Citrus Sinensis ID: 017757


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360------
MADLSFLGFLVLLLPLTLLLLLYLIVRPKPVRIPIKDRHVFITGGSSGIGLALAHQAAKEGARVSILARSGKKLEEAKQSIQLATGIEVATYSADVRDFDAVKTALDEAGPVDVLVVNQGVFVPGELEVQSLDEVRLMIDVNITGSFHMIKAALPLIKKRQNGGPASIALMSSQAGQCWTIKNTNMKGINENKLCESSGKGHGGYHVTSWRELSGQFCLLGTLLWIASKFGLRGLAEALQQEVIADDIHVSLIFPPDTETPGLEEENKRRPRLTSIIAASSGAMKADEVAKKALDGIKSGSFIVPCNSEGFLLSIATAGLSPQRSVLMAFVEVVAAGLIRFVALCFQWNWYGSIEKWHAQGKRSGN
cccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccEEEECccccHHHHHHHHHHHHccccEEEEcccHHHHHHHHHHHHHHcccEEEEEEcccccHHHHHHHHHHcccccEEEEccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcHHHHHccccccEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccHHcHHHHHHHHHHHHHHHHHHccccCEEEEEcccccccccccccccccHHHHHHHHHccccccHHHHHHHHHHHHcccccCEEcccHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccc
**DLSFLGFLVLLLPLTLLLLLYLIVRPKPVRIPIKDRHVFITGGSSGIGLALAHQAAKEGARVSILARSGKKLEEAKQSIQLATGIEVATYSADVRDFDAVKTALDEAGPVDVLVVNQGVFVPGELEVQSLDEVRLMIDVNITGSFHMIKAALPLIKKRQNGGPASIALMSSQAGQCWTIKNTNMKGINENKLCESSGKGHGGYHVTSWRELSGQFCLLGTLLWIASKFGLRGLAEALQQEVIADDIHVSLIFPPDTETPGLEEEN**************GAMKADEVAKKALDGIKSGSFIVPCNSEGFLLSIATAGLSPQRSVLMAFVEVVAAGLIRFVALCFQWNWYGSIEKW*********
xxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MADLSFLGFLVLLLPLTLLLLLYLIVRPKPVRIPIKDRHVFITGGSSGIGLALAHQAAKEGARVSILARSGKKLEEAKQSIQLATGIEVATYSADVRDFDAVKTALDEAGPVDVLVVNQGVFVPGELEVQSLDEVRLMIDVNITGSFHMIKAALPLIKKRQNGGPASIALMSSQAGQCWTIKNTNMKGINENKLCESSGKGHGGYHVTSWRELSGQFCLLGTLLWIASKFGLRGLAEALQQEVIADDIHVSLIFPPDTETPGLEEENKRRPRLTSIIAASSGAMKADEVAKKALDGIKSGSFIVPCNSEGFLLSIATAGLSPQRSVLMAFVEVVAAGLIRFVALCFQWNWYGSIEKWHAQGKRSGN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
3-ketodihydrosphingosine reductase Catalyzes the reduction of 3-ketodihydrosphingosine (KDS) to dihydrosphingosine (DHS).probableQ2KIJ5
3-ketodihydrosphingosine reductase Catalyzes the reduction of 3-ketodihydrosphingosine (KDS) to dihydrosphingosine (DHS).probableQ06136
3-ketodihydrosphingosine reductase Catalyzes the reduction of 3-ketodihydrosphingosine (KDS) to dihydrosphingosine (DHS).probableQ6GV12

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.1.-.-Acting on the CH-OH group of donors.probable
1.1.1.-15-hydroxyprostaglandin dehydrogenase (NAD(+)).probable
1.1.1.1023-dehydrosphinganine reductase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ET6, chain A
Confidence level:very confident
Coverage over the Query: 33-178,201-206,224-262,300-359
View the alignment between query and template
View the model in PyMOL
Template: 3T7C, chain A
Confidence level:very confident
Coverage over the Query: 31-178,201-206,224-339
View the alignment between query and template
View the model in PyMOL
Template: 1WMA, chain A
Confidence level:very confident
Coverage over the Query: 35-204,223-265,300-333
View the alignment between query and template
View the model in PyMOL
Template: 1OC2, chain A
Confidence level:confident
Coverage over the Query: 38-191,203-298
View the alignment between query and template
View the model in PyMOL