Citrus Sinensis ID: 017840


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-----
MLSVLRVHLPSDIPIVGCELTPYVLLRRPDNAVTTEDVPESAPIDGHFLRYKWYRIQSDRKVAVCSVHPSEQATLQCLGCVKAKIPVAKSYHCSPKCFSDAWQHHRVLHDRAASAVNENGNEEEELFGRFNSTGSGVINASLSGSASNSSLTNGSTPLYPAAVTRSGGETWFEVGRSKTYTPSADDIGHVLKFECVVVDAETKLPVGHPNTLLTSRVIPAPSPSPRRLFPVNGSDMNMMGHIDSDGRISSTGTFSVLSYNILSDVYATSESYSYCPSWALSWAYRRQNLLREIIGYRADIVCLQEVQNDHFEEFFAPELDKHGYQALYKRKTNEVEFNKAAQSLTDAILPSAQKKNALNRLVKVP
cccEEEEEccccccEEccEEEEEEEEEccccccccccccccccccccccEEEEEEEccccccEEECccccccccccccHHHcccccccccccccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccccEEEEEEEECcccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEHHHcccccccccccccccccccHHHHHHHHHHHHHcccccEEEEEcccHHHHHHHHHHHHHHccccEEEEEccccccccccccccccEEEEcccHHHHHHHccccc
**SVLRVHLPSDIPIVGCELTPYVLLRRPDNAVTTEDVPESAPIDGHFLRYKWYRIQSDRKVAVCSVHPSEQATLQCLGCVKAKIPVAKSYHCSPKCFSDAWQHHRVLHDR********GNEEEELFGRFNSTGSGVINAS******************PAAVTRSGGETWFEVGRSKTYTPSADDIGHVLKFECVVVDAETKLPVGHPNTLLTSRVIPAPSPSPRRLFPVNGSDM************SSTGTFSVLSYNILSDVYATSESYSYCPSWALSWAYRRQNLLREIIGYRADIVCLQEVQNDHFEEFFAPELDKHGYQALYKRKTNEVEFNKAAQSLTDAILPSAQKKNALNRLVKV*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLSVLRVHLPSDIPIVGCELTPYVLLRRPDNAVTTEDVPESAPIDGHFLRYKWYRIQSDRKVAVCSVHPSEQATLQCLGCVKAKIPVAKSYHCSPKCFSDAWQHHRVLHDRAASAVNENGNEEEELFGRFNSTGSGVINASLSGSASNSSLTNGSTPLYPAAVTRSGGETWFEVGRSKTYTPSADDIGHVLKFECVVVDAETKLPVGHPNTLLTSRVIPAPSPSPRRLFPVNGSDMNMMGHIDSDGRISSTGTFSVLSYNILSDVYATSESYSYCPSWALSWAYRRQNLLREIIGYRADIVCLQEVQNDHFEEFFAPELDKHGYQALYKRKTNEVEFNKAAQSLTDAILPSAQKKNALNRLVKVP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.1.-.-Acting on ester bonds.probable
3.1.13.-Exoribonucleases producing 5'-phosphomonoesters.probable
3.1.13.4Poly(A)-specific ribonuclease.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3NGQ, chain A
Confidence level:very confident
Coverage over the Query: 223-234,246-363
View the alignment between query and template
View the model in PyMOL
Template: 4B8C, chain D
Confidence level:very confident
Coverage over the Query: 152-225,261-337
View the alignment between query and template
View the model in PyMOL
Template: 3S6B, chain A
Confidence level:probable
Coverage over the Query: 122-227
View the alignment between query and template
View the model in PyMOL
Template: 2D8Q, chain A
Confidence level:probable
Coverage over the Query: 63-110
View the alignment between query and template
View the model in PyMOL