Citrus Sinensis ID: 017784

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360------
MVTVCQQCGDKGFYEALIGCEKCQTTAVHIYCLPVLPASFEDDVLWYCEDCEPKVAKPSTIVNPSSVLGGRCDSDSENLEIVQATQSNLRLKKNAVDRLSKNERKRNDSGSLAKAEVQKSGNSSSYLLQVHHSNNHEKDKKCGRRGELDGRSIYAEAESVKTKTSLATGGDSNSNPQYSRELLCNESDKNYEKLGRQIGLDGSSFNDEAESFRTRTSQVVTNDPPYTRECSSNAHKVVVIEVHSMGNDKKGYQFRRQRELVKNSSDTGTKSLKNSLVTTSHSFSIPKHSSNVSEKSIFEVQFKEDAVKDLSPIRWSGLNGGSSTEESESSKKETSLIASSRPSNIPEHCFVPAQPIIEPIWKEFAP
ccccccccccccccccEEEccccccccEEccccccccccccccccEEcccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEccccccccHHHHHHHHHccccccccccccccEEEccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
ccEEEccccccccHcEEEEEccccccEEEEEHHccccccccccEEEEEccccccccccccccccccccccccccccccccEHHHccccccccccccccccccccccccccccccccccccccccccEEEEccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccccccccccccHcccHccccccccccccccccccccccccEEEEEEEcccccccccHccccHHccccccccccccccccccccccccccccccccHccccccccccHHHHHHHccccEEcccccccccHHHHcccccccEEEEccccccccccEccccccEccEEHEccc
mvtvcqqcgdkgfYEALIGCEKCQTTAvhiyclpvlpasfeddvlwycedcepkvakpstivnpssvlggrcdsdsenLEIVQATQSNLRLKKNAVDRLSKnerkrndsgslAKAEvqksgnsssYLLQVHhsnnhekdkkcgrrgeldgrsiYAEAesvktktslatggdsnsnpqysRELLCNESDKNYEKLGRqigldgssfndeaesfrtrtsqvvtndppytrecssnaHKVVVIEVHSmgndkkgyqFRRQRelvknssdtgtkslknslvttshsfsipkhssnvseksiFEVQFKedavkdlspirwsglnggssteesesskkETSLIassrpsnipehcfvpaqpiiepiwkefap
MVTVCQQCGDKGFYEALIGCEKCQTTAVHIYCLPVLPASFEDDVLWYCEDCEPkvakpstivnpssvlggrcdsdSENLEIVQatqsnlrlkknavdrlsknerkrndsgslakaevqksgnSSSYLLQVhhsnnhekdkkcgrrgeLDGRSIYAeaesvktktslatggdsnsnpqYSRELLCNESDKNYEKLGRQIgldgssfndEAESfrtrtsqvvtndppytrecssnaHKVVVIEVHsmgndkkgyqfrrqrelvknssdtgtkslknslvttshsfsipkhssnvseKSIFEVQFKedavkdlspirwsglnggssteesesskKETSLIassrpsnipehCFVPAQPIIEPIWKEFAP
MVTVCQQCGDKGFYEALIGCEKCQTTAVHIYCLPVLPASFEDDVLWYCEDCEPKVAKPSTIVNPSSVLGGRCDSDSENLEIVQATQSNLRLKKNAVDRLSKNERKRNDSGSLAKAEVQKSGNSSSYLLQVHHSNNHEKDKKCGRRGELDGRSIYAEAESVKTKTSLATGGDSNSNPQYSRELLCNESDKNYEKLGRQIGLDGSSFNDEAESFRTRTSQVVTNDPPYTRECSSNAHKVVVIEVHSMGNDKKGYQFRRQRELVKNSSDTGTKSLKNSLVTTSHSFSIPKHSSNVSEKSIFEVQFKEDAVKDLSPIRWSGLNGGssteesesskketsLIASSRPSNIPEHCFVPAQPIIEPIWKEFAP
**TVCQQCGDKGFYEALIGCEKCQTTAVHIYCLPVLPASFEDDVLWYCEDCEPKVAK**TI****************************************************************************************************************************************************************************AHKVVVIEVH********************************************************************************************************HCFVPAQPIIEPIWK****
MVTVCQQCGDKGFYEALIGCEKCQTTAVHIYCLPVLPASFEDDVLWYCEDCE********************************************************************************************************************************************************************************************************************************************************************************************************CFVPAQPIIEPIWKEFA*
MVTVCQQCGDKGFYEALIGCEKCQTTAVHIYCLPVLPASFEDDVLWYCEDCEPKVAKPSTIVNPSSVLGGRCDSDSENLEIVQATQSNLRLKKNAVDRLSK**********************SSYLLQVHH*************GELDGRSIYAEAESVKTKTSLATGGDSNSNPQYSRELLCNESDKNYEKLGRQIGLDGSSFNDEAESFRTRTSQVVTNDPPYTRECSSNAHKVVVIEVHSMGNDKKGYQFRRQRELVKNSSDTGTKSLKNSLVTTSHSFSIPKHSSNVSEKSIFEVQFKEDAVKDLSPIRWSG************************PSNIPEHCFVPAQPIIEPIWKEFAP
MVTVCQQCGDKGFYEALIGCEKCQTTAVHIYCLPVLPASFEDDVLWYCEDCEP***************************************************************************************************************************************************************************PYTRECSSNAHKVVVIEVHS*******************************************************VQFKEDAVKDLSPIRWSGLNGGSSTEESESSKKETSLIASSRPSNIPEHCFVPAQPIIEPIWKEFA*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVTVCQQCGDKGFYEALIGCEKCQTTAVHIYCLPVLPASFEDDVLWYCEDCEPKVAKPSTIVNPSSVLGGRCDSDSENLEIxxxxxxxxxxxxxxxxxxxxxERKRNDSGSLAKAEVQKSGNSSSYLLQVHHSNNHEKDKKCGRRGELDGRSIYAEAESVKTKTSLATGGDSNSNPQYSRELLCNESDKNYEKLGRQIGLDGSSFNDEAESFRTRTSQVVTNDPPYTRECSSNAHKVVVIEVHSMGNDKKGYQFRRQRELVKNSSDTGTKSLKNSLVTTSHSFSIPKHSSNVSEKSIFEVQFKEDAVKDLSPIRWSGLNGGSSTEESESSKKETSLIASSRPSNIPEHCFVPAQPIIEPIWKEFAP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query366
224085087456 predicted protein [Populus trichocarpa] 0.568 0.456 0.354 1e-24
255570352366 hypothetical protein RCOM_0137170 [Ricin 0.554 0.554 0.314 8e-15
357443745369 hypothetical protein MTR_1g099270 [Medic 0.161 0.159 0.5 7e-10
224082234 474 predicted protein [Populus trichocarpa] 0.133 0.103 0.551 4e-09
297846780 482 predicted protein [Arabidopsis lyrata su 0.133 0.101 0.469 1e-08
356535812338 PREDICTED: uncharacterized protein LOC10 0.163 0.177 0.475 1e-08
7523662419 Hypothetical protein [Arabidopsis thalia 0.133 0.116 0.489 2e-08
186488901431 RING/FYVE/PHD zinc finger-containing pro 0.133 0.113 0.489 2e-08
30693717371 RING/FYVE/PHD zinc finger-containing pro 0.133 0.132 0.489 3e-08
356574534349 PREDICTED: uncharacterized protein LOC10 0.158 0.166 0.457 1e-07
>gi|224085087|ref|XP_002307485.1| predicted protein [Populus trichocarpa] gi|222856934|gb|EEE94481.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  120 bits (300), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 79/223 (35%), Positives = 124/223 (55%), Gaps = 15/223 (6%)

Query: 2   VTVCQQCGDKGFYEALIGCEKCQTTAVHIYCLPVLPASFEDDVLWYCEDCEPKVAKPSTI 61
           VT+CQ+CGD+GF  ALI C++CQ  AVH YCL VLPA+F++ V+W C  CE K  K S++
Sbjct: 7   VTICQKCGDRGFDAALIFCDECQAYAVHCYCLDVLPATFDEYVVWLCYHCESKAVKLSSL 66

Query: 62  VNPSSVLGGRCDSDSENLEIVQATQSNLRLKKNAVDRLSKNERKRNDSGSLAKAEVQKSG 121
             P+S +    DSDS  L+I+Q        KKN + RL    ++     SL  +++ +  
Sbjct: 67  DRPNSPISTESDSDS--LKIIQLK------KKNPLKRLEGKPKEMVFDCSLTNSDLLRPQ 118

Query: 122 NSSSY-LLQVHHSNNHEKDKKCGRRGELDGRSIYAEAESVKTKTSLATGGDSNSNPQYSR 180
            SS + L++V    +  KD+K G +  L   S+   AE +++K  ++   D         
Sbjct: 119 ISSDFQLVEVDCCEDDGKDQKLGSQNGLHEDSVPEVAEYLESKNPVSPLPDLQ-----LV 173

Query: 181 ELLCNESDKNYEKLGRQIGLDGSSFNDEAESFRTRTSQVVTND 223
           ++ C+++D+  +KLG +  L+ S F  E E  R + SQ+V  D
Sbjct: 174 DVDCSQNDEKDQKLGGKNSLEESGFQ-ETEPLRNKNSQLVVCD 215

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255570352|ref|XP_002526135.1| hypothetical protein RCOM_0137170 [Ricinus communis] gi|223534512|gb|EEF36211.1| hypothetical protein RCOM_0137170 [Ricinus communis] Back     alignment and taxonomy information
>gi|357443745|ref|XP_003592150.1| hypothetical protein MTR_1g099270 [Medicago truncatula] gi|355481198|gb|AES62401.1| hypothetical protein MTR_1g099270 [Medicago truncatula] Back     alignment and taxonomy information
>gi|224082234|ref|XP_002306612.1| predicted protein [Populus trichocarpa] gi|222856061|gb|EEE93608.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297846780|ref|XP_002891271.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297337113|gb|EFH67530.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|356535812|ref|XP_003536437.1| PREDICTED: uncharacterized protein LOC100817132 [Glycine max] Back     alignment and taxonomy information
>gi|7523662|gb|AAF63102.1|AC006423_3 Hypothetical protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|186488901|ref|NP_001117432.1| RING/FYVE/PHD zinc finger-containing protein [Arabidopsis thaliana] gi|225898006|dbj|BAH30335.1| hypothetical protein [Arabidopsis thaliana] gi|332193874|gb|AEE31995.1| RING/FYVE/PHD zinc finger-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|30693717|ref|NP_175045.2| RING/FYVE/PHD zinc finger-containing protein [Arabidopsis thaliana] gi|332193873|gb|AEE31994.1| RING/FYVE/PHD zinc finger-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356574534|ref|XP_003555401.1| PREDICTED: uncharacterized protein LOC100796913 [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query366
TAIR|locus:2029147431 AT1G43770 "AT1G43770" [Arabido 0.133 0.113 0.489 7.3e-11
TAIR|locus:2029147 AT1G43770 "AT1G43770" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 156 (60.0 bits), Expect = 7.3e-11, Sum P(3) = 7.3e-11
 Identities = 24/49 (48%), Positives = 32/49 (65%)

Query:     4 VCQQCGDKGFYEALIGCEKCQTTAVHIYCLPVLPASFEDDVLWYCEDCE 52
             VCQ CGD GF EAL+ C+ C   ++H YCL + P  F + + W CEDC+
Sbjct:     9 VCQTCGDIGFEEALVFCDSCMFESIHRYCLGITPIPFTEYITWICEDCD 57
GO:0003677 "DNA binding" evidence=ISS
GO:0005634 "nucleus" evidence=ISM
GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS
GO:0008270 "zinc ion binding" evidence=IEA

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query366
smart0024947 smart00249, PHD, PHD zinc finger 3e-07
pfam0062851 pfam00628, PHD, PHD-finger 8e-06
>gnl|CDD|214584 smart00249, PHD, PHD zinc finger Back     alignment and domain information 
 Score = 46.4 bits (110), Expect = 3e-07
 Identities = 15/48 (31%), Positives = 17/48 (35%), Gaps = 1/48 (2%)

Query: 4  VCQQCGDKGFYEALIGCEKCQTTAVHIYCLPVLPASFEDDVLWYCEDC 51
           C  CG       L+ C+ C     H  CL       E D  WYC  C
Sbjct: 1  YCSVCGKPDDGGELLQCDGCDR-WYHQTCLGPPLLEEEPDGKWYCPKC 47

The plant homeodomain (PHD) finger is a C4HC3 zinc-finger-like motif found in nuclear proteins thought to be involved in epigenetics and chromatin-mediated transcriptional regulation. The PHD finger binds two zinc ions using the so-called 'cross-brace' motif and is thus structurally related to the RING finger and the FYVE finger. It is not yet known if PHD fingers have a common molecular function. Several reports suggest that it can function as a protein-protein interacton domain and it was recently demonstrated that the PHD finger of p300 can cooperate with the adjacent BROMO domain in nucleosome binding in vitro. Other reports suggesting that the PHD finger is a ubiquitin ligase have been refuted as these domains were RING fingers misidentified as PHD fingers. Length = 47
>gnl|CDD|201356 pfam00628, PHD, PHD-finger Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 366
KOG0825 1134 consensus PHD Zn-finger protein [General function 98.41
PF0062851 PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( 98.22
smart0024947 PHD PHD zinc finger. The plant homeodomain (PHD) f 98.14
KOG4443 694 consensus Putative transcription factor HALR/MLL3, 97.74
KOG0955 1051 consensus PHD finger protein BR140/LIN-49 [General 97.69
KOG1512381 consensus PHD Zn-finger protein [General function 97.69
KOG0956 900 consensus PHD finger protein AF10 [General functio 97.33
KOG0954 893 consensus PHD finger protein [General function pre 97.1
PF1383136 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A. 96.92
KOG12451404 consensus Chromatin remodeling complex WSTF-ISWI, 96.81
KOG4299613 consensus PHD Zn-finger protein [General function 96.55
COG5141 669 PHD zinc finger-containing protein [General functi 96.08
cd04718148 BAH_plant_2 BAH, or Bromo Adjacent Homology domain 95.86
KOG4323464 consensus Polycomb-like PHD Zn-finger protein [Gen 95.48
KOG0383 696 consensus Predicted helicase [General function pre 91.33
KOG0957707 consensus PHD finger protein [General function pre 90.08
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information 
Probab=98.41  E-value=9.3e-08  Score=101.87  Aligned_cols=50  Identities=26%  Similarity=0.673  Sum_probs=44.6

Q ss_pred             CcccccccccCcccceeecCCCCCCCeeeccCCCCCCCCCCCCcccccccc
Q 017784            2 VTVCQQCGDKGFYEALIGCEKCQTTAVHIYCLPVLPASFEDDVLWYCEDCE   52 (366)
Q Consensus         2 VtVCdICGDvGFEElLv~CdkCrvgAEHTYCLdv~pvefvppg~WfCEECq   52 (366)
                      +.-|.||+.-.-+|+|++|+.|+.+..|+|||+.++-+ ++-+.|||.-|.
T Consensus       215 ~~~C~IC~~~DpEdVLLLCDsCN~~~YH~YCLDPdl~e-iP~~eWYC~NC~  264 (1134)
T KOG0825|consen  215 EVKCDICTVHDPEDVLLLCDSCNKVYYHVYCLDPDLSE-SPVNEWYCTNCS  264 (1134)
T ss_pred             cccceeeccCChHHhheeecccccceeeccccCccccc-ccccceecCcch
Confidence            46799999999999999999999988999999996533 667899999994

>PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00249 PHD PHD zinc finger Back     alignment and domain information
>KOG4443 consensus Putative transcription factor HALR/MLL3, involved in embryonic development [General function prediction only] Back     alignment and domain information
>KOG0955 consensus PHD finger protein BR140/LIN-49 [General function prediction only] Back     alignment and domain information
>KOG1512 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG0956 consensus PHD finger protein AF10 [General function prediction only] Back     alignment and domain information
>KOG0954 consensus PHD finger protein [General function prediction only] Back     alignment and domain information
>PF13831 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A Back     alignment and domain information
>KOG1245 consensus Chromatin remodeling complex WSTF-ISWI, large subunit (contains heterochromatin localization, PHD and BROMO domains) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG4299 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>COG5141 PHD zinc finger-containing protein [General function prediction only] Back     alignment and domain information
>cd04718 BAH_plant_2 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function Back     alignment and domain information
>KOG4323 consensus Polycomb-like PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG0383 consensus Predicted helicase [General function prediction only] Back     alignment and domain information
>KOG0957 consensus PHD finger protein [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query366
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 2e-06
2k16_A75 Transcription initiation factor TFIID subunit 3; p 1e-05
2ku3_A71 Bromodomain-containing protein 1; PHD finger, chro 2e-05
2e6s_A77 E3 ubiquitin-protein ligase UHRF2; PHD domain, str 2e-05
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 6e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-05
3asl_A70 E3 ubiquitin-protein ligase UHRF1; histone reader 9e-05
2e6r_A92 Jumonji/ARID domain-containing protein 1D; PHD dom 1e-04
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 1e-04
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 2e-04
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 2e-04
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 2e-04
2l43_A88 N-teminal domain from histone H3.3, linker, PHD1 f 3e-04
2yt5_A66 Metal-response element-binding transcription facto 3e-04
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 4e-04
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 4e-04
3shb_A77 E3 ubiquitin-protein ligase UHRF1; unmodified hist 4e-04
1we9_A64 PHD finger family protein; structural genomics, PH 5e-04
1wev_A88 Riken cDNA 1110020M19; structural genomics, PHD do 9e-04
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Length = 51 Back     alignment and structure
 Score = 43.5 bits (103), Expect = 2e-06
 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 4/50 (8%)

Query: 5  CQQCGDKGFYEALIGCEKCQTTAVHIYCL-PVLPASFEDDVLWYCEDCEP 53
          C+ C  KG  + LI C++C   A H++CL P L    + +  W C  C+P
Sbjct: 3  CKVCRKKGEDDKLILCDECN-KAFHLFCLRPALYEVPDGE--WQCPACQP 49
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Length = 75 Back     alignment and structure
>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 77 Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Length = 60 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Length = 70 Back     alignment and structure
>2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 56 Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Length = 61 Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Length = 112 Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Length = 61 Back     alignment and structure
>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Length = 66 Back     alignment and structure
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Length = 66 Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Length = 114 Back     alignment and structure
>3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Length = 77 Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Length = 64 Back     alignment and structure
>1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Length = 88 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query366
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 98.9
2ku3_A71 Bromodomain-containing protein 1; PHD finger, chro 98.79
2e6r_A92 Jumonji/ARID domain-containing protein 1D; PHD dom 98.74
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 98.72
1wev_A88 Riken cDNA 1110020M19; structural genomics, PHD do 98.7
2l43_A88 N-teminal domain from histone H3.3, linker, PHD1 f 98.69
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 98.67
2e6s_A77 E3 ubiquitin-protein ligase UHRF2; PHD domain, str 98.67
3shb_A77 E3 ubiquitin-protein ligase UHRF1; unmodified hist 98.62
3asl_A70 E3 ubiquitin-protein ligase UHRF1; histone reader 98.6
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 98.57
2yt5_A66 Metal-response element-binding transcription facto 98.56
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 98.55
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 98.54
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 98.52
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 98.5
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 98.5
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 98.45
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 98.44
2k16_A75 Transcription initiation factor TFIID subunit 3; p 98.43
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 98.41
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 98.41
2lv9_A98 Histone-lysine N-methyltransferase MLL5; zinc fing 98.3
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 98.3
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 98.09
1wen_A71 Inhibitor of growth family, member 4; ING1-like pr 97.75
4gne_A107 Histone-lysine N-methyltransferase NSD3; zinc fing 97.68
2vnf_A60 ING 4, P29ING4, inhibitor of growth protein 4; ace 97.65
1weu_A91 Inhibitor of growth family, member 4; structural g 97.63
3c6w_A59 P28ING5, inhibitor of growth protein 5; chromatin, 97.59
2jmi_A90 Protein YNG1, ING1 homolog 1; PHD, histone, recogn 97.48
1we9_A64 PHD finger family protein; structural genomics, PH 97.33
2g6q_A62 Inhibitor of growth protein 2; protein-peptide com 97.32
3o70_A68 PHD finger protein 13; PHF13, structural genomics 97.28
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 97.22
1wee_A72 PHD finger family protein; structural genomics, PH 97.2
1wew_A78 DNA-binding family protein; structural genomics, P 97.04
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 96.89
1x4i_A70 Inhibitor of growth protein 3; structural genomics 96.84
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 96.79
3o7a_A52 PHD finger protein 13 variant; PHF13, zinc finger, 96.73
1wep_A79 PHF8; structural genomics, PHD domain, riken struc 96.56
3kqi_A75 GRC5, PHD finger protein 2; metal-binding, zinc-fi 96.32
2rsd_A68 E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant 96.22
1wem_A76 Death associated transcription factor 1; structura 96.17
2xb1_A105 Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; 95.68
2lbm_A142 Transcriptional regulator ATRX; metal binding prot 95.65
2kgg_A52 Histone demethylase jarid1A; PHD finger, histone m 95.51
2vpb_A65 Hpygo1, pygopus homolog 1; gene regulation, WNT si 94.54
3kv5_D488 JMJC domain-containing histone demethylation prote 93.84
4bbq_A117 Lysine-specific demethylase 2A; oxidoreductase, ub 93.83
3kv4_A447 PHD finger protein 8; epigenetics, histone CODE, c 93.79
3pur_A 528 Lysine-specific demethylase 7 homolog; oxidoreduct 93.35
3ql9_A129 Transcriptional regulator ATRX; zinc finger, trans 93.34
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 90.82
1wil_A89 KIAA1045 protein; ring finger domain, structural g 84.55
2yuu_A83 NPKC-delta, protein kinase C delta type; metal bin 82.81
1weq_A85 PHD finger protein 7; structural genomics, PHD dom 81.02
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
Probab=98.90  E-value=6.6e-10  Score=78.06  Aligned_cols=49  Identities=35%  Similarity=0.808  Sum_probs=42.6

Q ss_pred             cccccccccCcccceeecCCCCCCCeeeccCCCCCCCCCCCCccccccccC
Q 017784            3 TVCQQCGDKGFYEALIGCEKCQTTAVHIYCLPVLPASFEDDVLWYCEDCEP   53 (366)
Q Consensus         3 tVCdICGDvGFEElLv~CdkCrvgAEHTYCLdv~pvefvppg~WfCEECqs   53 (366)
                      ..|.+||+.|.++.|+.|+.|.. +.|.||+++. ...+|.+.|+|..|..
T Consensus         1 a~C~vC~~~~~~~~ll~Cd~C~~-~~H~~Cl~p~-l~~~P~g~W~C~~C~~   49 (51)
T 1f62_A            1 ARCKVCRKKGEDDKLILCDECNK-AFHLFCLRPA-LYEVPDGEWQCPACQP   49 (51)
T ss_dssp             CCCTTTCCSSCCSCCEECTTTCC-EECHHHHCTT-CCSCCSSCCSCTTTSC
T ss_pred             CCCCCCCCCCCCCCEEECCCCCh-hhCcccCCCC-cCCCCCCcEECcCccc
Confidence            36999999999999999999997 6999999873 3357789999999975
>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Back     alignment and structure
>2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Back     alignment and structure
>3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Back     alignment and structure
>2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A Back     alignment and structure
>4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* Back     alignment and structure
>2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* Back     alignment and structure
>1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* Back     alignment and structure
>2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} Back     alignment and structure
>3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Back     alignment and structure
>1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Back     alignment and structure
>3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} Back     alignment and structure
>1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group} Back     alignment and structure
>1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} Back     alignment and structure
>2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Back     alignment and structure
>2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* Back     alignment and structure
>2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* Back     alignment and structure
>3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* Back     alignment and structure
>4bbq_A Lysine-specific demethylase 2A; oxidoreductase, ubiquitin, ligase, ubiquitination, demethyla ZF-CXXC DNA binding domain, CPG island, chromatin; 2.24A {Homo sapiens} Back     alignment and structure
>3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} Back     alignment and structure
>3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* Back     alignment and structure
>3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure
>2yuu_A NPKC-delta, protein kinase C delta type; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1weq_A PHD finger protein 7; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 366
d1mm2a_61 g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens 2e-06
d1f62a_51 g.50.1.2 (A:) Williams-Beuren syndrome transcripti 3e-06
d1we9a_64 g.50.1.2 (A:) PHD finger protein At5g26210 {Thale 6e-06
d1weea_72 g.50.1.2 (A:) PHD finger protein At1g33420 {Thale 2e-05
d1wema_76 g.50.1.2 (A:) Death associated transcription facto 4e-05
d1fp0a170 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF- 7e-05
d1wepa_79 g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus mus 4e-04
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Length = 61 Back     information, alignment and structure

class: Small proteins
fold: FYVE/PHD zinc finger
superfamily: FYVE/PHD zinc finger
family: PHD domain
domain: Mi2-beta (CHD4)
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 42.6 bits (100), Expect = 2e-06
 Identities = 15/54 (27%), Positives = 22/54 (40%), Gaps = 5/54 (9%)

Query: 4  VCQQCGDKGFYEALIGCEKCQTTAVHIYCLPVLPASFEDDVLWYCEDCEPKVAK 57
           C+ C D G    L+ C+ C + + HI+CL        +   W C  C     K
Sbjct: 11 FCRVCKDGGE---LLCCDTCPS-SYHIHCLNPPLPEIPNGE-WLCPRCTCPALK 59
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Length = 51 Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 Back     information, alignment and structure
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 72 Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 76 Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Length = 70 Back     information, alignment and structure
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query366
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 98.8
d1fp0a170 Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo 98.61
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 98.48
d1weva_88 PHD finger protein 22 {Mouse (Mus musculus) [TaxId 98.44
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 98.01
d1wepa_79 PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 97.92
d1wesa_71 PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu 97.85
d1weea_72 PHD finger protein At1g33420 {Thale cress (Arabido 97.8
d2pnxa151 Inhibitor of growth protein 4, Ing4 {Homo sapiens 97.25
d1wema_76 Death associated transcription factor 1, Datf1 (DI 97.22
d1wewa_78 Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop 95.93
d1weqa_85 PHD finger protein 7 (NYD-SP6) {Mouse (Mus musculu 87.62
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: FYVE/PHD zinc finger
superfamily: FYVE/PHD zinc finger
family: PHD domain
domain: Williams-Beuren syndrome transcription factor, WSTF
species: Human (Homo sapiens) [TaxId: 9606]

Probab=98.80  E-value=9.7e-10  Score=75.71  Aligned_cols=48  Identities=35%  Similarity=0.821  Sum_probs=42.2

Q ss_pred             ccccccccCcccceeecCCCCCCCeeeccCCCCCCCCCCCCccccccccC
Q 017784            4 VCQQCGDKGFYEALIGCEKCQTTAVHIYCLPVLPASFEDDVLWYCEDCEP   53 (366)
Q Consensus         4 VCdICGDvGFEElLv~CdkCrvgAEHTYCLdv~pvefvppg~WfCEECqs   53 (366)
                      .|.+||..+.++.|++|+.|+. ..|.+|+++. ...+|.+.|+|..|+.
T Consensus         2 ~C~vC~~~~~~~~~i~Cd~C~~-~~H~~C~~p~-~~~~p~~~W~C~~C~~   49 (51)
T d1f62a_           2 RCKVCRKKGEDDKLILCDECNK-AFHLFCLRPA-LYEVPDGEWQCPACQP   49 (51)
T ss_dssp             CCTTTCCSSCCSCCEECTTTCC-EECHHHHCTT-CCSCCSSCCSCTTTSC
T ss_pred             CCcCcCCCCCCCCEEEcCCCCC-CCCCCCCCCC-CCcCCCCCEECcCCcC
Confidence            5999999999999999999998 5999999994 4446778999999985
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1weqa_ g.50.1.2 (A:) PHD finger protein 7 (NYD-SP6) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure