceEecCCCCCCCccCCCCCCeeEeEEeecCCCCCeeEEEEEE-e---cccceeEEEEEEcCCCcEEecCC
Q 017755          112 GMSVFNPTTKKFKLFPQFWSDCYTDYMTNNFHFDGFGYDASTDDYKLVRIIQ-S---YKVDYLEVIIYSLKADTWRRTRE  187 (366)
Q Consensus       112 ~~~V~NP~t~~~~~lP~~~~~~~~~~~~~~~~~~~~g~d~~~~~ykVv~~~~-~---~~~~~~~~~vyss~~~~W~~~~~  187 (366)
                      .++++||.|++|..+|+++... ..     .....+  +   +  ++..+.- .   .......+++|+..+++|+.+++
T Consensus        68 ~~~~~d~~~~~W~~~~~~p~~r-~~-----~~~~~~--~---~--~lyv~GG~~~~~~~~~~~~~~~~d~~~~~W~~~~~  134 (315)
T 4asc_A           68 YFLQFDHLDSEWLGMPPLPSPR-CL-----FGLGEA--L---N--SIYVVGGREIKDGERCLDSVMCYDRLSFKWGESDP  134 (315)
T ss_dssp             EEEEEETTTTEEEECCCBSSCE-ES-----CEEEEE--T---T--EEEEECCEESSTTCCBCCCEEEEETTTTEEEECCC
T ss_pred             ceEEecCCCCeEEECCCCCcch-hc-----eeEEEE--C---C--EEEEEeCCcCCCCCcccceEEEECCCCCcEeECCC
Confidence            3889999999999999887553 11     111111  1   2  3333322 1   12345678999999999999988


Q ss_pred             CCceeecCCCCceEECCeEEEEEeeCCCCCCcceEEEEECCCceeEEE-CCCCCCCCCeeeEEEEECCEEEEEEecCCCC
Q 017755          188 FPYYILDDRCNGVFIAGALHWLAARGSVRTGQNMILAFDLKSEKFYEV-QQPHGMKGGFCSQVGVLRGCLWINSYYHDEP  266 (366)
Q Consensus       188 ~p~~~~~~~~~~v~~~G~lyw~~~~~~~~~~~~~i~~fD~~~e~~~~i-~~P~~~~~~~~~~l~~~~G~L~~v~~~~~~~  266 (366)
                      +|......  ..+.++|++|.++...........+.+||+.+++|+.+ ++|...   .....+..+|+|+++.......
T Consensus       135 ~p~~r~~~--~~~~~~~~iyv~GG~~~~~~~~~~~~~yd~~~~~W~~~~~~p~~r---~~~~~~~~~~~iyv~GG~~~~~  209 (315)
T 4asc_A          135 LPYVVYGH--TVLSHMDLVYVIGGKGSDRKCLNKMCVYDPKKFEWKELAPMQTAR---SLFGATVHDGRIIVAAGVTDTG  209 (315)
T ss_dssp             CSSCCBSC--EEEEETTEEEEECCBCTTSCBCCCEEEEETTTTEEEECCCCSSCC---BSCEEEEETTEEEEEEEECSSS
T ss_pred             CCCcccce--eEEEECCEEEEEeCCCCCCcccceEEEEeCCCCeEEECCCCCCch---hceEEEEECCEEEEEeccCCCC
Confidence            77654332  36789999999998743333335899999999999998 566544   3446677899999998865432


Q ss_pred             -eEEEEEEeecCCCCCeeEEEEecCCCCCCcceeEEEEEEeCCCeEEEEEcC---------------CeEEEEECCCCcE
Q 017755          267 -RCDIWVMKEYGSQQSWSKLCSFSKMLHETCYYTEAFAFSKDGDKALIYQHS---------------RCLHWYNLKDHKQ  330 (366)
Q Consensus       267 -~l~iW~l~~~~~~~~W~~~~~i~~~~~~~~~~~~~~~~~~~g~~i~l~~~~---------------~~l~~ydl~t~~~  330 (366)
                       .-++|.++..  ..+|+.+..++...     ....++.. ++. |++....               ..+..||+++++|
T Consensus       210 ~~~~~~~yd~~--~~~W~~~~~~p~~r-----~~~~~~~~-~~~-l~v~GG~~~~~~~~~~~~~~~~~~v~~yd~~~~~W  280 (315)
T 4asc_A          210 LTSSAEVYSIT--DNKWAPFEAFPQER-----SSLSLVSL-VGT-LYAIGGFATLETESGELVPTELNDIWRYNEEEKKW  280 (315)
T ss_dssp             EEEEEEEEETT--TTEEEEECCCSSCC-----BSCEEEEE-TTE-EEEEEEEEEEECTTSCEEEEEEEEEEEEETTTTEE
T ss_pred             ccceEEEEECC--CCeEEECCCCCCcc-----cceeEEEE-CCE-EEEECCccccCcCCccccccccCcEEEecCCCChh
Confidence             2378888752  46899875432222     12222222 444 5544211               2389999999999


Q ss_pred             EEE
Q 017755          331 DVI  333 (366)
Q Consensus       331 ~~v  333 (366)
                      +.+
T Consensus       281 ~~~  283 (315)
T 4asc_A          281 EGV  283 (315)
T ss_dssp             EEE
T ss_pred             hhh
Confidence            999
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E Back     alignment and structure
>2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 366
d1fs1a141 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [ 5e-06
d2ovrb1102 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing 6e-04
>d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure

class: All alpha proteins
fold: F-box domain
superfamily: F-box domain
family: F-box domain
domain: Skp2
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 40.8 bits (96), Expect = 5e-06
 Identities = 12/39 (30%), Positives = 18/39 (46%)

Query: 2  SSLPLDLISDILSRLPVKPLLRFRCVSKCFCGLIDSQDF 40
           SLP +L+  I S L +  LL+   V K +  L   +  
Sbjct: 2  DSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESL 40
>d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query366
d1fs1a141 Skp2 {Human (Homo sapiens) [TaxId: 9606]} 99.17
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 98.63
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 98.63
d2ovrb1102 F-box/WD repeat-containing protein 7, FBXW7 {Human 98.59
d1nexb1100 Cdc4 F-box and linker domains {Baker's yeast (Sacc 98.46
d1p22a1118 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 98.13
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 98.1
d1k3ia3 387 Galactose oxidase, central domain {Fungi (Fusarium 97.75
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 92.94
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 92.51
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 92.27
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 92.25
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 91.21
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 89.6
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 88.06
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 87.53
d2ghsa1 295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 86.12
d2p4oa1 302 Hypothetical protein All0351 homologue {Nostoc pun 86.02
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 85.61
d1pbyb_ 337 Quinohemoprotein amine dehydrogenase B chain {Para 85.37
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 84.96
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 84.03
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 83.35
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 82.66
d1jmxb_ 346 Quinohemoprotein amine dehydrogenase B chain {Pseu 80.63
>d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: F-box domain
superfamily: F-box domain
family: F-box domain
domain: Skp2
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.17  E-value=1.4e-12  Score=77.07  Aligned_cols=39  Identities=31%  Similarity=0.420  Sum_probs=36.8

Q ss_pred             CCCcHHHHHHHHccCCccceeeeeecccccccccCChhH
Q 017755            2 SSLPLDLISDILSRLPVKPLLRFRCVSKCFCGLIDSQDF   40 (366)
Q Consensus         2 ~~LP~Dll~~Il~rLP~~~l~r~~~VcK~W~~li~~~~F   40 (366)
                      +.||+|++.+||++||++++.++++|||+|+++++++.+
T Consensus         2 ~~LP~eil~~If~~L~~~dl~~~~~Vcr~w~~l~~~~~l   40 (41)
T d1fs1a1           2 DSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESL   40 (41)
T ss_dssp             CSSCHHHHHHHHTTSCGGGHHHHHTTCHHHHHHHTCGGG
T ss_pred             CcCCHHHHHHHHHcCCHHHHHHHHHHHHHHHHHhCCccc
Confidence            679999999999999999999999999999999998764
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure