Citrus Sinensis ID: 017819


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-----
MMKEESNDGSGGGNSWARVCDTCRAAACTVYCKADMAYLCSACDSRVHVANRVAFRHERVFVCESCEQAPAAFLCKADAASLCAACDAEIHSANPLARRHQRVPILPISGSVYGGRTGATPEGHHEDDQDEEEAASWLLLSNPGKNCGNGNNGNNNGFLFGGEVDEYLDLVDYTGGNQYLDQYSNGNNNQQQHGVAQKGYVGDSVVPVQCELANKDHHRHQQNFQLGLDYDSSKAGYSYNGSISHSVSVSSTDLGVVPESTMSDISISHSRPPKGTIDLFSGPPIQMPPQLTPMDREARVLRYREKKKTRKFEKTIRYASRKAYAETRPRIKGRFAKRTDAEVEVDQMFSATLMTDPGYGIVPSF
cccccccccccccccccccccccccccEEEEEccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHcccccccccccccccHHHHHHcccccccccccccccccc
****************ARVCDTCRAAACTVYCKADMAYLCSACDSRVHVANRVAFRHERVFVCESCEQAPAAFLCKADAASLCAACDAEIHSANPLARRHQRVPILPISGSVYGGRTGATP*************ASWLLLSNPGKNCGNGNNGNNNGFLFGGEVDEYLDLVDYTGGNQYLDQYSNGNNNQQQHGVAQKGYVGDSVVPVQCELANKDHHRHQQNFQLGLDYDSSKAGYSYNGSISHSVSVSSTDLGVVPESTMSDISISHSRPPKGTIDLFSGPPIQMPPQLTPMDREAR***********KFEKTIRYASRKAYAETRPRIKGRFAKRTDAEVEVDQMF*ATLMTDPGYGIVPSF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMKEESNDGSGGGNSWARVCDTCRAAACTVYCKADMAYLCSACDSRVHVANRVAFRHERVFVCESCEQAPAAFLCKADAASLCAACDAEIHSANPLARRHQRVPILPISGSVYGGRTGATPEGHHEDDQDEEEAASWLLLSNPGKNCGNGNNGNNNGFLFGGEVDEYLDLVDYTGGNQYLDQYSNGNNNQQQHGVAQKGYVGDSVVPVQCELANKDHHRHQQNFQLGLDYDSSKAGYSYNGSISHSVSVSSTDLGVVPESTMSDISISHSRPPKGTIDLFSGPPIQMPPQLTPMDREARVLRYREKKKTRKFEKTIRYASRKAYAETRPRIKGRFAKRTDAEVEVDQMFSATLMTDPGYGIVPSF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Zinc finger protein CONSTANS-LIKE 2 Putative transcription factor. Does not affect flowering time.probableQ96502
Zinc finger protein HD1 Probable transcription factor involved in the regulation of flower development. Required for the promotion of flowering under short day (SD) conditions and the suppression of flowering under long day (LD) conditions. Regulates positively the floral activator HEADING DATE 3a (HD3A) under SD and negatively under LD conditions.probableQ9FDX8

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2JUN, chain A
Confidence level:probable
Coverage over the Query: 18-105
View the alignment between query and template
View the model in PyMOL
Template: 3OGL, chain Q
Confidence level:probable
Coverage over the Query: 293-303
View the alignment between query and template
View the model in PyMOL
Template: 1QZV, chain F
Confidence level:probable
Coverage over the Query: 324-344
View the alignment between query and template
View the model in PyMOL