Citrus Sinensis ID: 017792

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360------
MSKKDLALQQALDQITSSFGKGSIMWLGRSVTPRHVPVVSTGSFALDIALGTGGLPKGRVVEIYGPEASGKTTLALHVIAEAQRQGGYCVFIDAEHALDPSLAETIGVKTENLLLAQPDCGEQALSLVDTLIRSGSVDVVVVDSVAALVPKGELDGEMGDAHMAMQARLMSQALRKLSHSLSLSQTILIFINQVRAKLSTFGFGGPTEVTCGGNALKFYASVRLNIKRIGLVKKGEETIGSQIAVKIVKNKLAPPFKTAQFELEFGKGISRESEIIDLALKHKFASKAGAMFTYNDRNFRGKEAFKQFLVENESVREELVIKLREKLVVDHKEPQTAVTDEDSTEETVSTISPDSTDEEAAAVVEA
cccHHHHHHHHHHHHHHccccccEEEcccccccccccccccccHHHHHHHcccccccccEEEEEccccccHHHHHHHHHHHHHHcccEEEEEEccccccHHHHHHHcccccccEEcccccHHHHHHHHHHHHHcccccEEEEEEEEcccccccccccccccHHHHHHHHHHHHHHHHHcccccccEEEEEEEHHHHHHccccccccccccccccEEEEEEEEEEEEEEcccccccccccccEEEEEEEEcccccccccEEEEEEEccccccccHHHHHHHcccccccccccEEccccccccHHHHHHHHHHcHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccHHHHHHHcc
****DLA*QQALDQITSSFGKGSIMWLGRSVTPRHVPVVSTGSFALDIALGTGGLPKGRVVEIYGPEASGKTTLALHVIAEAQRQGGYCVFIDAEHALDPSLAETIGVKTENLLLAQPDCGEQALSLVDTLIRSGSVDVVVVDSVAALVPKGELDGEMGDAHMAMQARLMSQALRKLSHSLSLSQTILIFINQVRAKLSTFGFGGPTEVTCGGNALKFYASVRLNIKRIGLVKKGEETIGSQIAVKIVKNKLAPPFKTAQFELEFGKGISRESEIIDLALKHKFASKAGAMFTYNDRNFRGKEAFKQFLVENESVREELVIKLREKLVV*************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSKKDLALQQALDQITSSFGKGSIMWLGRSVTPRHVPVVSTGSFALDIALGTGGLPKGRVVEIYGPEASGKTTLALHVIAEAQRQGGYCVFIDAEHALDPSLAETIGVKTENLLLAQPDCGEQALSLVDTLIRSGSVDVVVVDSVAALVPKGELDGEMGDAHMAMQARLMSQALRKLSHSLSLSQTILIFINQVRAKLSTFGFGGPTEVTCGGNALKFYASVRLNIKRIGLVKKGEETIGSQIAVKIVKNKLAPPFKTAQFELEFGKGISRESEIIDLALKHKFASKAGAMFTYNDRNFRGKEAFKQFLVENESVREELVIKLREKLVVDHKEPQTAVTDEDSTEETVSTISPDSTDEEAAAVVEA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
DNA repair protein recA homolog 3, mitochondrial Involved in recombination ability and DNA strand transfer activity.confidentQ9ZUP2
Protein RecA Can catalyze the hydrolysis of ATP in the presence of single-stranded DNA, the ATP-dependent uptake of single-stranded DNA by duplex DNA, and the ATP-dependent hybridization of homologous single-stranded DNAs. It interacts with LexA causing its activation and leading to its autocatalytic cleavage.probableA6U9N5
Protein RecA Can catalyze the hydrolysis of ATP in the presence of single-stranded DNA, the ATP-dependent uptake of single-stranded DNA by duplex DNA, and the ATP-dependent hybridization of homologous single-stranded DNAs. It interacts with LexA causing its activation and leading to its autocatalytic cleavage.probableQ11IW6

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3CMU, chain A
Confidence level:very confident
Coverage over the Query: 3-329
View the alignment between query and template
View the model in PyMOL