Citrus Sinensis ID: 017868


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-----
MGKGGMSQGEKEDGEEVNMAAWLLGVNTLKIQPFELPSLGPYDVLVRMKAVGICGSDVHYLKTLRCADFVVKEPMVIGHECAGVIEKVGSEVKTLVPGDRVALEPGISCWRCDHCKGGRYNLCPEMKFFATPPVHGSLANQVVHPADLCFKLPDNVSLEEGAMCEPLSVGLHACRRANIGPETNVLIMGAGPIGLVTMLGAPRAFGAPRIVIVDVDDYRLSVAKEIGADNIVKVSTNLQDIAEEVEKIQKAMGTGIDVSFDCAGLNKTMSTALGATCAGGKVCLVGMGHHEMTVPLTPAAVREVDVVGVFRYKNTWPLCLELLRSGKIDVKPLVTHRFGFSQKEVEEAFETSARGGTAIKVMFNL
ccccccccccccccccccEEEEEEEcccEEEEEEcccccccccEEEEEEEEEEEccHHHHccccccccccccccEEccccccEEEEEEcccccccccccEEEEcccccccccccccccccccccccEEEEccccccccccEEEEccccEEEcccccccccHHHHHHHHHHHHHHHHcccccccEEEEEcccHHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHccccEEEEcccccccHHHHHHHHHHHccccccEEEEccccHHHHHHHHHHHccccEEEEEccccccccccHHHHHccccEEEEEEcccccHHHHHHHHHcccccccccEEEEEccccHHHHHHHHHHHcccccEEEEEEc
ccccccccccccccccccEEEEEEEccEEEEEEcccccccccEEEEEEEEEEEcHHHHHHHHHcEccccEccccEEcccEEEEEEEEEcccccccccccEEEEccEEcccccHHHHcccHHHccccEEccEccEccccEcEEEEEHHHEEEccccccHHHHHcHHHHHHHHHHHHHHccccccEEEEEcccHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHccccEEEEcccccccHHHHHHHHHHHccccccEEEEccccHHHHHHHHHHcccccEEEEcccccccccccHHHHHccccEEEEcccccccHHHHHHHHHccccccHHHEEEEEEHHHHHHHHHHHHHHcccccEEEEEEc
mgkggmsqgekedgeEVNMAAWLLGVntlkiqpfelpslgpydVLVRMKAVGicgsdvhylktlrcadfvvkepmvigHECAGVIEKVgsevktlvpgdrvalepgiscwrcdhckggrynlcpemkffatppvhgslanqvvhpadlcfklpdnvsleegamceplsvglhacrranigpetnvlimgagPIGLVtmlgaprafgaprivivdvddyRLSVAKEIGADNIVKVSTNLQDIAEEVEKIQKAMGTgidvsfdcaglnktmstalgatcaggkvclvgmghhemtvpltpaavreVDVVGVFRYKNTWPLCLELLRsgkidvkplvthrfgfsQKEVEEAFETSARGGTAIKVMFNL
mgkggmsqgekedGEEVNMAAWLLGVNTLKIQPFELPSLGPYDVLVRMKAVGICGSDVHYLKTLRCADFVVKEPMVIGHECAGVIEKVgsevktlvpgdrvalepgiscwrcdHCKGGRYNLCPEMKFFATPPVHGSLANQVVHPADLCFKLPDNVSLEEGAMCEPLSVGLHACRRANIGPETNVLIMGAGPIGLVTMLGAPRAFGAPRIVIVDVDDYRLSVAkeigadnivkvSTNLQDIAEEVEKIQKAMGTGIDVSFDCAGLNKTMSTALGATCAGGKVCLVGMGHHEMTVPLTPAAVREVDVVGVFRYKNTWPLCLELLRSGKIDVKPLVTHRFGFSQKEVEEAfetsarggtaiKVMFNL
MGKGGMSQGEKEDGEEVNMAAWLLGVNTLKIQPFELPSLGPYDVLVRMKAVGICGSDVHYLKTLRCADFVVKEPMVIGHECAGVIEKVGSEVKTLVPGDRVALEPGISCWRCDHCKGGRYNLCPEMKFFATPPVHGSLANQVVHPADLCFKLPDNVSLEEGAMCEPLSVGLHACRRANIGPETNVLIMGAGPIGLVTMLGAPRAFGAPRIVIVDVDDYRLSVAKEIGADNIVKVSTNLQDIAEEVEKIQKAMGTGIDVSFDCAGLNKTMSTALGATCAGGKVCLVGMGHHEMTVPLTPAAVREVDVVGVFRYKNTWPLCLELLRSGKIDVKPLVTHRFGFSQKEVEEAFETSARGGTAIKVMFNL
*****************NMAAWLLGVNTLKIQPFELPSLGPYDVLVRMKAVGICGSDVHYLKTLRCADFVVKEPMVIGHECAGVIEKVGSEVKTLVPGDRVALEPGISCWRCDHCKGGRYNLCPEMKFFATPPVHGSLANQVVHPADLCFKLPDNVSLEEGAMCEPLSVGLHACRRANIGPETNVLIMGAGPIGLVTMLGAPRAFGAPRIVIVDVDDYRLSVAKEIGADNIVKVSTNLQDIAEEVEKIQKAMGTGIDVSFDCAGLNKTMSTALGATCAGGKVCLVGMGHHEMTVPLTPAAVREVDVVGVFRYKNTWPLCLELLRSGKIDVKPLVTHRFGFSQK**********************
********************AWLLGVNTLKIQPFELPSLGPYDVLVRMKAVGICGSDVHYLKTLRCADFVVKEPMVIGHECAGVIEKVGSEVKTLVPGDRVALEPGISCWRCDHCKGGRYNLCPEMKFFATPPVHGSLANQVVHPADLCFKLPDNVSLEEGAMCEPLSVGLHACRRANIGPETNVLIMGAGPIGLVTMLGAPRAFGAPRIVIVDVDDYRLSVAKEIGADNIVKVSTNLQDIAEEVEKIQKAMGTGIDVSFDCAGLNKTMSTALGATCAGGKVCLVGMGHHEMTVPLTPAAVREVDVVGVFRYKNTWPLCLELLRSGKIDVKPLVTHRFGFSQKEVEEAFETSARGGTAIKVMFNL
**************EEVNMAAWLLGVNTLKIQPFELPSLGPYDVLVRMKAVGICGSDVHYLKTLRCADFVVKEPMVIGHECAGVIEKVGSEVKTLVPGDRVALEPGISCWRCDHCKGGRYNLCPEMKFFATPPVHGSLANQVVHPADLCFKLPDNVSLEEGAMCEPLSVGLHACRRANIGPETNVLIMGAGPIGLVTMLGAPRAFGAPRIVIVDVDDYRLSVAKEIGADNIVKVSTNLQDIAEEVEKIQKAMGTGIDVSFDCAGLNKTMSTALGATCAGGKVCLVGMGHHEMTVPLTPAAVREVDVVGVFRYKNTWPLCLELLRSGKIDVKPLVTHRFGFSQKEVEEAFETSARGGTAIKVMFNL
*************GEEVNMAAWLLGVNTLKIQPFELPSLGPYDVLVRMKAVGICGSDVHYLKTLRCADFVVKEPMVIGHECAGVIEKVGSEVKTLVPGDRVALEPGISCWRCDHCKGGRYNLCPEMKFFATPPVHGSLANQVVHPADLCFKLPDNVSLEEGAMCEPLSVGLHACRRANIGPETNVLIMGAGPIGLVTMLGAPRAFGAPRIVIVDVDDYRLSVAKEIGADNIVKVSTNLQDIAEEVEKIQKAMGTGIDVSFDCAGLNKTMSTALGATCAGGKVCLVGMGHHEMTVPLTPAAVREVDVVGVFRYKNTWPLCLELLRSGKIDVKPLVTHRFGFSQKEVEEAFETSARGGTAIKVMFNL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGKGGMSQGEKEDGEEVNMAAWLLGVNTLKIQPFELPSLGPYDVLVRMKAVGICGSDVHYLKTLRCADFVVKEPMVIGHECAGVIEKVGSEVKTLVPGDRVALEPGISCWRCDHCKGGRYNLCPEMKFFATPPVHGSLANQVVHPADLCFKLPDNVSLEEGAMCEPLSVGLHACRRANIGPETNVLIMGAGPIGLVTMLGAPRAFGAPRIVIVDVDDYRLSVAKEIGADNxxxxxxxxxxxxxxxxxxxxxMGTGIDVSFDCAGLNKTMSTALGATCAGGKVCLVGMGHHEMTVPLTPAAVREVDVVGVFRYKNTWPLCLELLRSGKIDVKPLVTHRFGFSQKEVEEAFETSARGGTAIKVMFNL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query365 2.2.26 [Sep-21-2011]
Q1PSI9366 L-idonate 5-dehydrogenase no no 0.994 0.991 0.790 1e-173
Q58D31356 Sorbitol dehydrogenase OS yes no 0.928 0.952 0.492 2e-88
P27867357 Sorbitol dehydrogenase OS yes no 0.931 0.952 0.494 4e-88
Q64442357 Sorbitol dehydrogenase OS yes no 0.931 0.952 0.488 9e-88
Q00796357 Sorbitol dehydrogenase OS yes no 0.931 0.952 0.488 7e-87
Q5R5F3357 Sorbitol dehydrogenase OS yes no 0.931 0.952 0.485 1e-86
P07846354 Sorbitol dehydrogenase OS N/A no 0.926 0.954 0.487 2e-86
Q4R639357 Sorbitol dehydrogenase OS N/A no 0.931 0.952 0.482 3e-86
A1CFY8358 Probable D-xylulose reduc N/A no 0.923 0.941 0.427 3e-71
Q86ZV0358 D-xylulose reductase A OS no no 0.931 0.949 0.422 3e-71
>sp|Q1PSI9|IDND_VITVI L-idonate 5-dehydrogenase OS=Vitis vinifera GN=VIT_16s0100g00290 PE=1 SV=2 Back     alignment and function desciption
 Score =  607 bits (1565), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 291/368 (79%), Positives = 328/368 (89%), Gaps = 5/368 (1%)

Query: 1   MGKGGMSQGE---KEDGEEVNMAAWLLGVNTLKIQPFELPSLGPYDVLVRMKAVGICGSD 57
           MGKGG S+     KE GEE NMAAWLLG+ TLKIQP+ LPSLGPYDV VR+KAVGICGSD
Sbjct: 1   MGKGGNSEDAVSGKEHGEE-NMAAWLLGIKTLKIQPYILPSLGPYDVKVRIKAVGICGSD 59

Query: 58  VHYLKTLRCADFVVKEPMVIGHECAGVIEKVGSEVKTLVPGDRVALEPGISCWRCDHCKG 117
           VH+ KT+RCA+F+VK+PMVIGHECAG+IE+VGSEVK LV GDRVALEPGISC RC  C+ 
Sbjct: 60  VHHFKTMRCANFIVKKPMVIGHECAGIIEEVGSEVKNLVAGDRVALEPGISCNRCSLCRN 119

Query: 118 GRYNLCPEMKFFATPPVHGSLANQVVHPADLCFKLPDNVSLEEGAMCEPLSVGLHACRRA 177
           G+YNLC EMKFF +PP +GSLANQVVHP++LCFKLPDNVSLEEGAMCEPLSVG+HACRRA
Sbjct: 120 GQYNLCREMKFFGSPPTNGSLANQVVHPSNLCFKLPDNVSLEEGAMCEPLSVGIHACRRA 179

Query: 178 NIGPETNVLIMGAGPIGLVTMLGAPRAFGAPRIVIVDVDDYRLSVAKEIGADNIVKVSTN 237
           N+GPETNVLIMG+GPIGLVTML A RAFGAPRIV+VDVDD RL++AK++GAD+I++VSTN
Sbjct: 180 NVGPETNVLIMGSGPIGLVTMLAA-RAFGAPRIVLVDVDDQRLAIAKDLGADDIIRVSTN 238

Query: 238 LQDIAEEVEKIQKAMGTGIDVSFDCAGLNKTMSTALGATCAGGKVCLVGMGHHEMTVPLT 297
           +QD+ EEV KIQ  M TG+DVSFDC G NKTMSTAL AT AGGKVCLVG+   EMTVPLT
Sbjct: 239 IQDLDEEVAKIQSTMVTGVDVSFDCVGFNKTMSTALNATRAGGKVCLVGLAQSEMTVPLT 298

Query: 298 PAAVREVDVVGVFRYKNTWPLCLELLRSGKIDVKPLVTHRFGFSQKEVEEAFETSARGGT 357
           PAA REVD+VG+FRY+NTWPLCLE LRSGKIDVKPL+THRF FSQK+VEEAFETSARGG 
Sbjct: 299 PAAAREVDIVGIFRYRNTWPLCLEFLRSGKIDVKPLITHRFTFSQKDVEEAFETSARGGN 358

Query: 358 AIKVMFNL 365
           AIKVMFNL
Sbjct: 359 AIKVMFNL 366




Involved in the catabolism of ascorbate to tartrate. The enzyme has no activity with NADP(+).
Vitis vinifera (taxid: 29760)
EC: 1EC: .EC: 1EC: .EC: 1EC: .EC: nEC: 8
>sp|Q58D31|DHSO_BOVIN Sorbitol dehydrogenase OS=Bos taurus GN=SORD PE=2 SV=3 Back     alignment and function description
>sp|P27867|DHSO_RAT Sorbitol dehydrogenase OS=Rattus norvegicus GN=Sord PE=1 SV=4 Back     alignment and function description
>sp|Q64442|DHSO_MOUSE Sorbitol dehydrogenase OS=Mus musculus GN=Sord PE=1 SV=3 Back     alignment and function description
>sp|Q00796|DHSO_HUMAN Sorbitol dehydrogenase OS=Homo sapiens GN=SORD PE=1 SV=4 Back     alignment and function description
>sp|Q5R5F3|DHSO_PONAB Sorbitol dehydrogenase OS=Pongo abelii GN=SORD PE=2 SV=1 Back     alignment and function description
>sp|P07846|DHSO_SHEEP Sorbitol dehydrogenase OS=Ovis aries GN=SORD PE=1 SV=1 Back     alignment and function description
>sp|Q4R639|DHSO_MACFA Sorbitol dehydrogenase OS=Macaca fascicularis GN=SORD PE=2 SV=3 Back     alignment and function description
>sp|A1CFY8|XYL2_ASPCL Probable D-xylulose reductase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=xdhA PE=3 SV=2 Back     alignment and function description
>sp|Q86ZV0|XYL2_ASPOR D-xylulose reductase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=xdhA PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query365
255539581364 alcohol dehydrogenase, putative [Ricinus 0.997 1.0 0.868 0.0
224120122364 predicted protein [Populus trichocarpa] 0.997 1.0 0.863 0.0
358345351362 L-idonate 5-dehydrogenase [Medicago trun 0.991 1.0 0.852 0.0
358248648364 uncharacterized protein LOC100791559 [Gl 0.997 1.0 0.854 0.0
217072128362 unknown [Medicago truncatula] gi|3885198 0.991 1.0 0.846 0.0
356559880364 PREDICTED: L-idonate 5-dehydrogenase-lik 0.997 1.0 0.849 0.0
350538545355 sorbitol related enzyme [Solanum lycoper 0.972 1.0 0.849 0.0
225469310365 PREDICTED: L-idonate 5-dehydrogenase [Vi 0.997 0.997 0.855 1e-180
15242240364 L-iditol 2-dehydrogenase [Arabidopsis th 0.997 1.0 0.838 1e-179
21553353364 sorbitol dehydrogenase-like protein [Ara 0.997 1.0 0.835 1e-179
>gi|255539581|ref|XP_002510855.1| alcohol dehydrogenase, putative [Ricinus communis] gi|223549970|gb|EEF51457.1| alcohol dehydrogenase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  655 bits (1689), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/365 (86%), Positives = 340/365 (93%), Gaps = 1/365 (0%)

Query: 1   MGKGGMSQGEKEDGEEVNMAAWLLGVNTLKIQPFELPSLGPYDVLVRMKAVGICGSDVHY 60
           MGKGGMS GE +D +E N+AAWLLGVNTLKIQPF+LPSLGP DV VRMKAVGICGSDVHY
Sbjct: 1   MGKGGMSHGENKDVQEENLAAWLLGVNTLKIQPFKLPSLGPNDVRVRMKAVGICGSDVHY 60

Query: 61  LKTLRCADFVVKEPMVIGHECAGVIEKVGSEVKTLVPGDRVALEPGISCWRCDHCKGGRY 120
           LKTLRCA FVV+EPMVIGHECAG+IE VGSEVK LVPGDRVALEPGISCWRCD CK GRY
Sbjct: 61  LKTLRCAHFVVEEPMVIGHECAGIIEGVGSEVKNLVPGDRVALEPGISCWRCDLCKEGRY 120

Query: 121 NLCPEMKFFATPPVHGSLANQVVHPADLCFKLPDNVSLEEGAMCEPLSVGLHACRRANIG 180
           NLCPEMKFFATPPVHGSLANQVVHPADLCF+LP+NVSLEEGAMCEPLSVG+HACRRANIG
Sbjct: 121 NLCPEMKFFATPPVHGSLANQVVHPADLCFRLPENVSLEEGAMCEPLSVGVHACRRANIG 180

Query: 181 PETNVLIMGAGPIGLVTMLGAPRAFGAPRIVIVDVDDYRLSVAKEIGADNIVKVSTNLQD 240
           PETNVL+MGAGPIGLVTML A RAFGAPRIVIVDVDDYRLSVAK++GAD IVKVST++QD
Sbjct: 181 PETNVLVMGAGPIGLVTMLAA-RAFGAPRIVIVDVDDYRLSVAKDLGADAIVKVSTSIQD 239

Query: 241 IAEEVEKIQKAMGTGIDVSFDCAGLNKTMSTALGATCAGGKVCLVGMGHHEMTVPLTPAA 300
           +A+EV  I KAMGTG+DV+ DCAG NKTMS+AL AT +GGKVCLVGMGH+EMTVPLTPAA
Sbjct: 240 VADEVVLIHKAMGTGVDVTLDCAGFNKTMSSALSATRSGGKVCLVGMGHNEMTVPLTPAA 299

Query: 301 VREVDVVGVFRYKNTWPLCLELLRSGKIDVKPLVTHRFGFSQKEVEEAFETSARGGTAIK 360
            REVDV+GVFRYKNTWPLCLE LRSGKIDVKPL+THRFGFSQKEVE AFETSARGG AIK
Sbjct: 300 AREVDVIGVFRYKNTWPLCLEFLRSGKIDVKPLITHRFGFSQKEVEAAFETSARGGDAIK 359

Query: 361 VMFNL 365
           VMFNL
Sbjct: 360 VMFNL 364




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224120122|ref|XP_002318247.1| predicted protein [Populus trichocarpa] gi|222858920|gb|EEE96467.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|358345351|ref|XP_003636744.1| L-idonate 5-dehydrogenase [Medicago truncatula] gi|355502679|gb|AES83882.1| L-idonate 5-dehydrogenase [Medicago truncatula] Back     alignment and taxonomy information
>gi|358248648|ref|NP_001239661.1| uncharacterized protein LOC100791559 [Glycine max] gi|255638941|gb|ACU19772.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|217072128|gb|ACJ84424.1| unknown [Medicago truncatula] gi|388519843|gb|AFK47983.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|356559880|ref|XP_003548224.1| PREDICTED: L-idonate 5-dehydrogenase-like [Glycine max] Back     alignment and taxonomy information
>gi|350538545|ref|NP_001234092.1| sorbitol related enzyme [Solanum lycopersicum] gi|78183416|dbj|BAE47038.1| sorbitol related enzyme [Solanum lycopersicum] Back     alignment and taxonomy information
>gi|225469310|ref|XP_002269895.1| PREDICTED: L-idonate 5-dehydrogenase [Vitis vinifera] gi|297741125|emb|CBI31856.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|15242240|ref|NP_200010.1| L-iditol 2-dehydrogenase [Arabidopsis thaliana] gi|42573658|ref|NP_974925.1| L-iditol 2-dehydrogenase [Arabidopsis thaliana] gi|13877797|gb|AAK43976.1|AF370161_1 putative sorbitol dehydrogenase [Arabidopsis thaliana] gi|10177732|dbj|BAB11045.1| sorbitol dehydrogenase-like protein [Arabidopsis thaliana] gi|22136876|gb|AAM91782.1| putative sorbitol dehydrogenase [Arabidopsis thaliana] gi|110741231|dbj|BAF02166.1| sorbitol dehydrogenase-like protein [Arabidopsis thaliana] gi|332008769|gb|AED96152.1| L-iditol 2-dehydrogenase [Arabidopsis thaliana] gi|332008770|gb|AED96153.1| L-iditol 2-dehydrogenase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|21553353|gb|AAM62446.1| sorbitol dehydrogenase-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query365
TAIR|locus:2173093364 AT5G51970 [Arabidopsis thalian 0.997 1.0 0.838 6e-167
FB|FBgn0022359360 Sodh-2 "Sorbitol dehydrogenase 0.942 0.955 0.515 3.2e-88
FB|FBgn0024289360 Sodh-1 "Sorbitol dehydrogenase 0.942 0.955 0.510 1.8e-87
WB|WBGene00011003347 R04B5.5 [Caenorhabditis elegan 0.926 0.974 0.478 2.4e-85
RGD|3734357 Sord "sorbitol dehydrogenase" 0.926 0.946 0.497 6.2e-85
MGI|MGI:98266357 Sord "sorbitol dehydrogenase" 0.926 0.946 0.491 1.3e-84
UNIPROTKB|Q58D31356 SORD "Sorbitol dehydrogenase" 0.926 0.949 0.497 5.6e-84
UNIPROTKB|F1PXG0356 SORD "Uncharacterized protein" 0.926 0.949 0.5 1.2e-83
UNIPROTKB|Q00796357 SORD "Sorbitol dehydrogenase" 0.926 0.946 0.494 3.1e-83
UNIPROTKB|Q5R5F3357 SORD "Sorbitol dehydrogenase" 0.926 0.946 0.491 3.1e-83
TAIR|locus:2173093 AT5G51970 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1624 (576.7 bits), Expect = 6.0e-167, P = 6.0e-167
 Identities = 306/365 (83%), Positives = 332/365 (90%)

Query:     1 MGKGGMSQGEKEDGEEVNMAAWLLGVNTLKIQPFELPSLGPYDVLVRMKAVGICGSDVHY 60
             MGKGGMSQGE    EE NMAAWL+G+NTLKIQPF LPS+GP+DV VRMKAVGICGSDVHY
Sbjct:     1 MGKGGMSQGEGSKVEEENMAAWLVGINTLKIQPFLLPSVGPHDVRVRMKAVGICGSDVHY 60

Query:    61 LKTLRCADFVVKEPMVIGHECAGVIEKVGSEVKTLVPGDRVALEPGISCWRCDHCKGGRY 120
             LKT+RCADFVVKEPMVIGHECAG+IE+VG EVK LV GDRVALEPGISCWRC+ C+ GRY
Sbjct:    61 LKTMRCADFVVKEPMVIGHECAGIIEEVGEEVKHLVVGDRVALEPGISCWRCNLCREGRY 120

Query:   121 NLCPEMKFFATPPVHGSLANQVVHPADLCFKLPDNVSLEEGAMCEPLSVGLHACRRANIG 180
             NLCPEMKFFATPPVHGSLANQVVHPADLCFKLP+NVSLEEGAMCEPLSVG+HACRRA +G
Sbjct:   121 NLCPEMKFFATPPVHGSLANQVVHPADLCFKLPENVSLEEGAMCEPLSVGVHACRRAEVG 180

Query:   181 PETNVLIMGAGPIGLVTMLGAPRAFGAPRIVIVDVDDYRLSVAKEIGADNIVKVSTNLQD 240
             PETNVL+MGAGPIGLVTML A RAF  PRIVIVDVD+ RL+VAK++GAD IV+V+TNL+D
Sbjct:   181 PETNVLVMGAGPIGLVTMLAA-RAFSVPRIVIVDVDENRLAVAKQLGADEIVQVTTNLED 239

Query:   241 IAEEVEKIQKAMGTGIDVSFDCAGLNKTMSTALGATCAGGKVCLVGMGHHEMTVPLTPAA 300
             +  EVE+IQKAMG+ IDV+FDCAG NKTMSTAL AT  GGKVCLVGMGH  MTVPLTPAA
Sbjct:   240 VGSEVEQIQKAMGSNIDVTFDCAGFNKTMSTALAATRCGGKVCLVGMGHGIMTVPLTPAA 299

Query:   301 VREVDVVGVFRYKNTWPLCLELLRSGKIDVKPLVTHRFGFSQKEVEEAFETSARGGTAIK 360
              REVDVVGVFRYKNTWPLCLE L SGKIDVKPL+THRFGFSQKEVE+AFETSARG  AIK
Sbjct:   300 AREVDVVGVFRYKNTWPLCLEFLTSGKIDVKPLITHRFGFSQKEVEDAFETSARGSNAIK 359

Query:   361 VMFNL 365
             VMFNL
Sbjct:   360 VMFNL 364




GO:0000166 "nucleotide binding" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0005829 "cytosol" evidence=IDA
GO:0009506 "plasmodesma" evidence=IDA
FB|FBgn0022359 Sodh-2 "Sorbitol dehydrogenase-2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0024289 Sodh-1 "Sorbitol dehydrogenase 1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
WB|WBGene00011003 R04B5.5 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
RGD|3734 Sord "sorbitol dehydrogenase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:98266 Sord "sorbitol dehydrogenase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q58D31 SORD "Sorbitol dehydrogenase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PXG0 SORD "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q00796 SORD "Sorbitol dehydrogenase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5R5F3 SORD "Sorbitol dehydrogenase" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
A8GLC6TDH_SERP51, ., 1, ., 1, ., 1, 0, 30.32320.86570.9266yesno
Q64442DHSO_MOUSE1, ., 1, ., 1, ., 1, 40.48850.93150.9523yesno
A2QY54XYL2_ASPNC1, ., 1, ., 1, ., 90.41070.92320.9413yesno
Q5ARL6XYL2_EMENI1, ., 1, ., 1, ., 90.40800.93690.9526yesno
P27867DHSO_RAT1, ., 1, ., 1, ., 1, 40.49420.93150.9523yesno
A1JHX8TDH_YERE81, ., 1, ., 1, ., 1, 0, 30.32530.86300.9237yesno
Q92MT4XYLD_RHIME1, ., 1, ., 1, ., 90.41170.81910.8641yesno
Q58D31DHSO_BOVIN1, ., 1, ., 1, ., 1, 40.49270.92870.9522yesno
B2JYP4TDH_YERPB1, ., 1, ., 1, ., 1, 0, 30.32220.86300.9237yesno
Q1CD13TDH_YERPN1, ., 1, ., 1, ., 1, 0, 30.32220.86300.9237yesno
Q07786DHSO2_YEAST1, ., 1, ., 1, ., 1, 40.39090.94520.9663yesno
Q48AM4TDH_COLP31, ., 1, ., 1, ., 1, 0, 30.31830.87120.9325yesno
Q00796DHSO_HUMAN1, ., 1, ., 1, ., 1, 40.48850.93150.9523yesno
A4TSC6TDH_YERPP1, ., 1, ., 1, ., 1, 0, 30.32220.86300.9237yesno
B1JQW2TDH_YERPY1, ., 1, ., 1, ., 1, 0, 30.32220.86300.9237yesno
Q5GN51XYL2_ASPNG1, ., 1, ., 1, ., 90.41070.92320.9413yesno
P36624DHSO_SCHPO1, ., 1, ., 1, ., 1, 40.41560.85200.8638yesno
Q98D10XYLD_RHILO1, ., 1, ., 1, ., 90.38410.87670.9195yesno
Q1PSI9IDND_VITVI1, ., 1, ., 1, ., n, 80.79070.99450.9918nono
A7HEI5TDH_ANADF1, ., 1, ., 1, ., 1, 0, 30.32330.86300.9183yesno
B0TYR8TDH_FRAP21, ., 1, ., 1, ., 1, 0, 30.32200.86020.8945yesno
P35497DHSO1_YEAST1, ., 1, ., 1, ., 1, 40.39370.94520.9663yesno
A7FCU5TDH_YERP31, ., 1, ., 1, ., 1, 0, 30.32220.86300.9237yesno
Q66GC5TDH_YERPS1, ., 1, ., 1, ., 1, 0, 30.32220.86300.9237yesno
P22144XYL2_PICST1, ., 1, ., 1, ., 90.35060.92870.9338yesno
Q4WAU7XYL2_ASPFU1, ., 1, ., 1, ., 90.42520.93150.9497yesno
Q06004DHSO_BACSU1, ., 1, ., 1, ., 1, 40.40180.87670.9065yesno
Q5R5F3DHSO_PONAB1, ., 1, ., 1, ., 1, 40.48560.93150.9523yesno
Q8U7Y1XYLD_AGRT51, ., 1, ., 1, ., 90.38310.84930.8857yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.1.10.983
4th Layer1.1.1.14LOW CONFIDENCE prediction!
4th Layer1.1.1.n80.979

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query365
PLN02702364 PLN02702, PLN02702, L-idonate 5-dehydrogenase 0.0
cd05285343 cd05285, sorbitol_DH, Sorbitol dehydrogenase 0.0
cd08232339 cd08232, idonate-5-DH, L-idonate 5-dehydrogenase 7e-99
cd08236343 cd08236, sugar_DH, NAD(P)-dependent sugar dehydrog 1e-89
COG1063350 COG1063, Tdh, Threonine dehydrogenase and related 3e-89
cd08234334 cd08234, threonine_DH_like, L-threonine dehydrogen 6e-88
cd08235343 cd08235, iditol_2_DH_like, L-iditol 2-dehydrogenas 4e-82
cd08233351 cd08233, butanediol_DH_like, (2R,3R)-2,3-butanedio 2e-80
cd08261337 cd08261, Zn_ADH7, Alcohol dehydrogenases of the MD 9e-75
cd05188271 cd05188, MDR, Medium chain reductase/dehydrogenase 2e-65
cd08258306 cd08258, Zn_ADH4, Alcohol dehydrogenases of the MD 2e-62
PRK05396341 PRK05396, tdh, L-threonine 3-dehydrogenase; Valida 2e-61
cd05281341 cd05281, TDH, Threonine dehydrogenase 5e-61
TIGR00692340 TIGR00692, tdh, L-threonine 3-dehydrogenase 5e-60
cd08239339 cd08239, THR_DH_like, L-threonine dehydrogenase (T 9e-60
cd05278347 cd05278, FDH_like, Formaldehyde dehydrogenases 9e-60
cd08254338 cd08254, hydroxyacyl_CoA_DH, 6-hydroxycyclohex-1-e 3e-57
PRK09880343 PRK09880, PRK09880, L-idonate 5-dehydrogenase; Pro 6e-57
cd08279363 cd08279, Zn_ADH_class_III, Class III alcohol dehyd 3e-55
COG1064339 COG1064, AdhP, Zn-dependent alcohol dehydrogenases 2e-54
COG1062366 COG1062, AdhC, Zn-dependent alcohol dehydrogenases 5e-53
cd08285351 cd08285, NADP_ADH, NADP(H)-dependent alcohol dehyd 1e-52
cd05284340 cd05284, arabinose_DH_like, D-arabinose dehydrogen 9e-52
cd08231361 cd08231, MDR_TM0436_like, Hypothetical enzyme TM04 1e-50
cd08256350 cd08256, Zn_ADH2, Alcohol dehydrogenases of the MD 2e-50
cd08286345 cd08286, FDH_like_ADH2, formaldehyde dehydrogenase 8e-50
cd08284344 cd08284, FDH_like_2, Glutathione-dependent formald 4e-49
cd08278365 cd08278, benzyl_alcohol_DH, Benzyl alcohol dehydro 9e-47
cd08262341 cd08262, Zn_ADH8, Alcohol dehydrogenases of the MD 5e-46
cd08259332 cd08259, Zn_ADH5, Alcohol dehydrogenases of the MD 2e-44
cd08283386 cd08283, FDH_like_1, Glutathione-dependent formald 6e-44
PRK10083339 PRK10083, PRK10083, putative oxidoreductase; Provi 5e-43
PRK10309347 PRK10309, PRK10309, galactitol-1-phosphate dehydro 6e-43
cd08265384 cd08265, Zn_ADH3, Alcohol dehydrogenases of the MD 7e-43
cd05279365 cd05279, Zn_ADH1, Liver alcohol dehydrogenase and 1e-42
cd08263367 cd08263, Zn_ADH10, Alcohol dehydrogenases of the M 3e-42
cd08260345 cd08260, Zn_ADH6, Alcohol dehydrogenases of the MD 1e-41
cd08269312 cd08269, Zn_ADH9, Alcohol dehydrogenases of the MD 8e-40
cd08240350 cd08240, 6_hydroxyhexanoate_dh_like, 6-hydroxyhexa 1e-39
cd08281371 cd08281, liver_ADH_like1, Zinc-dependent alcohol d 1e-39
cd08242319 cd08242, MDR_like, Medium chain dehydrogenases/red 4e-39
cd08245330 cd08245, CAD, Cinnamyl alcohol dehydrogenases (CAD 1e-38
pfam08240108 pfam08240, ADH_N, Alcohol dehydrogenase GroES-like 9e-38
cd08297341 cd08297, CAD3, Cinnamyl alcohol dehydrogenases (CA 5e-37
COG0604326 COG0604, Qor, NADPH:quinone reductase and related 2e-36
cd05283337 cd05283, CAD1, Cinnamyl alcohol dehydrogenases (CA 9e-36
cd08287345 cd08287, FDH_like_ADH3, formaldehyde dehydrogenase 6e-35
cd08266342 cd08266, Zn_ADH_like1, Alcohol dehydrogenases of t 1e-34
cd08277365 cd08277, liver_alcohol_DH_like, Liver alcohol dehy 3e-33
cd08255277 cd08255, 2-desacetyl-2-hydroxyethyl_bacteriochloro 9e-32
cd08282375 cd08282, PFDH_like, Pseudomonas putida aldehyde-di 4e-31
TIGR03451358 TIGR03451, mycoS_dep_FDH, S-(hydroxymethyl)mycothi 5e-30
PRK13771334 PRK13771, PRK13771, putative alcohol dehydrogenase 5e-30
cd08301369 cd08301, alcohol_DH_plants, Plant alcohol dehydrog 1e-27
cd05289309 cd05289, MDR_like_2, alcohol dehydrogenase and qui 7e-27
cd08299373 cd08299, alcohol_DH_class_I_II_IV, class I, II, IV 2e-26
TIGR03989369 TIGR03989, Rxyl_3153, oxidoreductase, Rxyl_3153 fa 3e-26
PRK09422338 PRK09422, PRK09422, ethanol-active dehydrogenase/a 7e-26
cd08298329 cd08298, CAD2, Cinnamyl alcohol dehydrogenases (CA 1e-25
cd08241323 cd08241, QOR1, Quinone oxidoreductase (QOR) 6e-25
cd05286320 cd05286, QOR2, Quinone oxidoreductase (QOR) 3e-24
cd08249339 cd08249, enoyl_reductase_like, enoyl_reductase_lik 6e-24
TIGR02818368 TIGR02818, adh_III_F_hyde, S-(hydroxymethyl)glutat 2e-23
cd08300368 cd08300, alcohol_DH_class_III, class III alcohol d 4e-23
cd08276336 cd08276, MDR7, Medium chain dehydrogenases/reducta 6e-23
cd08264325 cd08264, Zn_ADH_like2, Alcohol dehydrogenases of t 1e-22
pfam00107131 pfam00107, ADH_zinc_N, Zinc-binding dehydrogenase 1e-22
cd08272326 cd08272, MDR6, Medium chain dehydrogenases/reducta 3e-22
cd08253325 cd08253, zeta_crystallin, Zeta-crystallin with NAD 3e-22
PLN02740381 PLN02740, PLN02740, Alcohol dehydrogenase-like 3e-22
TIGR03201349 TIGR03201, dearomat_had, 6-hydroxycyclohex-1-ene-1 4e-22
cd08268328 cd08268, MDR2, Medium chain dehydrogenases/reducta 1e-21
cd05282323 cd05282, ETR_like, 2-enoyl thioester reductase-lik 1e-19
cd08230355 cd08230, glucose_DH, Glucose dehydrogenase 1e-19
cd08267319 cd08267, MDR1, Medium chain dehydrogenases/reducta 3e-19
PLN02586360 PLN02586, PLN02586, probable cinnamyl alcohol dehy 6e-18
cd08296333 cd08296, CAD_like, Cinnamyl alcohol dehydrogenases 8e-18
PLN02827378 PLN02827, PLN02827, Alcohol dehydrogenase-like 1e-17
cd05276323 cd05276, p53_inducible_oxidoreductase, PIG3 p53-in 5e-17
TIGR02819393 TIGR02819, fdhA_non_GSH, formaldehyde dehydrogenas 6e-17
cd08238410 cd08238, sorbose_phosphate_red, L-sorbose-1-phosph 1e-16
cd08275337 cd08275, MDR3, Medium chain dehydrogenases/reducta 2e-16
cd05195293 cd05195, enoyl_red, enoyl reductase of polyketide 5e-16
TIGR03366280 TIGR03366, HpnZ_proposed, putative phosphonate cat 1e-14
TIGR02824325 TIGR02824, quinone_pig3, putative NAD(P)H quinone 2e-14
cd08248350 cd08248, RTN4I1, Human Reticulon 4 Interacting Pro 7e-14
cd08271325 cd08271, MDR5, Medium chain dehydrogenases/reducta 2e-13
smart00829287 smart00829, PKS_ER, Enoylreductase 1e-12
cd08291324 cd08291, ETR_like_1, 2-enoyl thioester reductase ( 5e-12
TIGR02822329 TIGR02822, adh_fam_2, zinc-binding alcohol dehydro 5e-12
PLN02178375 PLN02178, PLN02178, cinnamyl-alcohol dehydrogenase 3e-11
cd08237341 cd08237, ribitol-5-phosphate_DH, ribitol-5-phospha 5e-11
PTZ00354334 PTZ00354, PTZ00354, alcohol dehydrogenase; Provisi 1e-10
PLN02514357 PLN02514, PLN02514, cinnamyl-alcohol dehydrogenase 3e-10
cd08246393 cd08246, crotonyl_coA_red, crotonyl-CoA reductase 5e-10
cd08252336 cd08252, AL_MDR, Arginate lyase and other MDR fami 8e-09
cd08292324 cd08292, ETR_like_2, 2-enoyl thioester reductase ( 2e-08
cd08273331 cd08273, MDR8, Medium chain dehydrogenases/reducta 5e-08
TIGR01751398 TIGR01751, crot-CoA-red, crotonyl-CoA reductase 7e-08
cd08243320 cd08243, quinone_oxidoreductase_like_1, Quinone ox 8e-08
cd08244324 cd08244, MDR_enoyl_red, Possible enoyl reductase 2e-07
cd08290341 cd08290, ETR, 2-enoyl thioester reductase (ETR) 3e-07
cd08251303 cd08251, polyketide_synthase, polyketide synthase 8e-07
PRK10754327 PRK10754, PRK10754, quinone oxidoreductase, NADPH- 2e-06
pfam13602129 pfam13602, ADH_zinc_N_2, Zinc-binding dehydrogenas 6e-06
cd08247352 cd08247, AST1_like, AST1 is a cytoplasmic protein 8e-06
cd08250329 cd08250, Mgc45594_like, Mgc45594 gene product and 2e-05
TIGR01202308 TIGR01202, bchC, 2-desacetyl-2-hydroxyethyl bacter 6e-05
cd08274350 cd08274, MDR9, Medium chain dehydrogenases/reducta 4e-04
TIGR02817336 TIGR02817, adh_fam_1, zinc-binding alcohol dehydro 9e-04
>gnl|CDD|215378 PLN02702, PLN02702, L-idonate 5-dehydrogenase Back     alignment and domain information
 Score =  735 bits (1899), Expect = 0.0
 Identities = 319/365 (87%), Positives = 338/365 (92%), Gaps = 1/365 (0%)

Query: 1   MGKGGMSQGEKEDGEEVNMAAWLLGVNTLKIQPFELPSLGPYDVLVRMKAVGICGSDVHY 60
           MGKGGMS GE    EE NMAAWL+GVNTLKIQPF+LP LGP+DV VRMKAVGICGSDVHY
Sbjct: 1   MGKGGMSSGEGSGVEEENMAAWLVGVNTLKIQPFKLPPLGPHDVRVRMKAVGICGSDVHY 60

Query: 61  LKTLRCADFVVKEPMVIGHECAGVIEKVGSEVKTLVPGDRVALEPGISCWRCDHCKGGRY 120
           LKT+RCADFVVKEPMVIGHECAG+IE+VGSEVK LV GDRVALEPGISCWRC+ CK GRY
Sbjct: 61  LKTMRCADFVVKEPMVIGHECAGIIEEVGSEVKHLVVGDRVALEPGISCWRCNLCKEGRY 120

Query: 121 NLCPEMKFFATPPVHGSLANQVVHPADLCFKLPDNVSLEEGAMCEPLSVGLHACRRANIG 180
           NLCPEMKFFATPPVHGSLANQVVHPADLCFKLP+NVSLEEGAMCEPLSVG+HACRRANIG
Sbjct: 121 NLCPEMKFFATPPVHGSLANQVVHPADLCFKLPENVSLEEGAMCEPLSVGVHACRRANIG 180

Query: 181 PETNVLIMGAGPIGLVTMLGAPRAFGAPRIVIVDVDDYRLSVAKEIGADNIVKVSTNLQD 240
           PETNVL+MGAGPIGLVTML A RAFGAPRIVIVDVDD RLSVAK++GAD IV VSTN++D
Sbjct: 181 PETNVLVMGAGPIGLVTMLAA-RAFGAPRIVIVDVDDERLSVAKQLGADEIVLVSTNIED 239

Query: 241 IAEEVEKIQKAMGTGIDVSFDCAGLNKTMSTALGATCAGGKVCLVGMGHHEMTVPLTPAA 300
           +  EVE+IQKAMG GIDVSFDC G NKTMSTAL AT AGGKVCLVGMGH+EMTVPLTPAA
Sbjct: 240 VESEVEEIQKAMGGGIDVSFDCVGFNKTMSTALEATRAGGKVCLVGMGHNEMTVPLTPAA 299

Query: 301 VREVDVVGVFRYKNTWPLCLELLRSGKIDVKPLVTHRFGFSQKEVEEAFETSARGGTAIK 360
            REVDVVGVFRY+NTWPLCLE LRSGKIDVKPL+THRFGFSQKEVEEAFETSARGG AIK
Sbjct: 300 AREVDVVGVFRYRNTWPLCLEFLRSGKIDVKPLITHRFGFSQKEVEEAFETSARGGNAIK 359

Query: 361 VMFNL 365
           VMFNL
Sbjct: 360 VMFNL 364


Length = 364

>gnl|CDD|176188 cd05285, sorbitol_DH, Sorbitol dehydrogenase Back     alignment and domain information
>gnl|CDD|176194 cd08232, idonate-5-DH, L-idonate 5-dehydrogenase Back     alignment and domain information
>gnl|CDD|176198 cd08236, sugar_DH, NAD(P)-dependent sugar dehydrogenases Back     alignment and domain information
>gnl|CDD|223991 COG1063, Tdh, Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|176196 cd08234, threonine_DH_like, L-threonine dehydrogenase Back     alignment and domain information
>gnl|CDD|176197 cd08235, iditol_2_DH_like, L-iditol 2-dehydrogenase Back     alignment and domain information
>gnl|CDD|176195 cd08233, butanediol_DH_like, (2R,3R)-2,3-butanediol dehydrogenase Back     alignment and domain information
>gnl|CDD|176222 cd08261, Zn_ADH7, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176178 cd05188, MDR, Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176219 cd08258, Zn_ADH4, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|180054 PRK05396, tdh, L-threonine 3-dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|176184 cd05281, TDH, Threonine dehydrogenase Back     alignment and domain information
>gnl|CDD|129775 TIGR00692, tdh, L-threonine 3-dehydrogenase Back     alignment and domain information
>gnl|CDD|176201 cd08239, THR_DH_like, L-threonine dehydrogenase (TDH)-like Back     alignment and domain information
>gnl|CDD|176181 cd05278, FDH_like, Formaldehyde dehydrogenases Back     alignment and domain information
>gnl|CDD|176216 cd08254, hydroxyacyl_CoA_DH, 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase, N-benzyl-3-pyrrolidinol dehydrogenase, and other MDR family members Back     alignment and domain information
>gnl|CDD|182130 PRK09880, PRK09880, L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|176240 cd08279, Zn_ADH_class_III, Class III alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|223992 COG1064, AdhP, Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>gnl|CDD|223990 COG1062, AdhC, Zn-dependent alcohol dehydrogenases, class III [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|176245 cd08285, NADP_ADH, NADP(H)-dependent alcohol dehydrogenases Back     alignment and domain information
>gnl|CDD|176187 cd05284, arabinose_DH_like, D-arabinose dehydrogenase Back     alignment and domain information
>gnl|CDD|176193 cd08231, MDR_TM0436_like, Hypothetical enzyme TM0436 resembles the zinc-dependent alcohol dehydrogenases (ADH) Back     alignment and domain information
>gnl|CDD|176218 cd08256, Zn_ADH2, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176246 cd08286, FDH_like_ADH2, formaldehyde dehydrogenase (FDH)-like Back     alignment and domain information
>gnl|CDD|176244 cd08284, FDH_like_2, Glutathione-dependent formaldehyde dehydrogenase related proteins, child 2 Back     alignment and domain information
>gnl|CDD|176239 cd08278, benzyl_alcohol_DH, Benzyl alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|176223 cd08262, Zn_ADH8, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176220 cd08259, Zn_ADH5, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176243 cd08283, FDH_like_1, Glutathione-dependent formaldehyde dehydrogenase related proteins, child 1 Back     alignment and domain information
>gnl|CDD|182229 PRK10083, PRK10083, putative oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|182371 PRK10309, PRK10309, galactitol-1-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|176226 cd08265, Zn_ADH3, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176182 cd05279, Zn_ADH1, Liver alcohol dehydrogenase and related zinc-dependent alcohol dehydrogenases Back     alignment and domain information
>gnl|CDD|176224 cd08263, Zn_ADH10, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176221 cd08260, Zn_ADH6, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176230 cd08269, Zn_ADH9, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176202 cd08240, 6_hydroxyhexanoate_dh_like, 6-hydroxyhexanoate dehydrogenase Back     alignment and domain information
>gnl|CDD|176241 cd08281, liver_ADH_like1, Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) Back     alignment and domain information
>gnl|CDD|176204 cd08242, MDR_like, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176207 cd08245, CAD, Cinnamyl alcohol dehydrogenases (CAD) and related proteins Back     alignment and domain information
>gnl|CDD|219758 pfam08240, ADH_N, Alcohol dehydrogenase GroES-like domain Back     alignment and domain information
>gnl|CDD|176257 cd08297, CAD3, Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>gnl|CDD|223677 COG0604, Qor, NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] Back     alignment and domain information
>gnl|CDD|176186 cd05283, CAD1, Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>gnl|CDD|176247 cd08287, FDH_like_ADH3, formaldehyde dehydrogenase (FDH)-like Back     alignment and domain information
>gnl|CDD|176227 cd08266, Zn_ADH_like1, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176238 cd08277, liver_alcohol_DH_like, Liver alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|176217 cd08255, 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_like, 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide and other MDR family members Back     alignment and domain information
>gnl|CDD|176242 cd08282, PFDH_like, Pseudomonas putida aldehyde-dismutating formaldehyde dehydrogenase (PFDH) Back     alignment and domain information
>gnl|CDD|132492 TIGR03451, mycoS_dep_FDH, S-(hydroxymethyl)mycothiol dehydrogenase Back     alignment and domain information
>gnl|CDD|184316 PRK13771, PRK13771, putative alcohol dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|176261 cd08301, alcohol_DH_plants, Plant alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|176191 cd05289, MDR_like_2, alcohol dehydrogenase and quinone reductase-like medium chain degydrogenases/reductases Back     alignment and domain information
>gnl|CDD|176259 cd08299, alcohol_DH_class_I_II_IV, class I, II, IV alcohol dehydrogenases Back     alignment and domain information
>gnl|CDD|188504 TIGR03989, Rxyl_3153, oxidoreductase, Rxyl_3153 family Back     alignment and domain information
>gnl|CDD|181842 PRK09422, PRK09422, ethanol-active dehydrogenase/acetaldehyde-active reductase; Provisional Back     alignment and domain information
>gnl|CDD|176258 cd08298, CAD2, Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>gnl|CDD|176203 cd08241, QOR1, Quinone oxidoreductase (QOR) Back     alignment and domain information
>gnl|CDD|176189 cd05286, QOR2, Quinone oxidoreductase (QOR) Back     alignment and domain information
>gnl|CDD|176211 cd08249, enoyl_reductase_like, enoyl_reductase_like Back     alignment and domain information
>gnl|CDD|131865 TIGR02818, adh_III_F_hyde, S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|176260 cd08300, alcohol_DH_class_III, class III alcohol dehydrogenases Back     alignment and domain information
>gnl|CDD|176237 cd08276, MDR7, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176225 cd08264, Zn_ADH_like2, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|215721 pfam00107, ADH_zinc_N, Zinc-binding dehydrogenase Back     alignment and domain information
>gnl|CDD|176233 cd08272, MDR6, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176215 cd08253, zeta_crystallin, Zeta-crystallin with NADP-dependent quinone reductase activity (QOR) Back     alignment and domain information
>gnl|CDD|178341 PLN02740, PLN02740, Alcohol dehydrogenase-like Back     alignment and domain information
>gnl|CDD|132245 TIGR03201, dearomat_had, 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|176229 cd08268, MDR2, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176645 cd05282, ETR_like, 2-enoyl thioester reductase-like Back     alignment and domain information
>gnl|CDD|176192 cd08230, glucose_DH, Glucose dehydrogenase Back     alignment and domain information
>gnl|CDD|176228 cd08267, MDR1, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|166227 PLN02586, PLN02586, probable cinnamyl alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|176256 cd08296, CAD_like, Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>gnl|CDD|215442 PLN02827, PLN02827, Alcohol dehydrogenase-like Back     alignment and domain information
>gnl|CDD|176180 cd05276, p53_inducible_oxidoreductase, PIG3 p53-inducible quinone oxidoreductase Back     alignment and domain information
>gnl|CDD|234025 TIGR02819, fdhA_non_GSH, formaldehyde dehydrogenase, glutathione-independent Back     alignment and domain information
>gnl|CDD|176200 cd08238, sorbose_phosphate_red, L-sorbose-1-phosphate reductase Back     alignment and domain information
>gnl|CDD|176236 cd08275, MDR3, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176179 cd05195, enoyl_red, enoyl reductase of polyketide synthase Back     alignment and domain information
>gnl|CDD|132409 TIGR03366, HpnZ_proposed, putative phosphonate catabolism associated alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|234027 TIGR02824, quinone_pig3, putative NAD(P)H quinone oxidoreductase, PIG3 family Back     alignment and domain information
>gnl|CDD|176210 cd08248, RTN4I1, Human Reticulon 4 Interacting Protein 1 Back     alignment and domain information
>gnl|CDD|176232 cd08271, MDR5, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|214840 smart00829, PKS_ER, Enoylreductase Back     alignment and domain information
>gnl|CDD|176251 cd08291, ETR_like_1, 2-enoyl thioester reductase (ETR) like proteins, child 1 Back     alignment and domain information
>gnl|CDD|131869 TIGR02822, adh_fam_2, zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>gnl|CDD|177834 PLN02178, PLN02178, cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|176199 cd08237, ribitol-5-phosphate_DH, ribitol-5-phosphate dehydrogenase Back     alignment and domain information
>gnl|CDD|173547 PTZ00354, PTZ00354, alcohol dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|166155 PLN02514, PLN02514, cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|176208 cd08246, crotonyl_coA_red, crotonyl-CoA reductase Back     alignment and domain information
>gnl|CDD|176214 cd08252, AL_MDR, Arginate lyase and other MDR family members Back     alignment and domain information
>gnl|CDD|176252 cd08292, ETR_like_2, 2-enoyl thioester reductase (ETR) like proteins, child 2 Back     alignment and domain information
>gnl|CDD|176234 cd08273, MDR8, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|188164 TIGR01751, crot-CoA-red, crotonyl-CoA reductase Back     alignment and domain information
>gnl|CDD|176205 cd08243, quinone_oxidoreductase_like_1, Quinone oxidoreductase (QOR) Back     alignment and domain information
>gnl|CDD|176206 cd08244, MDR_enoyl_red, Possible enoyl reductase Back     alignment and domain information
>gnl|CDD|176250 cd08290, ETR, 2-enoyl thioester reductase (ETR) Back     alignment and domain information
>gnl|CDD|176213 cd08251, polyketide_synthase, polyketide synthase Back     alignment and domain information
>gnl|CDD|182701 PRK10754, PRK10754, quinone oxidoreductase, NADPH-dependent; Provisional Back     alignment and domain information
>gnl|CDD|222256 pfam13602, ADH_zinc_N_2, Zinc-binding dehydrogenase Back     alignment and domain information
>gnl|CDD|176209 cd08247, AST1_like, AST1 is a cytoplasmic protein associated with the periplasmic membrane in yeast Back     alignment and domain information
>gnl|CDD|176212 cd08250, Mgc45594_like, Mgc45594 gene product and other MDR family members Back     alignment and domain information
>gnl|CDD|130269 TIGR01202, bchC, 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase Back     alignment and domain information
>gnl|CDD|176235 cd08274, MDR9, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|234024 TIGR02817, adh_fam_1, zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 365
KOG0024354 consensus Sorbitol dehydrogenase [Secondary metabo 100.0
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 100.0
PRK09880343 L-idonate 5-dehydrogenase; Provisional 100.0
COG1062366 AdhC Zn-dependent alcohol dehydrogenases, class II 100.0
cd08239339 THR_DH_like L-threonine dehydrogenase (TDH)-like. 100.0
PLN02702364 L-idonate 5-dehydrogenase 100.0
KOG0023360 consensus Alcohol dehydrogenase, class V [Secondar 100.0
cd08281371 liver_ADH_like1 Zinc-dependent alcohol dehydrogena 100.0
PLN02740381 Alcohol dehydrogenase-like 100.0
PLN02827378 Alcohol dehydrogenase-like 100.0
COG1063350 Tdh Threonine dehydrogenase and related Zn-depende 100.0
KOG0022375 consensus Alcohol dehydrogenase, class III [Second 100.0
TIGR03451358 mycoS_dep_FDH mycothiol-dependent formaldehyde deh 100.0
PRK10309347 galactitol-1-phosphate dehydrogenase; Provisional 100.0
TIGR02819393 fdhA_non_GSH formaldehyde dehydrogenase, glutathio 100.0
TIGR02818368 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydr 100.0
cd08301369 alcohol_DH_plants Plant alcohol dehydrogenase. NAD 100.0
COG0604326 Qor NADPH:quinone reductase and related Zn-depende 100.0
PLN02586360 probable cinnamyl alcohol dehydrogenase 100.0
cd08300368 alcohol_DH_class_III class III alcohol dehydrogena 100.0
cd08233351 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrog 100.0
TIGR03201349 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-Co 100.0
cd08230355 glucose_DH Glucose dehydrogenase. Glucose dehydrog 100.0
cd08277365 liver_alcohol_DH_like Liver alcohol dehydrogenase. 100.0
PLN02178375 cinnamyl-alcohol dehydrogenase 100.0
TIGR02822329 adh_fam_2 zinc-binding alcohol dehydrogenase famil 100.0
cd08237341 ribitol-5-phosphate_DH ribitol-5-phosphate dehydro 100.0
KOG1197336 consensus Predicted quinone oxidoreductase [Energy 100.0
PLN02514357 cinnamyl-alcohol dehydrogenase 100.0
PRK10083339 putative oxidoreductase; Provisional 100.0
cd08231361 MDR_TM0436_like Hypothetical enzyme TM0436 resembl 100.0
TIGR01202308 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyl 100.0
cd08238410 sorbose_phosphate_red L-sorbose-1-phosphate reduct 100.0
cd08285351 NADP_ADH NADP(H)-dependent alcohol dehydrogenases. 100.0
cd08256350 Zn_ADH2 Alcohol dehydrogenases of the MDR family. 100.0
cd05285343 sorbitol_DH Sorbitol dehydrogenase. Sorbitol and a 100.0
cd08299373 alcohol_DH_class_I_II_IV class I, II, IV alcohol d 100.0
cd08296333 CAD_like Cinnamyl alcohol dehydrogenases (CAD). Ci 100.0
cd08283386 FDH_like_1 Glutathione-dependent formaldehyde dehy 100.0
cd05284340 arabinose_DH_like D-arabinose dehydrogenase. This 100.0
PRK05396341 tdh L-threonine 3-dehydrogenase; Validated 100.0
cd05279365 Zn_ADH1 Liver alcohol dehydrogenase and related zi 100.0
cd08246393 crotonyl_coA_red crotonyl-CoA reductase. Crotonyl- 100.0
cd08232339 idonate-5-DH L-idonate 5-dehydrogenase. L-idonate 100.0
cd08284344 FDH_like_2 Glutathione-dependent formaldehyde dehy 100.0
cd05278347 FDH_like Formaldehyde dehydrogenases. Formaldehyde 100.0
cd08286345 FDH_like_ADH2 formaldehyde dehydrogenase (FDH)-lik 100.0
cd08278365 benzyl_alcohol_DH Benzyl alcohol dehydrogenase. Be 100.0
cd08242319 MDR_like Medium chain dehydrogenases/reductase (MD 100.0
cd08262341 Zn_ADH8 Alcohol dehydrogenases of the MDR family. 100.0
cd08265384 Zn_ADH3 Alcohol dehydrogenases of the MDR family. 100.0
cd08235343 iditol_2_DH_like L-iditol 2-dehydrogenase. Putativ 100.0
cd08240350 6_hydroxyhexanoate_dh_like 6-hydroxyhexanoate dehy 100.0
cd08279363 Zn_ADH_class_III Class III alcohol dehydrogenase. 100.0
cd08261337 Zn_ADH7 Alcohol dehydrogenases of the MDR family. 100.0
cd08287345 FDH_like_ADH3 formaldehyde dehydrogenase (FDH)-lik 100.0
cd08263367 Zn_ADH10 Alcohol dehydrogenases of the MDR family. 100.0
TIGR01751398 crot-CoA-red crotonyl-CoA reductase. The enzyme mo 100.0
cd08260345 Zn_ADH6 Alcohol dehydrogenases of the MDR family. 100.0
cd08282375 PFDH_like Pseudomonas putida aldehyde-dismutating 100.0
cd08236343 sugar_DH NAD(P)-dependent sugar dehydrogenases. Th 100.0
cd05283337 CAD1 Cinnamyl alcohol dehydrogenases (CAD). Cinnam 100.0
cd05281341 TDH Threonine dehydrogenase. L-threonine dehydroge 100.0
cd08291324 ETR_like_1 2-enoyl thioester reductase (ETR) like 100.0
cd08234334 threonine_DH_like L-threonine dehydrogenase. L-thr 100.0
TIGR00692340 tdh L-threonine 3-dehydrogenase. E. coli His-90 mo 100.0
PRK09422338 ethanol-active dehydrogenase/acetaldehyde-active r 100.0
cd08297341 CAD3 Cinnamyl alcohol dehydrogenases (CAD). These 100.0
PRK13771334 putative alcohol dehydrogenase; Provisional 100.0
cd08254338 hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carbo 100.0
TIGR03366280 HpnZ_proposed putative phosphonate catabolism asso 100.0
PLN03154348 putative allyl alcohol dehydrogenase; Provisional 100.0
cd08259332 Zn_ADH5 Alcohol dehydrogenases of the MDR family. 100.0
cd08298329 CAD2 Cinnamyl alcohol dehydrogenases (CAD). These 100.0
KOG0025354 consensus Zn2+-binding dehydrogenase (nuclear rece 100.0
cd08266342 Zn_ADH_like1 Alcohol dehydrogenases of the MDR fam 100.0
cd08293345 PTGR2 Prostaglandin reductase. Prostaglandins and 100.0
cd08292324 ETR_like_2 2-enoyl thioester reductase (ETR) like 100.0
cd08295338 double_bond_reductase_like Arabidopsis alkenal dou 100.0
TIGR02825325 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15 100.0
cd08294329 leukotriene_B4_DH_like 13-PGR is a bifunctional en 100.0
cd08264325 Zn_ADH_like2 Alcohol dehydrogenases of the MDR fam 100.0
cd08274350 MDR9 Medium chain dehydrogenases/reductase (MDR)/z 100.0
cd08245330 CAD Cinnamyl alcohol dehydrogenases (CAD) and rela 100.0
cd08258306 Zn_ADH4 Alcohol dehydrogenases of the MDR family. 100.0
cd08244324 MDR_enoyl_red Possible enoyl reductase. Member ide 100.0
cd08269312 Zn_ADH9 Alcohol dehydrogenases of the MDR family. 100.0
TIGR02817336 adh_fam_1 zinc-binding alcohol dehydrogenase famil 100.0
cd08290341 ETR 2-enoyl thioester reductase (ETR). 2-enoyl thi 100.0
PTZ00354334 alcohol dehydrogenase; Provisional 100.0
cd08276336 MDR7 Medium chain dehydrogenases/reductase (MDR)/z 100.0
cd08270305 MDR4 Medium chain dehydrogenases/reductase (MDR)/z 100.0
PRK10754327 quinone oxidoreductase, NADPH-dependent; Provision 100.0
KOG1198347 consensus Zinc-binding oxidoreductase [Energy prod 100.0
COG2130340 Putative NADP-dependent oxidoreductases [General f 100.0
cd08250329 Mgc45594_like Mgc45594 gene product and other MDR 100.0
cd08249339 enoyl_reductase_like enoyl_reductase_like. Member 100.0
cd05282323 ETR_like 2-enoyl thioester reductase-like. 2-enoyl 100.0
cd05280325 MDR_yhdh_yhfp Yhdh and yhfp-like putative quinone 100.0
cd08289326 MDR_yhfp_like Yhfp putative quinone oxidoreductase 100.0
TIGR02823323 oxido_YhdH putative quinone oxidoreductase, YhdH/Y 100.0
cd08243320 quinone_oxidoreductase_like_1 Quinone oxidoreducta 100.0
cd08253325 zeta_crystallin Zeta-crystallin with NADP-dependen 100.0
cd08252336 AL_MDR Arginate lyase and other MDR family members 100.0
cd08248350 RTN4I1 Human Reticulon 4 Interacting Protein 1. Hu 100.0
cd05276323 p53_inducible_oxidoreductase PIG3 p53-inducible qu 100.0
cd08272326 MDR6 Medium chain dehydrogenases/reductase (MDR)/z 100.0
cd08288324 MDR_yhdh Yhdh putative quinone oxidoreductases. Yh 100.0
cd08247352 AST1_like AST1 is a cytoplasmic protein associated 100.0
cd05288329 PGDH Prostaglandin dehydrogenases. Prostaglandins 100.0
cd08271325 MDR5 Medium chain dehydrogenases/reductase (MDR)/z 100.0
cd05188271 MDR Medium chain reductase/dehydrogenase (MDR)/zin 100.0
cd05286320 QOR2 Quinone oxidoreductase (QOR). Quinone oxidore 100.0
cd08273331 MDR8 Medium chain dehydrogenases/reductase (MDR)/z 100.0
cd08251303 polyketide_synthase polyketide synthase. Polyketid 100.0
TIGR02824325 quinone_pig3 putative NAD(P)H quinone oxidoreducta 100.0
cd08268328 MDR2 Medium chain dehydrogenases/reductase (MDR)/z 100.0
cd08241323 QOR1 Quinone oxidoreductase (QOR). QOR catalyzes t 99.98
cd05289309 MDR_like_2 alcohol dehydrogenase and quinone reduc 99.98
cd08267319 MDR1 Medium chain dehydrogenases/reductase (MDR)/z 99.98
cd08275337 MDR3 Medium chain dehydrogenases/reductase (MDR)/z 99.97
cd05195293 enoyl_red enoyl reductase of polyketide synthase. 99.97
cd08255277 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_ 99.96
smart00829288 PKS_ER Enoylreductase. Enoylreductase in Polyketid 99.96
KOG1202 2376 consensus Animal-type fatty acid synthase and rela 99.95
KOG1196343 consensus Predicted NAD-dependent oxidoreductase [ 99.94
PF08240109 ADH_N: Alcohol dehydrogenase GroES-like domain; In 99.9
PF00107130 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: 99.68
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 99.38
PRK09424 509 pntA NAD(P) transhydrogenase subunit alpha; Provis 99.33
PF13602127 ADH_zinc_N_2: Zinc-binding dehydrogenase; PDB: 3TQ 99.27
PRK11873272 arsM arsenite S-adenosylmethyltransferase; Reviewe 98.45
TIGR00561 511 pntA NAD(P) transhydrogenase, alpha subunit. In so 98.42
PF11017314 DUF2855: Protein of unknown function (DUF2855); In 98.33
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 98.22
PRK00517250 prmA ribosomal protein L11 methyltransferase; Revi 98.21
PRK08306296 dipicolinate synthase subunit A; Reviewed 98.12
PRK05476425 S-adenosyl-L-homocysteine hydrolase; Provisional 98.1
TIGR01035417 hemA glutamyl-tRNA reductase. This enzyme, togethe 98.09
TIGR00936406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 97.83
COG2518209 Pcm Protein-L-isoaspartate carboxylmethyltransfera 97.78
PRK00045423 hemA glutamyl-tRNA reductase; Reviewed 97.75
PLN02494477 adenosylhomocysteinase 97.64
PRK12771 564 putative glutamate synthase (NADPH) small subunit; 97.5
PRK08324681 short chain dehydrogenase; Validated 97.43
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 97.42
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 97.41
COG0300265 DltE Short-chain dehydrogenases of various substra 97.38
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 97.32
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 97.3
COG2242187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism 97.29
PTZ00075476 Adenosylhomocysteinase; Provisional 97.2
TIGR00406288 prmA ribosomal protein L11 methyltransferase. Ribo 97.17
PRK13943322 protein-L-isoaspartate O-methyltransferase; Provis 97.14
PRK05993277 short chain dehydrogenase; Provisional 97.1
COG2264300 PrmA Ribosomal protein L11 methylase [Translation, 97.08
COG4221246 Short-chain alcohol dehydrogenase of unknown speci 97.07
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.05
COG2230283 Cfa Cyclopropane fatty acid synthase and related m 96.94
TIGR02469124 CbiT precorrin-6Y C5,15-methyltransferase (decarbo 96.92
PF01135209 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl 96.84
PRK12742237 oxidoreductase; Provisional 96.79
PRK13942212 protein-L-isoaspartate O-methyltransferase; Provis 96.76
COG3967245 DltE Short-chain dehydrogenase involved in D-alani 96.76
PRK14967223 putative methyltransferase; Provisional 96.71
KOG1209289 consensus 1-Acyl dihydroxyacetone phosphate reduct 96.71
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 96.67
PRK08017256 oxidoreductase; Provisional 96.66
PRK06182273 short chain dehydrogenase; Validated 96.65
PF06325295 PrmA: Ribosomal protein L11 methyltransferase (Prm 96.64
PRK05693274 short chain dehydrogenase; Provisional 96.6
TIGR00438188 rrmJ cell division protein FtsJ. 96.58
PRK08618325 ornithine cyclodeaminase; Validated 96.53
PRK11705383 cyclopropane fatty acyl phospholipid synthase; Pro 96.53
TIGR00080215 pimt protein-L-isoaspartate(D-aspartate) O-methylt 96.52
KOG1205282 consensus Predicted dehydrogenase [Secondary metab 96.51
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provis 96.46
PF02353273 CMAS: Mycolic acid cyclopropane synthetase; InterP 96.43
PRK06139 330 short chain dehydrogenase; Provisional 96.36
COG1748 389 LYS9 Saccharopine dehydrogenase and related protei 96.35
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- 96.35
PRK08261450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 96.31
PRK06057255 short chain dehydrogenase; Provisional 96.25
PF03435 386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 96.24
PRK07060245 short chain dehydrogenase; Provisional 96.22
PRK08177225 short chain dehydrogenase; Provisional 96.19
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 96.18
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 96.16
PF00106167 adh_short: short chain dehydrogenase alcohol dehyd 96.12
PRK13940414 glutamyl-tRNA reductase; Provisional 96.07
PRK06949258 short chain dehydrogenase; Provisional 96.07
PLN03209 576 translocon at the inner envelope of chloroplast su 96.03
PRK07402196 precorrin-6B methylase; Provisional 96.0
PRK06463255 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 95.98
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 95.98
PRK07825273 short chain dehydrogenase; Provisional 95.97
PRK07814263 short chain dehydrogenase; Provisional 95.95
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 95.94
TIGR01809282 Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO 95.94
PRK05866293 short chain dehydrogenase; Provisional 95.92
KOG1201300 consensus Hydroxysteroid 17-beta dehydrogenase 11 95.92
PRK07340304 ornithine cyclodeaminase; Validated 95.91
PRK12828239 short chain dehydrogenase; Provisional 95.9
PRK07502 307 cyclohexadienyl dehydrogenase; Validated 95.89
PRK07533258 enoyl-(acyl carrier protein) reductase; Provisiona 95.86
PRK08862227 short chain dehydrogenase; Provisional 95.84
PRK06200263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog 95.83
PRK07904253 short chain dehydrogenase; Provisional 95.81
PRK06196 315 oxidoreductase; Provisional 95.79
PRK06505271 enoyl-(acyl carrier protein) reductase; Provisiona 95.78
PRK00107187 gidB 16S rRNA methyltransferase GidB; Reviewed 95.77
TIGR03325262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro 95.75
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 95.73
PRK05872 296 short chain dehydrogenase; Provisional 95.7
PRK07677252 short chain dehydrogenase; Provisional 95.68
PRK06841255 short chain dehydrogenase; Provisional 95.66
PRK06483236 dihydromonapterin reductase; Provisional 95.66
cd00755231 YgdL_like Family of activating enzymes (E1) of ubi 95.63
TIGR01832248 kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod 95.62
COG0373414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 95.61
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 95.59
PRK08642253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 95.58
PRK07774250 short chain dehydrogenase; Provisional 95.58
PRK08339263 short chain dehydrogenase; Provisional 95.57
PRK07806248 short chain dehydrogenase; Provisional 95.55
PRK07831262 short chain dehydrogenase; Provisional 95.55
PRK05867253 short chain dehydrogenase; Provisional 95.54
COG0421282 SpeE Spermidine synthase [Amino acid transport and 95.53
PRK12829264 short chain dehydrogenase; Provisional 95.51
PF01262168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 95.5
PRK00811283 spermidine synthase; Provisional 95.48
PRK06500249 short chain dehydrogenase; Provisional 95.46
PRK12549284 shikimate 5-dehydrogenase; Reviewed 95.46
COG1179263 Dinucleotide-utilizing enzymes involved in molybdo 95.46
PRK03369 488 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.45
PRK06718202 precorrin-2 dehydrogenase; Reviewed 95.45
PRK08628258 short chain dehydrogenase; Provisional 95.45
PRK06180277 short chain dehydrogenase; Provisional 95.45
PRK07062265 short chain dehydrogenase; Provisional 95.44
PRK08589272 short chain dehydrogenase; Validated 95.44
COG2519256 GCD14 tRNA(1-methyladenosine) methyltransferase an 95.44
PRK08415274 enoyl-(acyl carrier protein) reductase; Provisiona 95.43
PF01118121 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi 95.42
PRK09072263 short chain dehydrogenase; Provisional 95.4
PRK01581374 speE spermidine synthase; Validated 95.39
PRK04148134 hypothetical protein; Provisional 95.38
PRK00312212 pcm protein-L-isoaspartate O-methyltransferase; Re 95.35
PRK12939250 short chain dehydrogenase; Provisional 95.35
PRK07231251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 95.35
PRK06603260 enoyl-(acyl carrier protein) reductase; Provisiona 95.34
PRK08317241 hypothetical protein; Provisional 95.32
PRK06198260 short chain dehydrogenase; Provisional 95.32
PF00670162 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase 95.31
PRK07453 322 protochlorophyllide oxidoreductase; Validated 95.28
PRK08267260 short chain dehydrogenase; Provisional 95.28
cd05311226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 95.26
PRK08265261 short chain dehydrogenase; Provisional 95.24
PF01408120 GFO_IDH_MocA: Oxidoreductase family, NAD-binding R 95.23
TIGR02355240 moeB molybdopterin synthase sulfurylase MoeB. This 95.19
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 95.19
PRK05854 313 short chain dehydrogenase; Provisional 95.19
PRK07478254 short chain dehydrogenase; Provisional 95.17
PRK07688 339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 95.14
PRK08690261 enoyl-(acyl carrier protein) reductase; Provisiona 95.14
PRK12475 338 thiamine/molybdopterin biosynthesis MoeB-like prot 95.14
PRK12823260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat 95.13
PRK08703239 short chain dehydrogenase; Provisional 95.12
PRK06079252 enoyl-(acyl carrier protein) reductase; Provisiona 95.11
TIGR03840213 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d 95.11
PRK08643256 acetoin reductase; Validated 95.08
COG0031300 CysK Cysteine synthase [Amino acid transport and m 95.08
PRK08340259 glucose-1-dehydrogenase; Provisional 95.07
PRK08159272 enoyl-(acyl carrier protein) reductase; Provisiona 95.07
PRK07523255 gluconate 5-dehydrogenase; Provisional 95.06
COG3288356 PntA NAD/NADP transhydrogenase alpha subunit [Ener 95.06
PLN02780320 ketoreductase/ oxidoreductase 95.06
PRK07024257 short chain dehydrogenase; Provisional 95.04
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 95.03
TIGR03215 285 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylati 95.02
PRK06719157 precorrin-2 dehydrogenase; Validated 95.02
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 95.01
PRK08300 302 acetaldehyde dehydrogenase; Validated 95.0
PF01113124 DapB_N: Dihydrodipicolinate reductase, N-terminus; 95.0
TIGR00446264 nop2p NOL1/NOP2/sun family putative RNA methylase. 94.99
PRK05717255 oxidoreductase; Validated 94.96
PRK06194287 hypothetical protein; Provisional 94.95
PRK06128300 oxidoreductase; Provisional 94.95
PRK06172253 short chain dehydrogenase; Provisional 94.95
PRK07109 334 short chain dehydrogenase; Provisional 94.94
cd01483143 E1_enzyme_family Superfamily of activating enzymes 94.92
PRK06179270 short chain dehydrogenase; Provisional 94.92
PRK07326237 short chain dehydrogenase; Provisional 94.9
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 94.9
PLN02366308 spermidine synthase 94.9
PRK07063260 short chain dehydrogenase; Provisional 94.89
PRK07984262 enoyl-(acyl carrier protein) reductase; Provisiona 94.89
PRK12481251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 94.89
PRK12384259 sorbitol-6-phosphate dehydrogenase; Provisional 94.88
PRK07035252 short chain dehydrogenase; Provisional 94.88
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 94.88
PRK08226263 short chain dehydrogenase; Provisional 94.86
PRK05690245 molybdopterin biosynthesis protein MoeB; Provision 94.86
PRK06953222 short chain dehydrogenase; Provisional 94.84
KOG1200256 consensus Mitochondrial/plastidial beta-ketoacyl-A 94.84
PRK07454241 short chain dehydrogenase; Provisional 94.83
PRK08264238 short chain dehydrogenase; Validated 94.83
PLN02253280 xanthoxin dehydrogenase 94.82
PRK06935258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 94.8
PRK04266226 fibrillarin; Provisional 94.8
PLN03075296 nicotianamine synthase; Provisional 94.8
TIGR00417270 speE spermidine synthase. the SpeE subunit of sper 94.79
PLN02819 1042 lysine-ketoglutarate reductase/saccharopine dehydr 94.78
PRK05875276 short chain dehydrogenase; Provisional 94.78
PRK06138252 short chain dehydrogenase; Provisional 94.78
PRK08277278 D-mannonate oxidoreductase; Provisional 94.77
PRK07576264 short chain dehydrogenase; Provisional 94.75
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 94.74
PRK08063250 enoyl-(acyl carrier protein) reductase; Provisiona 94.72
TIGR00138181 gidB 16S rRNA methyltransferase GidB. GidB (glucos 94.72
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone 94.71
KOG1252362 consensus Cystathionine beta-synthase and related 94.71
PRK15116268 sulfur acceptor protein CsdL; Provisional 94.7
PRK04457262 spermidine synthase; Provisional 94.7
PRK12743256 oxidoreductase; Provisional 94.68
PRK08213259 gluconate 5-dehydrogenase; Provisional 94.66
PRK07890258 short chain dehydrogenase; Provisional 94.65
PRK06482276 short chain dehydrogenase; Provisional 94.63
PRK05562223 precorrin-2 dehydrogenase; Provisional 94.6
PRK05597 355 molybdopterin biosynthesis protein MoeB; Validated 94.59
PRK06141314 ornithine cyclodeaminase; Validated 94.58
TIGR02992326 ectoine_eutC ectoine utilization protein EutC. Mem 94.55
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 94.55
PRK06125259 short chain dehydrogenase; Provisional 94.54
TIGR03206250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr 94.53
PRK08328231 hypothetical protein; Provisional 94.52
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 94.52
PRK07856252 short chain dehydrogenase; Provisional 94.52
PRK05876275 short chain dehydrogenase; Provisional 94.51
PLN02233261 ubiquinone biosynthesis methyltransferase 94.51
PRK08416260 7-alpha-hydroxysteroid dehydrogenase; Provisional 94.5
PF1382323 ADH_N_assoc: Alcohol dehydrogenase GroES-associate 94.5
PRK08251248 short chain dehydrogenase; Provisional 94.49
PRK06197 306 short chain dehydrogenase; Provisional 94.48
PRK06114254 short chain dehydrogenase; Provisional 94.47
PRK09242257 tropinone reductase; Provisional 94.46
PLN03139386 formate dehydrogenase; Provisional 94.45
PRK06181263 short chain dehydrogenase; Provisional 94.43
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 94.42
PRK12749288 quinate/shikimate dehydrogenase; Reviewed 94.41
PRK06398258 aldose dehydrogenase; Validated 94.39
PRK14103255 trans-aconitate 2-methyltransferase; Provisional 94.36
PF01209233 Ubie_methyltran: ubiE/COQ5 methyltransferase famil 94.35
PF08704247 GCD14: tRNA methyltransferase complex GCD14 subuni 94.35
PRK08993253 2-deoxy-D-gluconate 3-dehydrogenase; Validated 94.35
PRK05884223 short chain dehydrogenase; Provisional 94.34
PRK07832272 short chain dehydrogenase; Provisional 94.33
PRK01683258 trans-aconitate 2-methyltransferase; Provisional 94.33
PRK09186256 flagellin modification protein A; Provisional 94.32
PLN02823336 spermine synthase 94.32
PRK12936245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; 94.31
PRK12747252 short chain dehydrogenase; Provisional 94.31
PRK06914280 short chain dehydrogenase; Provisional 94.3
COG0686371 Ald Alanine dehydrogenase [Amino acid transport an 94.29
PRK06720169 hypothetical protein; Provisional 94.27
PRK12550272 shikimate 5-dehydrogenase; Reviewed 94.27
PRK10538248 malonic semialdehyde reductase; Provisional 94.27
PRK08287187 cobalt-precorrin-6Y C(15)-methyltransferase; Valid 94.26
CHL00194 317 ycf39 Ycf39; Provisional 94.26
PRK12548289 shikimate 5-dehydrogenase; Provisional 94.22
PRK07067257 sorbitol dehydrogenase; Provisional 94.21
KOG0725270 consensus Reductases with broad range of substrate 94.2
PRK06484520 short chain dehydrogenase; Validated 94.18
PRK06523260 short chain dehydrogenase; Provisional 94.17
PRK08085254 gluconate 5-dehydrogenase; Provisional 94.15
TIGR02632676 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc 94.13
PRK11207197 tellurite resistance protein TehB; Provisional 94.11
PRK09134258 short chain dehydrogenase; Provisional 94.11
PRK08263275 short chain dehydrogenase; Provisional 94.11
PRK07985294 oxidoreductase; Provisional 94.08
PRK06124256 gluconate 5-dehydrogenase; Provisional 94.07
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 94.07
PRK06113255 7-alpha-hydroxysteroid dehydrogenase; Validated 94.03
PRK09291257 short chain dehydrogenase; Provisional 94.0
COG0673 342 MviM Predicted dehydrogenases and related proteins 93.99
PRK12367245 short chain dehydrogenase; Provisional 93.99
PRK06997260 enoyl-(acyl carrier protein) reductase; Provisiona 93.98
PRK07577234 short chain dehydrogenase; Provisional 93.98
PRK07791286 short chain dehydrogenase; Provisional 93.97
PLN00203519 glutamyl-tRNA reductase 93.92
PRK09730247 putative NAD(P)-binding oxidoreductase; Provisiona 93.92
PRK04207 341 glyceraldehyde-3-phosphate dehydrogenase; Provisio 93.9
PRK13303265 L-aspartate dehydrogenase; Provisional 93.9
PRK07424406 bifunctional sterol desaturase/short chain dehydro 93.9
TIGR01963255 PHB_DH 3-hydroxybutyrate dehydrogenase. This model 93.9
PRK06077252 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 93.9
PRK07074257 short chain dehydrogenase; Provisional 93.89
PRK00536262 speE spermidine synthase; Provisional 93.88
PLN03013429 cysteine synthase 93.86
TIGR02752231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me 93.86
TIGR00563426 rsmB ribosomal RNA small subunit methyltransferase 93.85
PRK08303305 short chain dehydrogenase; Provisional 93.85
PRK08762376 molybdopterin biosynthesis protein MoeB; Validated 93.84
PRK08936261 glucose-1-dehydrogenase; Provisional 93.82
PRK11579 346 putative oxidoreductase; Provisional 93.8
KOG1014312 consensus 17 beta-hydroxysteroid dehydrogenase typ 93.79
PRK07097265 gluconate 5-dehydrogenase; Provisional 93.72
PRK12825249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 93.71
PRK06484 520 short chain dehydrogenase; Validated 93.7
PRK12937245 short chain dehydrogenase; Provisional 93.66
TIGR00715256 precor6x_red precorrin-6x reductase. This enzyme w 93.66
PRK00121202 trmB tRNA (guanine-N(7)-)-methyltransferase; Revie 93.64
TIGR02371325 ala_DH_arch alanine dehydrogenase, Archaeoglobus f 93.63
PF01564246 Spermine_synth: Spermine/spermidine synthase; Inte 93.63
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 93.63
PRK07574385 formate dehydrogenase; Provisional 93.63
PRK08594257 enoyl-(acyl carrier protein) reductase; Provisiona 93.6
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 93.6
PRK11188209 rrmJ 23S rRNA methyltransferase J; Provisional 93.59
PRK03612521 spermidine synthase; Provisional 93.56
COG4122219 Predicted O-methyltransferase [General function pr 93.55
PRK06823315 ornithine cyclodeaminase; Validated 93.54
PRK14982340 acyl-ACP reductase; Provisional 93.52
PRK05557248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 93.52
COG0169283 AroE Shikimate 5-dehydrogenase [Amino acid transpo 93.51
TIGR01289 314 LPOR light-dependent protochlorophyllide reductase 93.51
PTZ00098263 phosphoethanolamine N-methyltransferase; Provision 93.49
PRK13302271 putative L-aspartate dehydrogenase; Provisional 93.48
PRK12938246 acetyacetyl-CoA reductase; Provisional 93.47
PRK12746254 short chain dehydrogenase; Provisional 93.45
PRK14175286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.44
PRK13255218 thiopurine S-methyltransferase; Reviewed 93.44
PRK07370258 enoyl-(acyl carrier protein) reductase; Validated 93.43
PRK08261 450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 93.42
PRK06947248 glucose-1-dehydrogenase; Provisional 93.42
PRK06101240 short chain dehydrogenase; Provisional 93.41
PRK07411 390 hypothetical protein; Validated 93.37
PRK07666239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 93.35
PRK05599246 hypothetical protein; Provisional 93.3
PRK08291330 ectoine utilization protein EutC; Validated 93.29
PRK05600 370 thiamine biosynthesis protein ThiF; Validated 93.29
PRK05650270 short chain dehydrogenase; Provisional 93.25
PRK09135249 pteridine reductase; Provisional 93.23
PRK13656 398 trans-2-enoyl-CoA reductase; Provisional 93.22
PRK11036255 putative S-adenosyl-L-methionine-dependent methylt 93.2
PRK14903431 16S rRNA methyltransferase B; Provisional 93.19
PLN02244340 tocopherol O-methyltransferase 93.19
PRK07878 392 molybdopterin biosynthesis-like protein MoeZ; Vali 93.19
PRK12935247 acetoacetyl-CoA reductase; Provisional 93.18
COG1712255 Predicted dinucleotide-utilizing enzyme [General f 93.14
PRK07775274 short chain dehydrogenase; Provisional 93.13
PRK06940275 short chain dehydrogenase; Provisional 93.12
TIGR01318 467 gltD_gamma_fam glutamate synthase small subunit fa 93.08
PRK14901434 16S rRNA methyltransferase B; Provisional 93.06
PRK08945247 putative oxoacyl-(acyl carrier protein) reductase; 93.02
PRK12744257 short chain dehydrogenase; Provisional 93.0
cd01492197 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit 92.9
TIGR03589 324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This 92.9
PRK13304265 L-aspartate dehydrogenase; Reviewed 92.88
TIGR01829242 AcAcCoA_reduct acetoacetyl-CoA reductase. (R)-3-hy 92.84
TIGR02622 349 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member 92.83
PRK12809 639 putative oxidoreductase Fe-S binding subunit; Revi 92.81
PRK07889256 enoyl-(acyl carrier protein) reductase; Provisiona 92.8
smart00846149 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, 92.79
PLN00141251 Tic62-NAD(P)-related group II protein; Provisional 92.79
COG3963194 Phospholipid N-methyltransferase [Lipid metabolism 92.78
PRK05855582 short chain dehydrogenase; Validated 92.78
PRK08220252 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated 92.77
PRK06701290 short chain dehydrogenase; Provisional 92.75
PRK11933 470 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; 92.74
COG1052324 LdhA Lactate dehydrogenase and related dehydrogena 92.72
PRK07792 306 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 92.7
PRK06407301 ornithine cyclodeaminase; Provisional 92.67
COG1086 588 Predicted nucleoside-diphosphate sugar epimerases 92.65
PRK06171266 sorbitol-6-phosphate 2-dehydrogenase; Provisional 92.65
PRK08223287 hypothetical protein; Validated 92.63
TIGR01138290 cysM cysteine synthase B. Alternate name: O-acetyl 92.62
PRK05565247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 92.61
PRK13256226 thiopurine S-methyltransferase; Reviewed 92.58
PRK07102243 short chain dehydrogenase; Provisional 92.55
PRK06123248 short chain dehydrogenase; Provisional 92.54
KOG1611249 consensus Predicted short chain-type dehydrogenase 92.53
PRK14902444 16S rRNA methyltransferase B; Provisional 92.49
PRK10901427 16S rRNA methyltransferase B; Provisional 92.43
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 92.41
COG0623259 FabI Enoyl-[acyl-carrier-protein] 92.36
PRK14027283 quinate/shikimate dehydrogenase; Provisional 92.34
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 92.31
KOG0069336 consensus Glyoxylate/hydroxypyruvate reductase (D- 92.29
TIGR02415254 23BDH acetoin reductases. One member of this famil 92.27
PLN02657 390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 92.25
PRK06046326 alanine dehydrogenase; Validated 92.22
PRK12769 654 putative oxidoreductase Fe-S binding subunit; Revi 92.21
TIGR00507270 aroE shikimate 5-dehydrogenase. This model finds p 92.2
PRK08278273 short chain dehydrogenase; Provisional 92.19
KOG1207245 consensus Diacetyl reductase/L-xylulose reductase 92.15
PRK13243333 glyoxylate reductase; Reviewed 92.13
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltra 92.1
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 92.09
cd01484234 E1-2_like Ubiquitin activating enzyme (E1), repeat 92.08
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 92.08
>KOG0024 consensus Sorbitol dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
Probab=100.00  E-value=1.6e-63  Score=422.80  Aligned_cols=346  Identities=53%  Similarity=0.914  Sum_probs=317.2

Q ss_pred             hhcceeEEEecCCceEEEEecCCCC-CCCcEEEEEeeeeeCcccHhhhhccccCCccCCCCcccCccceEEEEEeCCCCC
Q 017868           15 EEVNMAAWLLGVNTLKIQPFELPSL-GPYDVLVRMKAVGICGSDVHYLKTLRCADFVVKEPMVIGHECAGVIEKVGSEVK   93 (365)
Q Consensus        15 ~~~~~~~~~~~~~~l~~~~~~~p~~-~~~eVlI~v~~~~l~~~D~~~~~g~~~~~~~~~~p~~~G~e~~G~V~~vG~~v~   93 (365)
                      ..+|+++++.+++++++.++|.|++ .|+||+|++.++|||.+|++.+...+.+.+..+.|.++|||.+|+|+++|+.|+
T Consensus         2 ~~~~~A~vl~g~~di~i~~~p~p~i~~p~eVlv~i~a~GICGSDvHy~~~G~ig~~v~k~PmvlGHEssGiV~evG~~Vk   81 (354)
T KOG0024|consen    2 AADNLALVLRGKGDIRIEQRPIPTITDPDEVLVAIKAVGICGSDVHYYTHGRIGDFVVKKPMVLGHESSGIVEEVGDEVK   81 (354)
T ss_pred             CcccceeEEEccCceeEeeCCCCCCCCCCEEEEEeeeEEecCccchhhccCCcCccccccccccccccccchhhhccccc
Confidence            4578999999999999999999998 999999999999999999999998887777778999999999999999999999


Q ss_pred             CCCCCCEEEEcCCcCCCCCccccCCCCCCCCCccccccCCCCcceeeEEeecCCceEECCCCCCcchhccchhhHHHHHH
Q 017868           94 TLVPGDRVALEPGISCWRCDHCKGGRYNLCPEMKFFATPPVHGSLANQVVHPADLCFKLPDNVSLEEGAMCEPLSVGLHA  173 (365)
Q Consensus        94 ~~~~Gd~V~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~v~~~~~~~iP~~~~~~~a~~~~~~~~a~~~  173 (365)
                      ++++||||+.-+..+|+.|++|++|++|+|+++.+...++.+|++++|++.++++|+++|+++|++++|++.++++++||
T Consensus        82 ~LkVGDrVaiEpg~~c~~cd~CK~GrYNlCp~m~f~atpp~~G~la~y~~~~~dfc~KLPd~vs~eeGAl~ePLsV~~HA  161 (354)
T KOG0024|consen   82 HLKVGDRVAIEPGLPCRDCDFCKEGRYNLCPHMVFCATPPVDGTLAEYYVHPADFCYKLPDNVSFEEGALIEPLSVGVHA  161 (354)
T ss_pred             ccccCCeEEecCCCccccchhhhCcccccCCccccccCCCcCCceEEEEEechHheeeCCCCCchhhcccccchhhhhhh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHhcCCCCCCEEEEEcCCHHHHHHHHHHHHHCCCCeEEEEeCChhHHHHHHHcCCCEEEeCCCCcccHHHHHHHHHHHhC
Q 017868          174 CRRANIGPETNVLIMGAGPIGLVTMLGAPRAFGAPRIVIVDVDDYRLSVAKEIGADNIVKVSTNLQDIAEEVEKIQKAMG  253 (365)
Q Consensus       174 ~~~~~~~~g~~vlI~G~g~~G~~ai~~l~~~~g~~~vi~v~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~i~~~~~~~~  253 (365)
                      .+++++++|++|||+|+|++|+++.. .|+.+|+..|++++..+.|++++++||++.+....... +..+..+...+..+
T Consensus       162 cr~~~vk~Gs~vLV~GAGPIGl~t~l-~Aka~GA~~VVi~d~~~~Rle~Ak~~Ga~~~~~~~~~~-~~~~~~~~v~~~~g  239 (354)
T KOG0024|consen  162 CRRAGVKKGSKVLVLGAGPIGLLTGL-VAKAMGASDVVITDLVANRLELAKKFGATVTDPSSHKS-SPQELAELVEKALG  239 (354)
T ss_pred             hhhcCcccCCeEEEECCcHHHHHHHH-HHHHcCCCcEEEeecCHHHHHHHHHhCCeEEeeccccc-cHHHHHHHHHhhcc
Confidence            99999999999999999999999999 99999999999999999999999999999877654332 22222222222223


Q ss_pred             -CCceEEEeCCCCHHHHHHHHHhcccCCEEEEEccCCCCccccchHhhhcCcEEEeecccCC-cHHHHHHHHHcCCCCCC
Q 017868          254 -TGIDVSFDCAGLNKTMSTALGATCAGGKVCLVGMGHHEMTVPLTPAAVREVDVVGVFRYKN-TWPLCLELLRSGKIDVK  331 (365)
Q Consensus       254 -~~~d~vid~~g~~~~~~~~~~~l~~~G~~~~~g~~~~~~~~~~~~~~~~~~~i~~~~~~~~-~~~~~~~~l~~g~~~~~  331 (365)
                       ..+|++|||+|....++.++.+++.+|++++.++......++...+..|++++.|++.+.. ++..+++++++|+++++
T Consensus       240 ~~~~d~~~dCsG~~~~~~aai~a~r~gGt~vlvg~g~~~~~fpi~~v~~kE~~~~g~fry~~~~y~~ai~li~sGki~~k  319 (354)
T KOG0024|consen  240 KKQPDVTFDCSGAEVTIRAAIKATRSGGTVVLVGMGAEEIQFPIIDVALKEVDLRGSFRYCNGDYPTAIELVSSGKIDVK  319 (354)
T ss_pred             ccCCCeEEEccCchHHHHHHHHHhccCCEEEEeccCCCccccChhhhhhheeeeeeeeeeccccHHHHHHHHHcCCcCch
Confidence             5599999999999899999999999999999999888889999999999999999999955 99999999999999999


Q ss_pred             CceEEEecCChhhHHHHHHHHhcCC-CceEEEEe
Q 017868          332 PLVTHRFGFSQKEVEEAFETSARGG-TAIKVMFN  364 (365)
Q Consensus       332 ~~~~~~~~~~~~~~~~a~~~~~~~~-~~gk~vi~  364 (365)
                      +++++.|++  +++.+||+.+..++ ...|++++
T Consensus       320 ~lIT~r~~~--~~~~eAf~~~~~~~~~~iKv~i~  351 (354)
T KOG0024|consen  320 PLITHRYKF--DDADEAFETLQHGEEGVIKVIIT  351 (354)
T ss_pred             hheeccccc--chHHHHHHHHHhCcCCceEEEEe
Confidence            999999999  99999999988774 36788875



>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>COG1062 AdhC Zn-dependent alcohol dehydrogenases, class III [Energy production and conversion] Back     alignment and domain information
>cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like Back     alignment and domain information
>PLN02702 L-idonate 5-dehydrogenase Back     alignment and domain information
>KOG0023 consensus Alcohol dehydrogenase, class V [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>cd08281 liver_ADH_like1 Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) Back     alignment and domain information
>PLN02740 Alcohol dehydrogenase-like Back     alignment and domain information
>PLN02827 Alcohol dehydrogenase-like Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>KOG0022 consensus Alcohol dehydrogenase, class III [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase Back     alignment and domain information
>PRK10309 galactitol-1-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02819 fdhA_non_GSH formaldehyde dehydrogenase, glutathione-independent Back     alignment and domain information
>TIGR02818 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase Back     alignment and domain information
>cd08301 alcohol_DH_plants Plant alcohol dehydrogenase Back     alignment and domain information
>COG0604 Qor NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] Back     alignment and domain information
>PLN02586 probable cinnamyl alcohol dehydrogenase Back     alignment and domain information
>cd08300 alcohol_DH_class_III class III alcohol dehydrogenases Back     alignment and domain information
>cd08233 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrogenase Back     alignment and domain information
>TIGR03201 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase Back     alignment and domain information
>cd08230 glucose_DH Glucose dehydrogenase Back     alignment and domain information
>cd08277 liver_alcohol_DH_like Liver alcohol dehydrogenase Back     alignment and domain information
>PLN02178 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>TIGR02822 adh_fam_2 zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>cd08237 ribitol-5-phosphate_DH ribitol-5-phosphate dehydrogenase Back     alignment and domain information
>KOG1197 consensus Predicted quinone oxidoreductase [Energy production and conversion; General function prediction only] Back     alignment and domain information
>PLN02514 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PRK10083 putative oxidoreductase; Provisional Back     alignment and domain information
>cd08231 MDR_TM0436_like Hypothetical enzyme TM0436 resembles the zinc-dependent alcohol dehydrogenases (ADH) Back     alignment and domain information
>TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase Back     alignment and domain information
>cd08238 sorbose_phosphate_red L-sorbose-1-phosphate reductase Back     alignment and domain information
>cd08285 NADP_ADH NADP(H)-dependent alcohol dehydrogenases Back     alignment and domain information
>cd08256 Zn_ADH2 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd05285 sorbitol_DH Sorbitol dehydrogenase Back     alignment and domain information
>cd08299 alcohol_DH_class_I_II_IV class I, II, IV alcohol dehydrogenases Back     alignment and domain information
>cd08296 CAD_like Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>cd08283 FDH_like_1 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 1 Back     alignment and domain information
>cd05284 arabinose_DH_like D-arabinose dehydrogenase Back     alignment and domain information
>PRK05396 tdh L-threonine 3-dehydrogenase; Validated Back     alignment and domain information
>cd05279 Zn_ADH1 Liver alcohol dehydrogenase and related zinc-dependent alcohol dehydrogenases Back     alignment and domain information
>cd08246 crotonyl_coA_red crotonyl-CoA reductase Back     alignment and domain information
>cd08232 idonate-5-DH L-idonate 5-dehydrogenase Back     alignment and domain information
>cd08284 FDH_like_2 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 2 Back     alignment and domain information
>cd05278 FDH_like Formaldehyde dehydrogenases Back     alignment and domain information
>cd08286 FDH_like_ADH2 formaldehyde dehydrogenase (FDH)-like Back     alignment and domain information
>cd08278 benzyl_alcohol_DH Benzyl alcohol dehydrogenase Back     alignment and domain information
>cd08242 MDR_like Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08262 Zn_ADH8 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08265 Zn_ADH3 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08235 iditol_2_DH_like L-iditol 2-dehydrogenase Back     alignment and domain information
>cd08240 6_hydroxyhexanoate_dh_like 6-hydroxyhexanoate dehydrogenase Back     alignment and domain information
>cd08279 Zn_ADH_class_III Class III alcohol dehydrogenase Back     alignment and domain information
>cd08261 Zn_ADH7 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08287 FDH_like_ADH3 formaldehyde dehydrogenase (FDH)-like Back     alignment and domain information
>cd08263 Zn_ADH10 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>TIGR01751 crot-CoA-red crotonyl-CoA reductase Back     alignment and domain information
>cd08260 Zn_ADH6 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08282 PFDH_like Pseudomonas putida aldehyde-dismutating formaldehyde dehydrogenase (PFDH) Back     alignment and domain information
>cd08236 sugar_DH NAD(P)-dependent sugar dehydrogenases Back     alignment and domain information
>cd05283 CAD1 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>cd05281 TDH Threonine dehydrogenase Back     alignment and domain information
>cd08291 ETR_like_1 2-enoyl thioester reductase (ETR) like proteins, child 1 Back     alignment and domain information
>cd08234 threonine_DH_like L-threonine dehydrogenase Back     alignment and domain information
>TIGR00692 tdh L-threonine 3-dehydrogenase Back     alignment and domain information
>PRK09422 ethanol-active dehydrogenase/acetaldehyde-active reductase; Provisional Back     alignment and domain information
>cd08297 CAD3 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>PRK13771 putative alcohol dehydrogenase; Provisional Back     alignment and domain information
>cd08254 hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase, N-benzyl-3-pyrrolidinol dehydrogenase, and other MDR family members Back     alignment and domain information
>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase Back     alignment and domain information
>PLN03154 putative allyl alcohol dehydrogenase; Provisional Back     alignment and domain information
>cd08259 Zn_ADH5 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08298 CAD2 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>KOG0025 consensus Zn2+-binding dehydrogenase (nuclear receptor binding factor-1) [Transcription; Energy production and conversion] Back     alignment and domain information
>cd08266 Zn_ADH_like1 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08293 PTGR2 Prostaglandin reductase Back     alignment and domain information
>cd08292 ETR_like_2 2-enoyl thioester reductase (ETR) like proteins, child 2 Back     alignment and domain information
>cd08295 double_bond_reductase_like Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase Back     alignment and domain information
>TIGR02825 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase Back     alignment and domain information
>cd08294 leukotriene_B4_DH_like 13-PGR is a bifunctional enzyme with delta-13 15-prostaglandin reductase and leukotriene B4 12 hydroxydehydrogenase activity Back     alignment and domain information
>cd08264 Zn_ADH_like2 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08274 MDR9 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08245 CAD Cinnamyl alcohol dehydrogenases (CAD) and related proteins Back     alignment and domain information
>cd08258 Zn_ADH4 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08244 MDR_enoyl_red Possible enoyl reductase Back     alignment and domain information
>cd08269 Zn_ADH9 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>TIGR02817 adh_fam_1 zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>cd08290 ETR 2-enoyl thioester reductase (ETR) Back     alignment and domain information
>PTZ00354 alcohol dehydrogenase; Provisional Back     alignment and domain information
>cd08276 MDR7 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08270 MDR4 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>PRK10754 quinone oxidoreductase, NADPH-dependent; Provisional Back     alignment and domain information
>KOG1198 consensus Zinc-binding oxidoreductase [Energy production and conversion; General function prediction only] Back     alignment and domain information
>COG2130 Putative NADP-dependent oxidoreductases [General function prediction only] Back     alignment and domain information
>cd08250 Mgc45594_like Mgc45594 gene product and other MDR family members Back     alignment and domain information
>cd08249 enoyl_reductase_like enoyl_reductase_like Back     alignment and domain information
>cd05282 ETR_like 2-enoyl thioester reductase-like Back     alignment and domain information
>cd05280 MDR_yhdh_yhfp Yhdh and yhfp-like putative quinone oxidoreductases Back     alignment and domain information
>cd08289 MDR_yhfp_like Yhfp putative quinone oxidoreductases Back     alignment and domain information
>TIGR02823 oxido_YhdH putative quinone oxidoreductase, YhdH/YhfP family Back     alignment and domain information
>cd08243 quinone_oxidoreductase_like_1 Quinone oxidoreductase (QOR) Back     alignment and domain information
>cd08253 zeta_crystallin Zeta-crystallin with NADP-dependent quinone reductase activity (QOR) Back     alignment and domain information
>cd08252 AL_MDR Arginate lyase and other MDR family members Back     alignment and domain information
>cd08248 RTN4I1 Human Reticulon 4 Interacting Protein 1 Back     alignment and domain information
>cd05276 p53_inducible_oxidoreductase PIG3 p53-inducible quinone oxidoreductase Back     alignment and domain information
>cd08272 MDR6 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08288 MDR_yhdh Yhdh putative quinone oxidoreductases Back     alignment and domain information
>cd08247 AST1_like AST1 is a cytoplasmic protein associated with the periplasmic membrane in yeast Back     alignment and domain information
>cd05288 PGDH Prostaglandin dehydrogenases Back     alignment and domain information
>cd08271 MDR5 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd05188 MDR Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd05286 QOR2 Quinone oxidoreductase (QOR) Back     alignment and domain information
>cd08273 MDR8 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08251 polyketide_synthase polyketide synthase Back     alignment and domain information
>TIGR02824 quinone_pig3 putative NAD(P)H quinone oxidoreductase, PIG3 family Back     alignment and domain information
>cd08268 MDR2 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08241 QOR1 Quinone oxidoreductase (QOR) Back     alignment and domain information
>cd05289 MDR_like_2 alcohol dehydrogenase and quinone reductase-like medium chain degydrogenases/reductases Back     alignment and domain information
>cd08267 MDR1 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08275 MDR3 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd05195 enoyl_red enoyl reductase of polyketide synthase Back     alignment and domain information
>cd08255 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_like 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide and other MDR family members Back     alignment and domain information
>smart00829 PKS_ER Enoylreductase Back     alignment and domain information
>KOG1202 consensus Animal-type fatty acid synthase and related proteins [Lipid transport and metabolism] Back     alignment and domain information
>KOG1196 consensus Predicted NAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>PF08240 ADH_N: Alcohol dehydrogenase GroES-like domain; InterPro: IPR013154 This is the catalytic domain of alcohol dehydrogenases (1 Back     alignment and domain information
>PF00107 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: IPR013149 Alcohol dehydrogenase (1 Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>PF13602 ADH_zinc_N_2: Zinc-binding dehydrogenase; PDB: 3TQH_A 2VN8_A 3GOH_A 4A27_A Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>PF11017 DUF2855: Protein of unknown function (DUF2855); InterPro: IPR021276 This family of proteins has no known function Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>PLN02494 adenosylhomocysteinase Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>PRK08324 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>PTZ00075 Adenosylhomocysteinase; Provisional Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase Back     alignment and domain information
>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2 Back     alignment and domain information
>PRK12742 oxidoreductase; Provisional Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>COG3967 DltE Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK14967 putative methyltransferase; Provisional Back     alignment and domain information
>KOG1209 consensus 1-Acyl dihydroxyacetone phosphate reductase and related dehydrogenases [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>PRK08017 oxidoreductase; Provisional Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences Back     alignment and domain information
>PRK05693 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR00438 rrmJ cell division protein FtsJ Back     alignment and domain information
>PRK08618 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase Back     alignment and domain information
>KOG1205 consensus Predicted dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08177 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1201 consensus Hydroxysteroid 17-beta dehydrogenase 11 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK07340 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07502 cyclohexadienyl dehydrogenase; Validated Back     alignment and domain information
>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08862 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>PRK07904 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed Back     alignment and domain information
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05872 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07677 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06841 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06483 dihydromonapterin reductase; Provisional Back     alignment and domain information
>cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E Back     alignment and domain information
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08339 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>PRK06500 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>COG1179 Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 1 [Coenzyme metabolism] Back     alignment and domain information
>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>PRK08628 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06180 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08589 short chain dehydrogenase; Validated Back     alignment and domain information
>COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK08415 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate Back     alignment and domain information
>PRK09072 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK01581 speE spermidine synthase; Validated Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06603 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>PRK06198 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 Back     alignment and domain information
>PRK07453 protochlorophyllide oxidoreductase; Validated Back     alignment and domain information
>PRK08267 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>PRK08690 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>PRK08703 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family Back     alignment and domain information
>PRK08643 acetoin reductase; Validated Back     alignment and domain information
>COG0031 CysK Cysteine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08340 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK08159 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>COG3288 PntA NAD/NADP transhydrogenase alpha subunit [Energy production and conversion] Back     alignment and domain information
>PLN02780 ketoreductase/ oxidoreductase Back     alignment and domain information
>PRK07024 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>TIGR03215 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylating) Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>PRK08300 acetaldehyde dehydrogenase; Validated Back     alignment and domain information
>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] Back     alignment and domain information
>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>PRK06128 oxidoreductase; Provisional Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>PRK06179 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>PLN02366 spermidine synthase Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07984 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK07035 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>PRK08226 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>PRK06953 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1200 consensus Mitochondrial/plastidial beta-ketoacyl-ACP reductase [Lipid transport and metabolism] Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08264 short chain dehydrogenase; Validated Back     alignment and domain information
>PLN02253 xanthoxin dehydrogenase Back     alignment and domain information
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK04266 fibrillarin; Provisional Back     alignment and domain information
>PLN03075 nicotianamine synthase; Provisional Back     alignment and domain information
>TIGR00417 speE spermidine synthase Back     alignment and domain information
>PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08277 D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>TIGR00138 gidB 16S rRNA methyltransferase GidB Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG1252 consensus Cystathionine beta-synthase and related enzymes [Amino acid transport and metabolism] Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>PRK04457 spermidine synthase; Provisional Back     alignment and domain information
>PRK12743 oxidoreductase; Provisional Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06482 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05562 precorrin-2 dehydrogenase; Provisional Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK06141 ornithine cyclodeaminase; Validated Back     alignment and domain information
>TIGR02992 ectoine_eutC ectoine utilization protein EutC Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>PRK06125 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>PRK08328 hypothetical protein; Provisional Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK07856 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02233 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PF13823 ADH_N_assoc: Alcohol dehydrogenase GroES-associated; PDB: 2DPH_B Back     alignment and domain information
>PRK08251 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06114 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>PLN03139 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK06181 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK12749 quinate/shikimate dehydrogenase; Reviewed Back     alignment and domain information
>PRK06398 aldose dehydrogenase; Validated Back     alignment and domain information
>PRK14103 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] Back     alignment and domain information
>PF08704 GCD14: tRNA methyltransferase complex GCD14 subunit; InterPro: IPR014816 GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA [] Back     alignment and domain information
>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated Back     alignment and domain information
>PRK05884 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07832 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>PLN02823 spermine synthase Back     alignment and domain information
>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>PRK12747 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06720 hypothetical protein; Provisional Back     alignment and domain information
>PRK12550 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK10538 malonic semialdehyde reductase; Provisional Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>KOG0725 consensus Reductases with broad range of substrate specificities [General function prediction only] Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06523 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08085 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PRK09134 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08263 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07985 oxidoreductase; Provisional Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>PRK09291 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0673 MviM Predicted dehydrogenases and related proteins [General function prediction only] Back     alignment and domain information
>PRK12367 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06997 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07577 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07791 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN00203 glutamyl-tRNA reductase Back     alignment and domain information
>PRK09730 putative NAD(P)-binding oxidoreductase; Provisional Back     alignment and domain information
>PRK04207 glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK13303 L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated Back     alignment and domain information
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07074 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK00536 speE spermidine synthase; Provisional Back     alignment and domain information
>PLN03013 cysteine synthase Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase Back     alignment and domain information
>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB Back     alignment and domain information
>PRK08303 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK08936 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK11579 putative oxidoreductase; Provisional Back     alignment and domain information
>KOG1014 consensus 17 beta-hydroxysteroid dehydrogenase type 3, HSD17B3 [Lipid transport and metabolism] Back     alignment and domain information
>PRK07097 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK12937 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR00715 precor6x_red precorrin-6x reductase Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>TIGR02371 ala_DH_arch alanine dehydrogenase, Archaeoglobus fulgidus type Back     alignment and domain information
>PF01564 Spermine_synth: Spermine/spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (2 Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>COG4122 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>PRK06823 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK14982 acyl-ACP reductase; Provisional Back     alignment and domain information
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01289 LPOR light-dependent protochlorophyllide reductase Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>PRK13302 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK12938 acetyacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK12746 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK13255 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>PRK07370 enoyl-(acyl carrier protein) reductase; Validated Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06947 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK06101 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07411 hypothetical protein; Validated Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05599 hypothetical protein; Provisional Back     alignment and domain information
>PRK08291 ectoine utilization protein EutC; Validated Back     alignment and domain information
>PRK05600 thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>PRK05650 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09135 pteridine reductase; Provisional Back     alignment and domain information
>PRK13656 trans-2-enoyl-CoA reductase; Provisional Back     alignment and domain information
>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK14903 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PLN02244 tocopherol O-methyltransferase Back     alignment and domain information
>PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated Back     alignment and domain information
>PRK12935 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>COG1712 Predicted dinucleotide-utilizing enzyme [General function prediction only] Back     alignment and domain information
>PRK07775 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06940 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>PRK14901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12744 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>PRK13304 L-aspartate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01829 AcAcCoA_reduct acetoacetyl-CoA reductase Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK07889 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>smart00846 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>COG3963 Phospholipid N-methyltransferase [Lipid metabolism] Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated Back     alignment and domain information
>PRK06701 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed Back     alignment and domain information
>COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06407 ornithine cyclodeaminase; Provisional Back     alignment and domain information
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional Back     alignment and domain information
>PRK08223 hypothetical protein; Validated Back     alignment and domain information
>TIGR01138 cysM cysteine synthase B Back     alignment and domain information
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK13256 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>PRK07102 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06123 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1611 consensus Predicted short chain-type dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK14902 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>COG0623 FabI Enoyl-[acyl-carrier-protein] Back     alignment and domain information
>PRK14027 quinate/shikimate dehydrogenase; Provisional Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>KOG0069 consensus Glyoxylate/hydroxypyruvate reductase (D-isomer-specific 2-hydroxy acid dehydrogenase superfamily) [Energy production and conversion] Back     alignment and domain information
>TIGR02415 23BDH acetoin reductases Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>PRK06046 alanine dehydrogenase; Validated Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>PRK08278 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1207 consensus Diacetyl reductase/L-xylulose reductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>cd01484 E1-2_like Ubiquitin activating enzyme (E1), repeat 2-like Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query365
3qe3_A355 Sheep Liver Sorbitol Dehydrogenase Length = 355 2e-88
1e3j_A352 Ketose Reductase (Sorbitol Dehydrogenase) From Silv 4e-88
1pl7_A356 Human Sorbitol Dehydrogenase (Apo) Length = 356 6e-88
1pl6_A356 Human SdhNADHINHIBITOR COMPLEX Length = 356 2e-85
3m6i_A363 L-Arabinitol 4-Dehydrogenase Length = 363 7e-60
2dfv_A347 Hyperthermophilic Threonine Dehydrogenase From Pyro 3e-40
2d8a_A348 Crystal Structure Of Ph0655 From Pyrococcus Horikos 3e-40
3gfb_A350 L-Threonine Dehydrogenase (Tktdh) From The Hyperthe 4e-39
4ej6_A370 Crystal Structure Of A Putative Zinc-Binding Dehydr 4e-37
2dq4_A343 Crystal Structure Of Threonine 3-Dehydrogenase Leng 6e-37
4a2c_A346 Crystal Structure Of Galactitol-1-Phosphate Dehydro 4e-31
4ilk_A359 Crystal Structure Of Short Chain Alcohol Dehydrogen 1e-29
1rjw_A339 Crystal Structure Of Nad(+)-Dependent Alcohol Dehyd 2e-27
3pii_A339 Crystal Structure Of Mutant Of Ht- Alcohol Dehydrog 3e-27
2eih_A343 Crystal Structure Of Nad-Dependent Alcohol Dehydrog 4e-25
2eer_A347 Structural Study Of Project Id St2577 From Sulfolob 8e-25
4eez_A348 Crystal Structure Of Lactococcus Lactis Alcohol Deh 6e-24
4eex_A348 Crystal Structure Of Lactococcus Lactis Alcohol Deh 1e-23
1e3l_A376 P47h Mutant Of Mouse Class Ii Alcohol Dehydrogenase 4e-23
1e3e_A376 Mouse Class Ii Alcohol Dehydrogenase Complex With N 4e-23
1ee2_B373 The Structure Of Steroid-Active Alcohol Dehydrogena 1e-22
1ee2_A373 The Structure Of Steroid-Active Alcohol Dehydrogena 1e-22
1mgo_A374 Horse Liver Alcohol Dehydrogenase Phe93ala Mutant L 1e-22
1hdz_A374 Three-Dimensional Structures Of Three Human Alcohol 2e-22
6adh_A374 Structure Of Triclinic Ternary Complex Of Horse Liv 3e-22
1axe_A374 Crystal Structure Of The Active-Site Mutant Phe93-> 3e-22
3oq6_A374 Horse Liver Alcohol Dehydrogenase A317c Mutant Comp 4e-22
2xaa_A345 Alcohol Dehydrogenase Adh-'a' From Rhodococcus Rube 6e-22
1qv6_A374 Horse Liver Alcohol Dehydrogenase His51glnLYS228ARG 7e-22
1n8k_A374 Horse Liver Alcohol Dehydrogenase Val292thr Mutant 8e-22
3fpl_A351 Chimera Of Alcohol Dehydrogenase By Exchange Of The 8e-22
1axg_A374 Crystal Structure Of The Val203->ala Mutant Of Live 8e-22
2nvb_A352 Contribution Of Pro275 To The Thermostability Of Th 9e-22
1qlh_A374 Horse Liver Alcohol Dehydrogenase Complexed To Nad 9e-22
1a71_A374 Ternary Complex Of An Active Site Double Mutant Of 9e-22
1ykf_A352 Nadp-Dependent Alcohol Dehydrogenase From Thermoana 9e-22
1htb_A374 Crystallization Of Human Beta3 Alcohol Dehydrogenas 1e-21
1ju9_A374 Horse Liver Alcohol Dehydrogenase Val292ser Mutant 1e-21
1hdy_A374 Three-Dimensional Structures Of Three Human Alcohol 1e-21
1hdx_A374 Three-Dimensional Structures Of Three Human Alcohol 2e-21
1hso_A374 Human Alpha Alcohol Dehydrogenase (Adh1a) Length = 2e-21
1ht0_A374 Human Gamma-2 Alcohol Dehydrogense Length = 374 2e-21
3meq_A365 Crystal Structure Of Alcohol Dehydrogenase From Bru 5e-21
3fpc_A352 Chimera Of Alcohol Dehydrogenase By Exchange Of The 6e-21
1r37_A347 Alcohol Dehydrogenase From Sulfolobus Solfataricus 1e-20
1llu_A342 The Ternary Complex Of Pseudomonas Aeruginosa Alcoh 1e-20
1nto_A347 N249y Mutant Of Alcohol Dehydrogenase From The Arch 2e-20
3i4c_A347 Crystal Structure Of Sulfolobus Solfataricus Adh(Ss 4e-20
3cos_A381 Crystal Structure Of Human Class Ii Alcohol Dehydro 4e-20
1ped_A351 Bacterial Secondary Alcohol Dehydrogenase (Apo-Form 7e-20
3fsr_A352 Chimera Of Alcohol Dehydrogenase By Exchange Of The 9e-20
2b83_A351 A Single Amino Acid Substitution In The Clostridium 9e-20
1y9a_A360 Alcohol Dehydrogenase From Entamoeba Histolotica In 1e-19
3ftn_A352 Q165eS254K DOUBLE MUTANT CHIMERA OF ALCOHOL DEHYDRO 1e-19
2oui_A360 D275p Mutant Of Alcohol Dehydrogenase From Protozoa 2e-19
1jqb_A351 Alcohol Dehydrogenase From Clostridium Beijerinckii 3e-19
1jvb_A347 Alcohol Dehydrogenase From The Archaeon Sulfolobus 3e-19
1h2b_A359 Crystal Structure Of The Alcohol Dehydrogenase From 4e-19
3s1l_A340 Crystal Structure Of Apo-Form Furx Length = 340 1e-18
1vj0_A380 Crystal Structure Of Alcohol Dehydrogenase (Tm0436) 3e-18
3ip1_A404 Structure Of Putative Alcohol Dehydrogenase (Tm_042 7e-17
1f8f_A371 Crystal Structure Of Benzyl Alcohol Dehydrogenase F 9e-17
3uko_A378 Crystal Structure Of S-Nitrosoglutathione Reductase 1e-16
1mc5_A374 Ternary Complex Of Human Glutathione-Dependent Form 1e-16
1teh_A373 Structure Of Human Liver Chichi Alcohol Dehydrogena 1e-16
3qj5_A374 S-Nitrosoglutathione Reductase (Gsnor) In Complex W 2e-16
1p0c_A373 Crystal Structure Of The Nadp(H)-Dependent Vertebra 2e-16
1cdo_A374 Alcohol Dehydrogenase (E.C.1.1.1.1) (Ee Isozyme) Co 4e-16
1agn_A373 X-Ray Structure Of Human Sigma Alcohol Dehydrogenas 9e-16
1d1t_A373 Mutant Of Human Sigma Alcohol Dehydrogenase With Le 9e-16
4dl9_A396 Crystal Structure Of S-nitrosoglutathione Reductase 1e-15
2fzw_A373 Structure Of The Binary Complex Of The E67l Mutant 1e-15
1yqd_A366 Sinapyl Alcohol Dehydrogenase Complexed With Nadp+ 2e-13
2dph_A398 Crystal Structure Of Formaldehyde Dismutase Length 8e-13
2h6e_A344 Crystal Structure Of The D-Arabinose Dehydrogenase 2e-11
1kol_A398 Crystal Structure Of Formaldehyde Dehydrogenase Len 1e-10
1wly_A333 Crystal Structure Of 2-haloacrylate Reductase Lengt 4e-09
3uog_A363 Crystal Structure Of Putative Alcohol Dehydrogenase 4e-09
3two_A348 The Crystal Structure Of Cad From Helicobacter Pylo 5e-09
3jyl_A325 Crystal Structures Of Pseudomonas Syringae Pv. Toma 3e-08
2hcy_A347 Yeast Alcohol Dehydrogenase I, Saccharomyces Cerevi 1e-07
3goh_A315 Crystal Structure Of Alcohol Dehydrogenase Superfam 2e-07
3qwa_A334 Crystal Structure Of Saccharomyces Cerevisiae Zeta- 2e-07
1uuf_A369 Crystal Structure Of A Zinc-Type Alcohol Dehydrogen 6e-07
1ps0_A360 Crystal Structure Of The Nadp(H)-Dependent Cinnamyl 1e-06
4a27_A349 Crystal Structure Of Human Synaptic Vesicle Membran 4e-06
3fbg_A346 Crystal Structure Of A Putative Arginate Lyase From 8e-06
3krt_A456 Crystal Structure Of Putative Crotonyl Coa Reductas 3e-04
1yb5_A351 Crystal Structure Of Human Zeta-crystallin With Bou 4e-04
2b5w_A357 Crystal Structure Of D38c Glucose Dehydrogenase Mut 4e-04
>pdb|3QE3|A Chain A, Sheep Liver Sorbitol Dehydrogenase Length = 355 Back     alignment and structure

Iteration: 1

Score = 322 bits (826), Expect = 2e-88, Method: Compositional matrix adjust. Identities = 169/347 (48%), Positives = 238/347 (68%), Gaps = 8/347 (2%) Query: 18 NMAAWLLGVNTLKIQPFELPSLGPYDVLVRMKAVGICGSDVHYLKTLRCADFVVKEPMVI 77 N++ + G L+++ + +P GP +VL++M +VGICGSDVHY + R DFVVK+PMV+ Sbjct: 7 NLSLVVHGPGDLRLENYPIPEPGPNEVLLKMHSVGICGSDVHYWQHGRIGDFVVKKPMVL 66 Query: 78 GHECAGVIEKVGSEVKTLVPGDRVALEPGISCWRCDHCKGGRYNLCPEMKFFATPPVHGS 137 GHE +G + KVGS V+ L PGDRVA++PG + CK GRYNL P + F ATPP G+ Sbjct: 67 GHEASGTVVKVGSLVRHLQPGDRVAIQPGAPRQTDEFCKIGRYNLSPTIFFCATPPDDGN 126 Query: 138 LANQVVHPADLCFKLPDNVSLEEGAMCEPLSVGLHACRRANIGPETNVLIMGAGPIGLVT 197 L H A+ C+KLPDNV+ EEGA+ EPLSVG+HACRRA + VL+ GAGPIGLV Sbjct: 127 LCRFYKHNANFCYKLPDNVTFEEGALIEPLSVGIHACRRAGVTLGNKVLVCGAGPIGLVN 186 Query: 198 MLGAPRAFGAPRIVIVDVDDYRLSVAKEIGADNIVKVST-NLQDIAEEVEKIQKAMGTGI 256 +L A +A GA ++V+ D+ RLS AKE+GAD I+++S + ++IA++VE + +G+ Sbjct: 187 LLAA-KAMGAAQVVVTDLSASRLSKAKEVGADFILEISNESPEEIAKKVEGL---LGSKP 242 Query: 257 DVSFDCAGLNKTMSTALGATCAGGKVCLVGMGHHEMTVPLTPAAVREVDVVGVFRYKNTW 316 +V+ +C G+ ++ + AT +GG + LVG+G +VPL AA REVD+ GVFRY NTW Sbjct: 243 EVTIECTGVETSIQAGIYATHSGGTLVLVGLGSEMTSVPLVHAATREVDIKGVFRYCNTW 302 Query: 317 PLCLELLRSGKIDVKPLVTHRFGFSQKEVEEAFETSARGGTAIKVMF 363 P+ + +L S ++VKPLVTHRF ++ EAFETS + G +KVM Sbjct: 303 PMAISMLASKSVNVKPLVTHRFPL--EKALEAFETSKK-GLGLKVMI 346
>pdb|1E3J|A Chain A, Ketose Reductase (Sorbitol Dehydrogenase) From Silverleaf Whitefly Length = 352 Back     alignment and structure
>pdb|1PL7|A Chain A, Human Sorbitol Dehydrogenase (Apo) Length = 356 Back     alignment and structure
>pdb|1PL6|A Chain A, Human SdhNADHINHIBITOR COMPLEX Length = 356 Back     alignment and structure
>pdb|3M6I|A Chain A, L-Arabinitol 4-Dehydrogenase Length = 363 Back     alignment and structure
>pdb|2DFV|A Chain A, Hyperthermophilic Threonine Dehydrogenase From Pyrococcus Horikoshii Length = 347 Back     alignment and structure
>pdb|2D8A|A Chain A, Crystal Structure Of Ph0655 From Pyrococcus Horikoshii Ot3 Length = 348 Back     alignment and structure
>pdb|3GFB|A Chain A, L-Threonine Dehydrogenase (Tktdh) From The Hyperthermophilic Archaeon Thermococcus Kodakaraensis Length = 350 Back     alignment and structure
>pdb|4EJ6|A Chain A, Crystal Structure Of A Putative Zinc-Binding Dehydrogenase (Target Psi-012003) From Sinorhizobium Meliloti 1021 Length = 370 Back     alignment and structure
>pdb|2DQ4|A Chain A, Crystal Structure Of Threonine 3-Dehydrogenase Length = 343 Back     alignment and structure
>pdb|4A2C|A Chain A, Crystal Structure Of Galactitol-1-Phosphate Dehydrogenase From Escherichia Coli Length = 346 Back     alignment and structure
>pdb|4ILK|A Chain A, Crystal Structure Of Short Chain Alcohol Dehydrogenase (rspb) From E. Coli Cft073 (efi Target Efi-506413) Complexed With Cofactor Nadh Length = 359 Back     alignment and structure
>pdb|1RJW|A Chain A, Crystal Structure Of Nad(+)-Dependent Alcohol Dehydrogenase From Bacillus Stearothermophilus Strain Lld-R Length = 339 Back     alignment and structure
>pdb|3PII|A Chain A, Crystal Structure Of Mutant Of Ht- Alcohol Dehydrogenase With Substrate Analogue Butyramide Length = 339 Back     alignment and structure
>pdb|2EIH|A Chain A, Crystal Structure Of Nad-Dependent Alcohol Dehydrogenase Length = 343 Back     alignment and structure
>pdb|2EER|A Chain A, Structural Study Of Project Id St2577 From Sulfolobus Tokodaii Strain7 Length = 347 Back     alignment and structure
>pdb|4EEZ|A Chain A, Crystal Structure Of Lactococcus Lactis Alcohol Dehydrogenase Variant Re1 Length = 348 Back     alignment and structure
>pdb|4EEX|A Chain A, Crystal Structure Of Lactococcus Lactis Alcohol Dehydrogenase Length = 348 Back     alignment and structure
>pdb|1E3L|A Chain A, P47h Mutant Of Mouse Class Ii Alcohol Dehydrogenase Complex With Nadh Length = 376 Back     alignment and structure
>pdb|1E3E|A Chain A, Mouse Class Ii Alcohol Dehydrogenase Complex With Nadh Length = 376 Back     alignment and structure
>pdb|1EE2|B Chain B, The Structure Of Steroid-Active Alcohol Dehydrogenase At 1.54 A Resolution Length = 373 Back     alignment and structure
>pdb|1EE2|A Chain A, The Structure Of Steroid-Active Alcohol Dehydrogenase At 1.54 A Resolution Length = 373 Back     alignment and structure
>pdb|1MGO|A Chain A, Horse Liver Alcohol Dehydrogenase Phe93ala Mutant Length = 374 Back     alignment and structure
>pdb|1HDZ|A Chain A, Three-Dimensional Structures Of Three Human Alcohol Dehydrogenase Variants: Correlations With Their Functional Differences Length = 374 Back     alignment and structure
>pdb|6ADH|A Chain A, Structure Of Triclinic Ternary Complex Of Horse Liver Alcohol Dehydrogenase At 2.9 Angstroms Resolution Length = 374 Back     alignment and structure
>pdb|1AXE|A Chain A, Crystal Structure Of The Active-Site Mutant Phe93->trp Of Horse Liver Alcohol Dehydrogenase In Complex With Nad And Inhibitor Trifluoroethanol Length = 374 Back     alignment and structure
>pdb|3OQ6|A Chain A, Horse Liver Alcohol Dehydrogenase A317c Mutant Complexed With Nad+ And 2,3,4,5,6-Pentafluorobenzyl Alcohol Length = 374 Back     alignment and structure
>pdb|2XAA|A Chain A, Alcohol Dehydrogenase Adh-'a' From Rhodococcus Ruber Dsm 44541 At Ph 8.5 In Complex With Nad And Butane-1,4-Diol Length = 345 Back     alignment and structure
>pdb|1QV6|A Chain A, Horse Liver Alcohol Dehydrogenase His51glnLYS228ARG MUTANT Complexed With Nad+ And 2,4-Difluorobenzyl Alcohol Length = 374 Back     alignment and structure
>pdb|1N8K|A Chain A, Horse Liver Alcohol Dehydrogenase Val292thr Mutant Complexed To Nad+ And Pyrazole Length = 374 Back     alignment and structure
>pdb|3FPL|A Chain A, Chimera Of Alcohol Dehydrogenase By Exchange Of The Cofactor Binding Domain Res 153-295 Of C. Beijerinckii Adh By T. Brockii Adh Length = 351 Back     alignment and structure
>pdb|1AXG|A Chain A, Crystal Structure Of The Val203->ala Mutant Of Liver Alcohol Dehydrogenase Complexed With Cofactor Nad And Inhibitor Trifluoroethanol Solved To 2.5 Angstrom Resolution Length = 374 Back     alignment and structure
>pdb|2NVB|A Chain A, Contribution Of Pro275 To The Thermostability Of The Alcohol Dehydrogenases (Adhs) Length = 352 Back     alignment and structure
>pdb|1QLH|A Chain A, Horse Liver Alcohol Dehydrogenase Complexed To Nad Double Mutant Of Gly 293 Ala And Pro 295 Thr Length = 374 Back     alignment and structure
>pdb|1A71|A Chain A, Ternary Complex Of An Active Site Double Mutant Of Horse Liver Alcohol Dehydrogenase, Phe93>trp, Val203>ala With Nad And Trifluoroethanol Length = 374 Back     alignment and structure
>pdb|1YKF|A Chain A, Nadp-Dependent Alcohol Dehydrogenase From Thermoanaerobium Brockii Length = 352 Back     alignment and structure
>pdb|1HTB|A Chain A, Crystallization Of Human Beta3 Alcohol Dehydrogenase (10 MgML) IN 100 MM SODIUM PHOSPHATE (PH 7.5), 7.5 MM NAD+ And 1 Mm 4-Iodopyrazole At 25 C Length = 374 Back     alignment and structure
>pdb|1JU9|A Chain A, Horse Liver Alcohol Dehydrogenase Val292ser Mutant Length = 374 Back     alignment and structure
>pdb|1HDY|A Chain A, Three-Dimensional Structures Of Three Human Alcohol Dehydrogenase Variants: Correlations With Their Functional Differences Length = 374 Back     alignment and structure
>pdb|1HDX|A Chain A, Three-Dimensional Structures Of Three Human Alcohol Dehydrogenase Variants: Correlations With Their Functional Differences Length = 374 Back     alignment and structure
>pdb|1HSO|A Chain A, Human Alpha Alcohol Dehydrogenase (Adh1a) Length = 374 Back     alignment and structure
>pdb|1HT0|A Chain A, Human Gamma-2 Alcohol Dehydrogense Length = 374 Back     alignment and structure
>pdb|3MEQ|A Chain A, Crystal Structure Of Alcohol Dehydrogenase From Brucella Mel Length = 365 Back     alignment and structure
>pdb|3FPC|A Chain A, Chimera Of Alcohol Dehydrogenase By Exchange Of The Cofactor Binding Domain Res 153-294 Of T. Brockii Adh By E. Histolytica Adh Length = 352 Back     alignment and structure
>pdb|1R37|A Chain A, Alcohol Dehydrogenase From Sulfolobus Solfataricus Complexed With Nad(H) And 2-Ethoxyethanol Length = 347 Back     alignment and structure
>pdb|1LLU|A Chain A, The Ternary Complex Of Pseudomonas Aeruginosa Alcohol Dehydrogenase With Its Coenzyme And Weak Substrate Length = 342 Back     alignment and structure
>pdb|1NTO|A Chain A, N249y Mutant Of Alcohol Dehydrogenase From The Archaeon Sulfolobus Solfataricus-Monoclinic Crystal Form Length = 347 Back     alignment and structure
>pdb|3I4C|A Chain A, Crystal Structure Of Sulfolobus Solfataricus Adh(Ssadh) Double Mutant (W95l,N249y) Length = 347 Back     alignment and structure
>pdb|3COS|A Chain A, Crystal Structure Of Human Class Ii Alcohol Dehydrogenase (Adh4) In Complex With Nad And Zn Length = 381 Back     alignment and structure
>pdb|1PED|A Chain A, Bacterial Secondary Alcohol Dehydrogenase (Apo-Form) Length = 351 Back     alignment and structure
>pdb|3FSR|A Chain A, Chimera Of Alcohol Dehydrogenase By Exchange Of The Cofactor Binding Domain Res 153-295 Of T. Brockii Adh By C. Beijerinckii Adh Length = 352 Back     alignment and structure
>pdb|2B83|A Chain A, A Single Amino Acid Substitution In The Clostridium Beijerinckii Alcohol Dehydrogenase Is Critical For Thermostabilization Length = 351 Back     alignment and structure
>pdb|1Y9A|A Chain A, Alcohol Dehydrogenase From Entamoeba Histolotica In Complex With Cacodylate Length = 360 Back     alignment and structure
>pdb|3FTN|A Chain A, Q165eS254K DOUBLE MUTANT CHIMERA OF ALCOHOL DEHYDROGENASE BY EXCHANGE Of The Cofactor Binding Domain Res 153-295 Of T. Brockii Adh By C. Beijerinckii Adh Length = 352 Back     alignment and structure
>pdb|2OUI|A Chain A, D275p Mutant Of Alcohol Dehydrogenase From Protozoa Entamoeba Histolytica Length = 360 Back     alignment and structure
>pdb|1JQB|A Chain A, Alcohol Dehydrogenase From Clostridium Beijerinckii: Crystal Structure Of Mutant With Enhanced Thermal Stability Length = 351 Back     alignment and structure
>pdb|1JVB|A Chain A, Alcohol Dehydrogenase From The Archaeon Sulfolobus Solfataricus Length = 347 Back     alignment and structure
>pdb|1H2B|A Chain A, Crystal Structure Of The Alcohol Dehydrogenase From The Hyperthermophilic Archaeon Aeropyrum Pernix At 1.65a Resolution Length = 359 Back     alignment and structure
>pdb|3S1L|A Chain A, Crystal Structure Of Apo-Form Furx Length = 340 Back     alignment and structure
>pdb|1VJ0|A Chain A, Crystal Structure Of Alcohol Dehydrogenase (Tm0436) From Thermotoga Maritima At 2.00 A Resolution Length = 380 Back     alignment and structure
>pdb|3IP1|A Chain A, Structure Of Putative Alcohol Dehydrogenase (Tm_042) From Thermotoga Maritima Length = 404 Back     alignment and structure
>pdb|1F8F|A Chain A, Crystal Structure Of Benzyl Alcohol Dehydrogenase From Acinetobacter Calcoaceticus Length = 371 Back     alignment and structure
>pdb|3UKO|A Chain A, Crystal Structure Of S-Nitrosoglutathione Reductase From Arabidopsis Thaliana, Complex With Nadh Length = 378 Back     alignment and structure
>pdb|1MC5|A Chain A, Ternary Complex Of Human Glutathione-Dependent Formaldehyde Dehydrogenase With S-(Hydroxymethyl)glutathione And Nadh Length = 374 Back     alignment and structure
>pdb|1TEH|A Chain A, Structure Of Human Liver Chichi Alcohol Dehydrogenase (A Glutathione- Dependent Formaldehyde Dehydrogenase) Length = 373 Back     alignment and structure
>pdb|3QJ5|A Chain A, S-Nitrosoglutathione Reductase (Gsnor) In Complex With N6022 Length = 374 Back     alignment and structure
>pdb|1P0C|A Chain A, Crystal Structure Of The Nadp(H)-Dependent Vertebrate Alcohol Dehydrogenase (Adh8) Length = 373 Back     alignment and structure
>pdb|1CDO|A Chain A, Alcohol Dehydrogenase (E.C.1.1.1.1) (Ee Isozyme) Complexed With Nicotinamide Adenine Dinucleotide (Nad), And Zinc Length = 374 Back     alignment and structure
>pdb|1AGN|A Chain A, X-Ray Structure Of Human Sigma Alcohol Dehydrogenase Length = 373 Back     alignment and structure
>pdb|1D1T|A Chain A, Mutant Of Human Sigma Alcohol Dehydrogenase With Leucine At Position 141 Length = 373 Back     alignment and structure
>pdb|4DL9|A Chain A, Crystal Structure Of S-nitrosoglutathione Reductase From Tomato (solanum Lycopersicum) In Complex With Nad+ Length = 396 Back     alignment and structure
>pdb|2FZW|A Chain A, Structure Of The Binary Complex Of The E67l Mutant Of Human Glutathione-Dependent Formaldehyde Dehydrogenase With Nad(H) Length = 373 Back     alignment and structure
>pdb|1YQD|A Chain A, Sinapyl Alcohol Dehydrogenase Complexed With Nadp+ Length = 366 Back     alignment and structure
>pdb|2DPH|A Chain A, Crystal Structure Of Formaldehyde Dismutase Length = 398 Back     alignment and structure
>pdb|2H6E|A Chain A, Crystal Structure Of The D-Arabinose Dehydrogenase From Sulfolobus Solfataricus Length = 344 Back     alignment and structure
>pdb|1KOL|A Chain A, Crystal Structure Of Formaldehyde Dehydrogenase Length = 398 Back     alignment and structure
>pdb|1WLY|A Chain A, Crystal Structure Of 2-haloacrylate Reductase Length = 333 Back     alignment and structure
>pdb|3UOG|A Chain A, Crystal Structure Of Putative Alcohol Dehydrogenase From Sinorhizobium Meliloti 1021 Length = 363 Back     alignment and structure
>pdb|3TWO|A Chain A, The Crystal Structure Of Cad From Helicobacter Pylori Complexed With Nadp(H) Length = 348 Back     alignment and structure
>pdb|3JYL|A Chain A, Crystal Structures Of Pseudomonas Syringae Pv. Tomato Dc3000 Quinone Oxidoreductase Length = 325 Back     alignment and structure
>pdb|2HCY|A Chain A, Yeast Alcohol Dehydrogenase I, Saccharomyces Cerevisiae Fermentative Enzyme Length = 347 Back     alignment and structure
>pdb|3GOH|A Chain A, Crystal Structure Of Alcohol Dehydrogenase Superfamily Protein (np_718042.1) From Shewanella Oneidensis At 1.55 A Resolution Length = 315 Back     alignment and structure
>pdb|3QWA|A Chain A, Crystal Structure Of Saccharomyces Cerevisiae Zeta-Crystallin-Like Quinone Oxidoreductase Zta1 Length = 334 Back     alignment and structure
>pdb|1UUF|A Chain A, Crystal Structure Of A Zinc-Type Alcohol Dehydrogenase-Like Protein Yahk Length = 369 Back     alignment and structure
>pdb|1PS0|A Chain A, Crystal Structure Of The Nadp(H)-Dependent Cinnamyl Alcohol Dehydrogenase From Saccharomyces Cerevisiae Length = 360 Back     alignment and structure
>pdb|4A27|A Chain A, Crystal Structure Of Human Synaptic Vesicle Membrane Protein Vat-1 Homolog-Like Protein Length = 349 Back     alignment and structure
>pdb|3FBG|A Chain A, Crystal Structure Of A Putative Arginate Lyase From Staphylococcus Haemolyticus Length = 346 Back     alignment and structure
>pdb|3KRT|A Chain A, Crystal Structure Of Putative Crotonyl Coa Reductase From Streptomyces Coelicolor A3(2) Length = 456 Back     alignment and structure
>pdb|1YB5|A Chain A, Crystal Structure Of Human Zeta-crystallin With Bound Nadp Length = 351 Back     alignment and structure
>pdb|2B5W|A Chain A, Crystal Structure Of D38c Glucose Dehydrogenase Mutant From Haloferax Mediterranei Length = 357 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query365
1pl8_A356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 1e-173
1e3j_A352 NADP(H)-dependent ketose reductase; oxidoreductase 1e-169
3m6i_A363 L-arabinitol 4-dehydrogenase; medium chain dehydro 1e-162
2dq4_A343 L-threonine 3-dehydrogenase; NAD-dependent, oxidor 1e-155
4ej6_A370 Putative zinc-binding dehydrogenase; structural ge 1e-153
4a2c_A346 Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc 1e-148
2d8a_A348 PH0655, probable L-threonine 3-dehydrogenase; pyro 1e-145
2b5w_A357 Glucose dehydrogenase; nucleotide binding motif, o 1e-126
3ip1_A404 Alcohol dehydrogenase, zinc-containing; structural 1e-121
2cdc_A366 Glucose dehydrogenase glucose 1-dehydrogenase, DHG 2e-95
1vj0_A380 Alcohol dehydrogenase, zinc-containing; TM0436, st 1e-84
3fpc_A352 NADP-dependent alcohol dehydrogenase; oxydoreducta 1e-71
1jvb_A347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 3e-69
3jv7_A345 ADH-A; dehydrogenase, nucleotide binding, rossmann 1e-65
1h2b_A359 Alcohol dehydrogenase; oxidoreductase, archaea, hy 3e-62
2h6e_A344 ADH-4, D-arabinose 1-dehydrogenase; rossman fold, 3e-56
1f8f_A371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 2e-54
1e3i_A376 Alcohol dehydrogenase, class II; HET: NAD; 2.08A { 4e-49
2fzw_A373 Alcohol dehydrogenase class III CHI chain; S-nitro 2e-48
1p0f_A373 NADP-dependent alcohol dehydrogenase; ADH topology 3e-48
2dph_A398 Formaldehyde dismutase; dismutation of aldehydes, 1e-47
2jhf_A374 Alcohol dehydrogenase E chain; oxidoreductase, met 1e-47
1kol_A398 Formaldehyde dehydrogenase; oxidoreductase; HET: N 1e-46
1cdo_A374 Alcohol dehydrogenase; oxidoreductase, oxidoreduct 3e-45
3s2e_A340 Zinc-containing alcohol dehydrogenase superfamily; 1e-44
1rjw_A339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 3e-43
2hcy_A347 Alcohol dehydrogenase 1; tetramer of asymmetric di 1e-41
2eih_A343 Alcohol dehydrogenase; zinc ION binding protein, s 6e-41
3uog_A363 Alcohol dehydrogenase; structural genomics, protei 7e-40
4a0s_A447 Octenoyl-COA reductase/carboxylase; oxidoreductase 1e-39
3krt_A456 Crotonyl COA reductase; structural genomics, prote 5e-39
1zsy_A357 Mitochondrial 2-enoyl thioester reductase; medium- 8e-35
1gu7_A364 Enoyl-[acyl-carrier-protein] reductase [NADPH, B-s 2e-33
1piw_A360 Hypothetical zinc-type alcohol dehydrogenase- like 9e-30
1yqd_A366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 4e-28
2cf5_A357 Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign 2e-27
3tqh_A321 Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella 2e-27
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 2e-27
1wly_A333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 1e-26
3pi7_A349 NADH oxidoreductase; groes-like fold, NAD(P)-bindi 2e-26
4eye_A342 Probable oxidoreductase; structural genomics, niai 2e-26
1uuf_A369 YAHK, zinc-type alcohol dehydrogenase-like protein 2e-26
3gqv_A371 Enoyl reductase; medium-chain reductase (MDR super 3e-25
3gms_A340 Putative NADPH:quinone reductase; structural genom 2e-24
1yb5_A351 Quinone oxidoreductase; medium-chain dehydrogenase 3e-24
3jyn_A325 Quinone oxidoreductase; rossmann fold, protein-NAD 4e-24
1qor_A327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 4e-24
3goh_A315 Alcohol dehydrogenase, zinc-containing; NP_718042. 6e-24
4a27_A349 Synaptic vesicle membrane protein VAT-1 homolog-L; 1e-23
3iup_A379 Putative NADPH:quinone oxidoreductase; YP_296108.1 2e-23
3gaz_A343 Alcohol dehydrogenase superfamily protein; oxidore 7e-22
3qwb_A334 Probable quinone oxidoreductase; rossmann fold, qu 1e-21
4dup_A353 Quinone oxidoreductase; PSI-biology, structural ge 3e-21
2vn8_A375 Reticulon-4-interacting protein 1; mitochondrion, 7e-21
1iz0_A302 Quinone oxidoreductase; APO-enzyme, riken structur 5e-20
4dvj_A363 Putative zinc-dependent alcohol dehydrogenase Pro; 6e-20
3fbg_A346 Putative arginate lyase; structural genomics, unkn 5e-18
2j8z_A354 Quinone oxidoreductase; medium-chain dehydrogenase 6e-17
3slk_A 795 Polyketide synthase extender module 2; rossmann fo 2e-15
2c0c_A362 Zinc binding alcohol dehydrogenase, domain contain 3e-15
1tt7_A330 YHFP; alcohol dehydrogenase, Zn-dependent, NAD, st 3e-05
1xa0_A328 Putative NADPH dependent oxidoreductases; structur 7e-05
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 2e-04
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Length = 356 Back     alignment and structure
 Score =  484 bits (1247), Expect = e-173
 Identities = 167/347 (48%), Positives = 231/347 (66%), Gaps = 6/347 (1%)

Query: 18  NMAAWLLGVNTLKIQPFELPSLGPYDVLVRMKAVGICGSDVHYLKTLRCADFVVKEPMVI 77
           N++  + G   L+++ + +P  GP +VL+RM +VGICGSDVHY +  R  +F+VK+PMV+
Sbjct: 8   NLSLVVHGPGDLRLENYPIPEPGPNEVLLRMHSVGICGSDVHYWEYGRIGNFIVKKPMVL 67

Query: 78  GHECAGVIEKVGSEVKTLVPGDRVALEPGISCWRCDHCKGGRYNLCPEMKFFATPPVHGS 137
           GHE +G +EKVGS VK L PGDRVA+EPG      + CK GRYNL P + F ATPP  G+
Sbjct: 68  GHEASGTVEKVGSSVKHLKPGDRVAIEPGAPRENDEFCKMGRYNLSPSIFFCATPPDDGN 127

Query: 138 LANQVVHPADLCFKLPDNVSLEEGAMCEPLSVGLHACRRANIGPETNVLIMGAGPIGLVT 197
           L     H A  C+KLPDNV+ EEGA+ EPLSVG+HACRR  +     VL+ GAGPIG+VT
Sbjct: 128 LCRFYKHNAAFCYKLPDNVTFEEGALIEPLSVGIHACRRGGVTLGHKVLVCGAGPIGMVT 187

Query: 198 MLGAPRAFGAPRIVIVDVDDYRLSVAKEIGADNIVKVSTNLQDIAEEVEKIQKAMGTGID 257
           +L A +A GA ++V+ D+   RLS AKEIGAD ++++S   +   E   K++  +G   +
Sbjct: 188 LLVA-KAMGAAQVVVTDLSATRLSKAKEIGADLVLQISK--ESPQEIARKVEGQLGCKPE 244

Query: 258 VSFDCAGLNKTMSTALGATCAGGKVCLVGMGHHEMTVPLTPAAVREVDVVGVFRYKNTWP 317
           V+ +C G   ++   + AT +GG + LVG+G    TVPL  AA+REVD+ GVFRY NTWP
Sbjct: 245 VTIECTGAEASIQAGIYATRSGGTLVLVGLGSEMTTVPLLHAAIREVDIKGVFRYCNTWP 304

Query: 318 LCLELLRSGKIDVKPLVTHRFGFSQKEVEEAFETSARGGTAIKVMFN 364
           + + +L S  ++VKPLVTHRF    ++  EAFET  + G  +K+M  
Sbjct: 305 VAISMLASKSVNVKPLVTHRFPL--EKALEAFET-FKKGLGLKIMLK 348


>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Length = 352 Back     alignment and structure
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Length = 363 Back     alignment and structure
>2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* Length = 343 Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Length = 370 Back     alignment and structure
>4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} Length = 346 Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Length = 348 Back     alignment and structure
>2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* Length = 357 Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Length = 404 Back     alignment and structure
>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Length = 366 Back     alignment and structure
>1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 Length = 380 Back     alignment and structure
>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A Length = 352 Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Length = 347 Back     alignment and structure
>3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Length = 345 Back     alignment and structure
>1h2b_A Alcohol dehydrogenase; oxidoreductase, archaea, hyperthermophIle, zinc; HET: OCA NAJ; 1.62A {Aeropyrum pernix} SCOP: b.35.1.2 c.2.1.1 Length = 359 Back     alignment and structure
>2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} Length = 344 Back     alignment and structure
>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Length = 371 Back     alignment and structure
>1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* Length = 376 Back     alignment and structure
>2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* Length = 373 Back     alignment and structure
>1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* Length = 373 Back     alignment and structure
>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Length = 398 Back     alignment and structure
>2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... Length = 374 Back     alignment and structure
>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 Length = 398 Back     alignment and structure
>1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 Length = 374 Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Length = 340 Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Length = 339 Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Length = 347 Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Length = 343 Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Length = 363 Back     alignment and structure
>4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Length = 447 Back     alignment and structure
>3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A Length = 456 Back     alignment and structure
>1zsy_A Mitochondrial 2-enoyl thioester reductase; medium-chain dehydrogenase/reductase, oxidoreductase, 2-ENOY thioester reductase; 1.75A {Homo sapiens} PDB: 2vcy_A Length = 357 Back     alignment and structure
>1gu7_A Enoyl-[acyl-carrier-protein] reductase [NADPH, B-specific] 1,mitochondrial; oxidoreductase, thioester reduction, fatty acids; 1.70A {Candida tropicalis} SCOP: b.35.1.2 c.2.1.1 PDB: 1guf_A* 1n9g_B* 1n9g_A* 1gyr_A 1h0k_A Length = 364 Back     alignment and structure
>1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A Length = 360 Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Length = 366 Back     alignment and structure
>2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* Length = 357 Back     alignment and structure
>3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} Length = 321 Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Length = 348 Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Length = 333 Back     alignment and structure
>3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} Length = 349 Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Length = 342 Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Length = 369 Back     alignment and structure
>3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* Length = 371 Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Length = 340 Back     alignment and structure
>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Length = 351 Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Length = 325 Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Length = 327 Back     alignment and structure
>3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} Length = 315 Back     alignment and structure
>4a27_A Synaptic vesicle membrane protein VAT-1 homolog-L; oxidoreductase; 2.10A {Homo sapiens} Length = 349 Back     alignment and structure
>3iup_A Putative NADPH:quinone oxidoreductase; YP_296108.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE NDP; 1.70A {Ralstonia eutropha} Length = 379 Back     alignment and structure
>3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} Length = 343 Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Length = 334 Back     alignment and structure
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Length = 353 Back     alignment and structure
>2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} Length = 375 Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Length = 302 Back     alignment and structure
>4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} Length = 363 Back     alignment and structure
>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Length = 346 Back     alignment and structure
>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Length = 354 Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Length = 795 Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Length = 362 Back     alignment and structure
>1tt7_A YHFP; alcohol dehydrogenase, Zn-dependent, NAD, structural genomics, protein structure initiative, PSI; 2.70A {Bacillus subtilis} SCOP: b.35.1.2 c.2.1.1 PDB: 1y9e_A* Length = 330 Back     alignment and structure
>1xa0_A Putative NADPH dependent oxidoreductases; structural genomics, protein structure initiative, MCSG; HET: DTY; 2.80A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 Length = 328 Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Length = 2512 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query365
3m6i_A363 L-arabinitol 4-dehydrogenase; medium chain dehydro 100.0
1pl8_A356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 100.0
1e3j_A352 NADP(H)-dependent ketose reductase; oxidoreductase 100.0
4ej6_A370 Putative zinc-binding dehydrogenase; structural ge 100.0
4a2c_A346 Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc 100.0
2d8a_A348 PH0655, probable L-threonine 3-dehydrogenase; pyro 100.0
3uko_A378 Alcohol dehydrogenase class-3; alcohol dehydrogena 100.0
1p0f_A373 NADP-dependent alcohol dehydrogenase; ADH topology 100.0
2dq4_A343 L-threonine 3-dehydrogenase; NAD-dependent, oxidor 100.0
3s2e_A340 Zinc-containing alcohol dehydrogenase superfamily; 100.0
1h2b_A359 Alcohol dehydrogenase; oxidoreductase, archaea, hy 100.0
1e3i_A376 Alcohol dehydrogenase, class II; HET: NAD; 2.08A { 100.0
1cdo_A374 Alcohol dehydrogenase; oxidoreductase, oxidoreduct 100.0
1f8f_A371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 100.0
3jv7_A345 ADH-A; dehydrogenase, nucleotide binding, rossmann 100.0
2jhf_A374 Alcohol dehydrogenase E chain; oxidoreductase, met 100.0
3fpc_A352 NADP-dependent alcohol dehydrogenase; oxydoreducta 100.0
2fzw_A373 Alcohol dehydrogenase class III CHI chain; S-nitro 100.0
1vj0_A380 Alcohol dehydrogenase, zinc-containing; TM0436, st 100.0
4eez_A348 Alcohol dehydrogenase 1; site-saturation mutagenes 100.0
1rjw_A339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 100.0
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 100.0
2h6e_A344 ADH-4, D-arabinose 1-dehydrogenase; rossman fold, 100.0
2hcy_A347 Alcohol dehydrogenase 1; tetramer of asymmetric di 100.0
3uog_A363 Alcohol dehydrogenase; structural genomics, protei 100.0
2eih_A343 Alcohol dehydrogenase; zinc ION binding protein, s 100.0
1piw_A360 Hypothetical zinc-type alcohol dehydrogenase- like 100.0
2dph_A398 Formaldehyde dismutase; dismutation of aldehydes, 100.0
1jvb_A347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 100.0
3ip1_A404 Alcohol dehydrogenase, zinc-containing; structural 100.0
1kol_A398 Formaldehyde dehydrogenase; oxidoreductase; HET: N 100.0
2b5w_A357 Glucose dehydrogenase; nucleotide binding motif, o 100.0
1uuf_A369 YAHK, zinc-type alcohol dehydrogenase-like protein 100.0
2cf5_A357 Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign 100.0
1yqd_A366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 100.0
3krt_A456 Crotonyl COA reductase; structural genomics, prote 100.0
4a0s_A447 Octenoyl-COA reductase/carboxylase; oxidoreductase 100.0
4dup_A353 Quinone oxidoreductase; PSI-biology, structural ge 100.0
2cdc_A366 Glucose dehydrogenase glucose 1-dehydrogenase, DHG 100.0
4eye_A342 Probable oxidoreductase; structural genomics, niai 100.0
3qwb_A334 Probable quinone oxidoreductase; rossmann fold, qu 100.0
4dvj_A363 Putative zinc-dependent alcohol dehydrogenase Pro; 100.0
3tqh_A321 Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella 100.0
3gaz_A343 Alcohol dehydrogenase superfamily protein; oxidore 100.0
3pi7_A349 NADH oxidoreductase; groes-like fold, NAD(P)-bindi 100.0
3gqv_A371 Enoyl reductase; medium-chain reductase (MDR super 100.0
3fbg_A346 Putative arginate lyase; structural genomics, unkn 100.0
3gms_A340 Putative NADPH:quinone reductase; structural genom 100.0
3goh_A315 Alcohol dehydrogenase, zinc-containing; NP_718042. 100.0
4a27_A349 Synaptic vesicle membrane protein VAT-1 homolog-L; 100.0
2j8z_A354 Quinone oxidoreductase; medium-chain dehydrogenase 100.0
3jyn_A325 Quinone oxidoreductase; rossmann fold, protein-NAD 100.0
1yb5_A351 Quinone oxidoreductase; medium-chain dehydrogenase 100.0
1zsy_A357 Mitochondrial 2-enoyl thioester reductase; medium- 100.0
1gu7_A364 Enoyl-[acyl-carrier-protein] reductase [NADPH, B-s 100.0
1wly_A333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 100.0
1qor_A327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 100.0
4b7c_A336 Probable oxidoreductase; NADP cofactor, rossmann f 100.0
2c0c_A362 Zinc binding alcohol dehydrogenase, domain contain 100.0
3nx4_A324 Putative oxidoreductase; csgid, structural genomic 100.0
2vn8_A375 Reticulon-4-interacting protein 1; mitochondrion, 100.0
1tt7_A330 YHFP; alcohol dehydrogenase, Zn-dependent, NAD, st 100.0
3iup_A379 Putative NADPH:quinone oxidoreductase; YP_296108.1 100.0
2zb4_A357 Prostaglandin reductase 2; rossmann fold, alternat 100.0
1xa0_A328 Putative NADPH dependent oxidoreductases; structur 100.0
1iz0_A302 Quinone oxidoreductase; APO-enzyme, riken structur 100.0
2j3h_A345 NADP-dependent oxidoreductase P1; double bond redu 100.0
1v3u_A333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 100.0
3slk_A 795 Polyketide synthase extender module 2; rossmann fo 100.0
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 99.97
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 99.83
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltr 99.08
1gpj_A404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 98.9
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 98.67
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 98.44
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 98.39
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 98.38
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 98.37
3ce6_A494 Adenosylhomocysteinase; protein-substrate complex, 98.26
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structu 98.12
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 98.08
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 97.96
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 97.84
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 97.82
1i9g_A280 Hypothetical protein RV2118C; mtase, adoMet, cryst 97.82
1p91_A269 Ribosomal RNA large subunit methyltransferase A; R 97.79
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 97.77
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 97.58
2b25_A336 Hypothetical protein; structural genomics, methyl 97.56
3gvp_A435 Adenosylhomocysteinase 3; protein CO-factor comple 97.56
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 97.54
2rir_A300 Dipicolinate synthase, A chain; structural genomic 97.33
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 97.23
3c85_A183 Putative glutathione-regulated potassium-efflux S 97.22
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 97.19
3ond_A488 Adenosylhomocysteinase; plant protein, enzyme-subs 97.19
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 97.18
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase 97.13
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 97.1
3n58_A464 Adenosylhomocysteinase; ssgcid, hydrolase, structu 97.09
4eso_A255 Putative oxidoreductase; NADP, structural genomics 96.97
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; 96.97
3oig_A266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 96.93
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 96.91
2nyu_A196 Putative ribosomal RNA methyltransferase 2; SAM, s 96.83
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 96.8
3grk_A293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 96.8
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 96.79
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 96.79
3h9u_A436 Adenosylhomocysteinase; NAD CO-factor complex, str 96.78
3cea_A 346 MYO-inositol 2-dehydrogenase; NP_786804.1, oxidore 96.73
2d1y_A256 Hypothetical protein TT0321; strucrtural genomics, 96.71
1nvm_B 312 Acetaldehyde dehydrogenase (acylating), 4-hydroxy- 96.69
3gem_A260 Short chain dehydrogenase; structural genomics, AP 96.67
3u5t_A267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 96.67
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 96.67
4fs3_A256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 96.66
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 96.63
3v2g_A271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 96.62
2ekp_A239 2-deoxy-D-gluconate 3-dehydrogenase; structural ge 96.61
3is3_A270 17BETA-hydroxysteroid dehydrogenase; short chain d 96.6
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 96.58
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 96.57
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 96.57
3ged_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 96.56
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 96.54
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 96.54
3p19_A266 BFPVVD8, putative blue fluorescent protein; rossma 96.53
1uls_A245 Putative 3-oxoacyl-acyl carrier protein reductase; 96.51
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransfe 96.51
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 96.5
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 96.49
2fk8_A318 Methoxy mycolic acid synthase 4; S-adenosylmethion 96.47
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 96.46
1ae1_A273 Tropinone reductase-I; oxidoreductase, tropane alk 96.46
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 96.45
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 96.45
4b79_A242 PA4098, probable short-chain dehydrogenase; oxidor 96.43
1yde_A270 Retinal dehydrogenase/reductase 3; oxidoreductase, 96.42
1dl5_A317 Protein-L-isoaspartate O-methyltransferase; isoasp 96.4
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 96.39
3uf0_A273 Short-chain dehydrogenase/reductase SDR; gluconate 96.38
2z1n_A260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 96.38
3e18_A 359 Oxidoreductase; dehydrogenase, NAD-binding, struct 96.37
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 96.37
2hnk_A239 SAM-dependent O-methyltransferase; modified rossma 96.35
3imf_A257 Short chain dehydrogenase; structural genomics, in 96.34
3o26_A 311 Salutaridine reductase; short chain dehydrogenase/ 96.34
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 96.34
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 96.33
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 96.32
1g0o_A283 Trihydroxynaphthalene reductase; protein-NADPH-act 96.32
4dqx_A277 Probable oxidoreductase protein; structural genomi 96.32
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 96.3
3abi_A 365 Putative uncharacterized protein PH1688; L-lysine 96.29
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 96.29
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 96.29
1sny_A267 Sniffer CG10964-PA; alpha and beta protein, rossma 96.29
3hem_A302 Cyclopropane-fatty-acyl-phospholipid synthase 2; p 96.28
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 96.27
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 96.27
3tfo_A264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 96.27
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 96.27
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 96.26
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 96.26
3tjr_A301 Short chain dehydrogenase; structural genomics, se 96.26
3zv4_A281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 96.25
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 96.25
3v8b_A283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 96.25
1iy8_A267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 96.25
1c1d_A355 L-phenylalanine dehydrogenase; amino acid dehydrog 96.25
2rhc_B277 Actinorhodin polyketide ketoreductase; oxidoreduct 96.24
2gpy_A233 O-methyltransferase; structural genomics, PSI, pro 96.24
3ioy_A 319 Short-chain dehydrogenase/reductase SDR; structura 96.23
3rd5_A291 Mypaa.01249.C; ssgcid, structural genomics, seattl 96.23
1xq1_A266 Putative tropinone reducatse; structural genomics, 96.22
1hdc_A254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 96.22
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 96.22
3k31_A296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 96.21
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 96.2
2b4q_A276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 96.2
3rih_A293 Short chain dehydrogenase or reductase; structural 96.2
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 96.2
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 96.18
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 96.18
2a4k_A263 3-oxoacyl-[acyl carrier protein] reductase; reduct 96.17
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 96.17
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 96.17
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 96.17
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 96.17
2ag5_A246 DHRS6, dehydrogenase/reductase (SDR family) member 96.16
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 96.16
4had_A 350 Probable oxidoreductase protein; structural genomi 96.16
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 96.15
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase 96.15
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 96.15
3grp_A266 3-oxoacyl-(acyl carrierprotein) reductase; structu 96.14
3cxt_A291 Dehydrogenase with different specificities; rossma 96.14
3gvc_A277 Oxidoreductase, probable short-chain type dehydrog 96.14
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 96.13
3r3s_A294 Oxidoreductase; structural genomics, csgid, center 96.13
2ph5_A 480 Homospermidine synthase; alpha-beta protein, struc 96.13
1xkq_A280 Short-chain reductase family member (5D234); parra 96.13
2z2v_A 365 Hypothetical protein PH1688; L-lysine dehydrogenas 96.12
2ew8_A249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 96.11
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 96.11
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 96.1
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 96.08
3tox_A280 Short chain dehydrogenase; structural genomics, PS 96.08
4gkb_A258 3-oxoacyl-[acyl-carrier protein] reductase; putati 96.07
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 96.07
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 96.07
1xhl_A297 Short-chain dehydrogenase/reductase family member 96.07
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 96.06
2pbf_A227 Protein-L-isoaspartate O-methyltransferase beta-A 96.05
1o5i_A249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 96.05
1geg_A256 Acetoin reductase; SDR family, oxidoreductase; HET 96.05
1wma_A276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 96.04
3oid_A258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 96.03
3v2h_A281 D-beta-hydroxybutyrate dehydrogenase; structural g 96.02
3m1a_A281 Putative dehydrogenase; short, PSI, MCSG, structur 96.02
1w6u_A302 2,4-dienoyl-COA reductase, mitochondrial precursor 96.01
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 96.01
1vl8_A267 Gluconate 5-dehydrogenase; TM0441, structural geno 96.01
1lss_A140 TRK system potassium uptake protein TRKA homolog; 96.0
2bgk_A278 Rhizome secoisolariciresinol dehydrogenase; oxidor 96.0
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 95.99
4hkt_A 331 Inositol 2-dehydrogenase; structural genomics, nys 95.99
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 95.98
4ibo_A271 Gluconate dehydrogenase; enzyme function initiativ 95.96
1hxh_A253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 95.96
1nff_A260 Putative oxidoreductase RV2002; directed evolution 95.96
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 95.96
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 95.96
1zem_A262 Xylitol dehydrogenase; rossmann fold, dinucleotide 95.95
1sby_A254 Alcohol dehydrogenase; ternary complex, NAD, trifl 95.95
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 95.93
3rc1_A 350 Sugar 3-ketoreductase; sugar biosynthesis, TDP bin 95.92
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 95.92
3pwz_A272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 95.91
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 95.9
3ujc_A266 Phosphoethanolamine N-methyltransferase; parasite; 95.9
1kpg_A287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 95.9
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 95.89
1fbn_A230 MJ fibrillarin homologue; MJ proteins, ribosomal R 95.89
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 95.89
4imr_A275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 95.86
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 95.85
2qq5_A260 DHRS1, dehydrogenase/reductase SDR family member 1 95.85
3ezy_A 344 Dehydrogenase; structural genomics, unknown functi 95.84
4dmm_A269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 95.84
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 95.84
1mxh_A276 Pteridine reductase 2; SDR topology, protein-subst 95.83
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 95.8
3edm_A259 Short chain dehydrogenase; structural genomics, ox 95.78
3ek2_A271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 95.77
2glx_A 332 1,5-anhydro-D-fructose reductase; NADP(H) dependen 95.76
2uvd_A246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 95.76
4e3z_A272 Putative oxidoreductase protein; PSI-biology, stru 95.75
1xu9_A286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 95.75
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 95.73
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 95.72
1vl6_A388 Malate oxidoreductase; TM0542, NAD-dependent malic 95.71
1zmt_A254 Haloalcohol dehalogenase HHEC; halohydrin dehaloge 95.71
3vtz_A269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 95.71
2gn4_A 344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 95.71
2gdz_A267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 95.7
3sx2_A278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 95.7
3uve_A286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 95.69
3q2i_A 354 Dehydrogenase; rossmann fold, UDP-sugar binding, N 95.69
1x1t_A260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 95.69
4fc7_A277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 95.69
4h15_A261 Short chain alcohol dehydrogenase-related dehydro; 95.69
1npy_A271 Hypothetical shikimate 5-dehydrogenase-like protei 95.68
3ou2_A218 SAM-dependent methyltransferase; O-methyltransfera 95.68
3pgx_A280 Carveol dehydrogenase; structural genomics, seattl 95.68
1yxm_A303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 95.67
4da9_A280 Short-chain dehydrogenase/reductase; structural ge 95.67
2bd0_A244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 95.66
3u0b_A454 Oxidoreductase, short chain dehydrogenase/reducta 95.66
2q2v_A255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 95.65
1nkv_A256 Hypothetical protein YJHP; structural genomics, PS 95.65
2pd4_A275 Enoyl-[acyl-carrier-protein] reductase [NADH]; ant 95.65
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 95.64
3db2_A 354 Putative NADPH-dependent oxidoreductase; two domai 95.63
4iin_A271 3-ketoacyl-acyl carrier protein reductase (FABG); 95.63
3s55_A281 Putative short-chain dehydrogenase/reductase; stru 95.63
3ksu_A262 3-oxoacyl-acyl carrier protein reductase; structur 95.62
3i4f_A264 3-oxoacyl-[acyl-carrier protein] reductase; struct 95.62
3kvo_A 346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 95.62
2avd_A229 Catechol-O-methyltransferase; structural genomics, 95.62
3e9m_A 330 Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, 95.6
3l9w_A 413 Glutathione-regulated potassium-efflux system Pro 95.59
3adn_A294 Spermidine synthase; aminopropyltransferase, polya 95.59
4iiu_A267 3-oxoacyl-[acyl-carrier protein] reductase; struct 95.58
1ixk_A315 Methyltransferase; open beta sheet; 1.90A {Pyrococ 95.57
3nrc_A280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 95.57
3sc4_A285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 95.57
1r18_A227 Protein-L-isoaspartate(D-aspartate)-O-methyltrans; 95.56
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 95.56
3kzv_A254 Uncharacterized oxidoreductase YIR035C; cytoplasmi 95.56
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 95.55
2wyu_A261 Enoyl-[acyl carrier protein] reductase; oxidoreduc 95.55
1i1n_A226 Protein-L-isoaspartate O-methyltransferase; S-aden 95.55
1spx_A278 Short-chain reductase family member (5L265); paral 95.53
2fwm_X250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 95.52
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 95.5
3a28_C258 L-2.3-butanediol dehydrogenase; chiral substrate r 95.5
2cfc_A250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 95.49
3euw_A 344 MYO-inositol dehydrogenase; protein structure init 95.48
3e48_A 289 Putative nucleoside-diphosphate-sugar epimerase; a 95.48
1edo_A244 Beta-keto acyl carrier protein reductase; nucleoti 95.48
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 95.47
3pxx_A287 Carveol dehydrogenase; structural genomics, seattl 95.47
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 95.47
3tfw_A248 Putative O-methyltransferase; PSI-biology, nysgrc, 95.46
2p91_A285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 95.45
3osu_A246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 95.42
3tsc_A277 Putative oxidoreductase; structural genomics, seat 95.42
3t7c_A299 Carveol dehydrogenase; structural genomics, seattl 95.41
1gee_A261 Glucose 1-dehydrogenase; short-chain dehydrogenase 95.4
2h7i_A269 Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi 95.39
4df3_A233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 95.38
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 95.37
1e7w_A291 Pteridine reductase; dihydrofolate reductase, shor 95.37
1iy9_A275 Spermidine synthase; rossmann fold, structural gen 95.33
3tl3_A257 Short-chain type dehydrogenase/reductase; ssgcid, 95.33
3ajd_A274 Putative methyltransferase MJ0026; tRNA, M5C, ross 95.32
2axq_A 467 Saccharopine dehydrogenase; rossmann fold variant, 95.32
3h8v_A292 Ubiquitin-like modifier-activating enzyme 5; rossm 95.31
4hp8_A247 2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi 95.3
3ppi_A281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 95.3
2qhx_A328 Pteridine reductase 1; oxidoreductase, short-chain 95.29
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 95.28
4fb5_A 393 Probable oxidoreductase protein; PSI-biology, nysg 95.28
1u2z_A433 Histone-lysine N-methyltransferase, H3 lysine-79 s 95.27
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 95.27
2nm0_A253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 95.25
2dtx_A264 Glucose 1-dehydrogenase related protein; rossmann 95.25
3m4x_A 456 NOL1/NOP2/SUN family protein; mtase domain, PUA do 95.24
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 95.22
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- 95.22
2hq1_A247 Glucose/ribitol dehydrogenase; CTH-1438, structura 95.21
3g0o_A 303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 95.21
1ej0_A180 FTSJ; methyltransferase, adoMet, adenosyl methioni 95.2
3duw_A223 OMT, O-methyltransferase, putative; alternating of 95.19
1vl5_A260 Unknown conserved protein BH2331; putative methylt 95.17
3uwp_A438 Histone-lysine N-methyltransferase, H3 lysine-79; 95.16
1oaa_A259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 95.15
1pjz_A203 Thiopurine S-methyltransferase; polymorphism, S-ad 95.15
1yb2_A275 Hypothetical protein TA0852; structural genomics, 95.14
2x9g_A288 PTR1, pteridine reductase; short chain dehydrogena 95.14
4ina_A 405 Saccharopine dehydrogenase; structural genomics, P 95.14
3e03_A274 Short chain dehydrogenase; structural genomics, PS 95.13
2ph3_A245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 95.12
3d64_A494 Adenosylhomocysteinase; structural genomics, ssgci 95.11
1mjf_A281 Spermidine synthase; spermidine synthetase, struct 95.1
1qsg_A265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 95.1
3oec_A317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 95.09
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 95.09
3rku_A287 Oxidoreductase YMR226C; substrate fingerprint, sho 95.07
1ja9_A274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 95.07
4gqa_A 412 NAD binding oxidoreductase; structural genomics, P 95.06
3vc1_A312 Geranyl diphosphate 2-C-methyltransferase; rossman 95.05
3ezl_A256 Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA 95.05
3e9n_A245 Putative short-chain dehydrogenase/reductase; stru 95.05
1zh8_A 340 Oxidoreductase; TM0312, structural genomics, JO ce 95.04
1gz6_A 319 Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF 95.03
2i7c_A283 Spermidine synthase; transferase, structural genom 95.02
1h5q_A265 NADP-dependent mannitol dehydrogenase; oxidoreduct 95.01
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 95.01
3evn_A 329 Oxidoreductase, GFO/IDH/MOCA family; structural ge 95.01
2gb4_A252 Thiopurine S-methyltransferase; 18204406, thiopuri 95.0
2b2c_A314 Spermidine synthase; beta-alpha, transferase; 2.50 95.0
1v8b_A479 Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 94.99
4dll_A 320 2-hydroxy-3-oxopropionate reductase; structural ge 94.99
3asu_A248 Short-chain dehydrogenase/reductase SDR; SDR famil 94.98
3s8m_A 422 Enoyl-ACP reductase; rossmann fold, oxidoreductase 94.98
3qlj_A322 Short chain dehydrogenase; structural genomics, se 94.97
3u9l_A 324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 94.96
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 94.96
2yxl_A450 PH0851 protein, 450AA long hypothetical FMU protei 94.94
3pef_A 287 6-phosphogluconate dehydrogenase, NAD-binding; gam 94.93
2o07_A304 Spermidine synthase; structural genomics, structur 94.93
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 94.89
2h78_A 302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 94.87
1xq6_A253 Unknown protein; structural genomics, protein stru 94.86
1inl_A296 Spermidine synthase; beta-barrel, rossman fold, st 94.84
1zmo_A244 Halohydrin dehalogenase; haloalcohol dehalogenase, 94.84
3orh_A236 Guanidinoacetate N-methyltransferase; structura ge 94.82
1xxl_A239 YCGJ protein; structural genomics, protein structu 94.8
1vpd_A 299 Tartronate semialdehyde reductase; structural geno 94.79
3ohs_X 334 Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; d 94.76
3gk3_A269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 94.76
2ixa_A 444 Alpha-N-acetylgalactosaminidase; NAD, A-ECO conver 94.74
1id1_A153 Putative potassium channel protein; RCK domain, E. 94.73
3nzo_A 399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 94.71
1nt2_A210 Fibrillarin-like PRE-rRNA processing protein; adeM 94.69
1dhr_A241 Dihydropteridine reductase; oxidoreductase(acting 94.67
3bus_A273 REBM, methyltransferase; rebeccamycin synthesis; H 94.67
2jl1_A 287 Triphenylmethane reductase; oxidoreductase, biorem 94.66
3un1_A260 Probable oxidoreductase; structural genomics, PSI- 94.66
1wwk_A307 Phosphoglycerate dehydrogenase; riken structural g 94.65
3ggo_A 314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 94.64
2pt6_A321 Spermidine synthase; transferase, structural genom 94.61
1ooe_A236 Dihydropteridine reductase; structural genomics, P 94.61
3bwc_A304 Spermidine synthase; SAM, SGPP, structura genomics 94.58
2z5l_A511 Tylkr1, tylactone synthase starter module and modu 94.57
3m33_A226 Uncharacterized protein; structural genomics, PSI- 94.54
2nwq_A272 Probable short-chain dehydrogenase; oxidoreductase 94.54
1g8a_A227 Fibrillarin-like PRE-rRNA processing protein; rRNA 94.53
2pxx_A215 Uncharacterized protein MGC2408; structural genomi 94.52
1xj5_A334 Spermidine synthase 1; structural genomics, protei 94.49
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 94.49
2o57_A297 Putative sarcosine dimethylglycine methyltransfera 94.48
3g5t_A299 Trans-aconitate 3-methyltransferase; structural ge 94.47
2gas_A 307 Isoflavone reductase; NADPH-dependent reductase, o 94.44
3doj_A 310 AT3G25530, dehydrogenase-like protein; gamma-hydro 94.44
3cbg_A232 O-methyltransferase; cyanobacterium; HET: SAH FER 94.44
1ff9_A 450 Saccharopine reductase; lysine biosynthesis, alpha 94.43
3zu3_A 405 Putative reductase YPO4104/Y4119/YP_4011; oxidored 94.43
2frx_A 479 Hypothetical protein YEBU; rossmann-type S-adenosy 94.42
3g89_A249 Ribosomal RNA small subunit methyltransferase G; 1 94.42
3qp9_A525 Type I polyketide synthase pikaii; rossmann fold, 94.41
2p35_A259 Trans-aconitate 2-methyltransferase; SAM dependent 94.4
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 94.4
3ctm_A279 Carbonyl reductase; alcohol dehydrogenase, short-c 94.39
3moi_A 387 Probable dehydrogenase; structural genomics, PSI2, 94.39
2g5c_A 281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 94.39
2j6i_A364 Formate dehydrogenase; oxidoreductase, D-specific- 94.37
1yzh_A214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta 94.37
4h3v_A 390 Oxidoreductase domain protein; structural genomics 94.33
2ekl_A313 D-3-phosphoglycerate dehydrogenase; structural gen 94.33
3tr6_A225 O-methyltransferase; cellular processes; HET: SAH; 94.33
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 94.31
3m6w_A 464 RRNA methylase; rRNA methyltransferase, 5-methylcy 94.31
2fca_A213 TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac 94.3
1qyd_A 313 Pinoresinol-lariciresinol reductase; NADPH-depende 94.28
1uir_A314 Polyamine aminopropyltransferase; spermidien synth 94.27
3i6i_A 346 Putative leucoanthocyanidin reductase 1; rossmann 94.27
2dbq_A334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 94.24
3icc_A255 Putative 3-oxoacyl-(acyl carrier protein) reducta; 94.24
1sqg_A429 SUN protein, FMU protein; rossmann-fold, mixed bet 94.23
2nvw_A 479 Galactose/lactose metabolism regulatory protein GA 94.2
3kkz_A267 Uncharacterized protein Q5LES9; putative methyltra 94.18
3f4k_A257 Putative methyltransferase; structural genomics, P 94.18
3e82_A 364 Putative oxidoreductase; NAD, GFO/IDH/MOCA family, 94.17
4ggo_A 401 Trans-2-enoyl-COA reductase; rossmann fold, oxidor 94.16
4eue_A 418 Putative reductase CA_C0462; TER, biofuel, synthet 94.15
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 94.14
2g76_A335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor 94.13
3kux_A 352 Putative oxidoreductase; oxidoreductase family, cs 94.13
3hdj_A313 Probable ornithine cyclodeaminase; APC62486, borde 94.13
3iv6_A261 Putative Zn-dependent alcohol dehydrogenase; alpha 94.1
3id6_C232 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 94.09
1fjh_A257 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc 94.07
3gdo_A 358 Uncharacterized oxidoreductase YVAA; structural ge 94.07
3g07_A292 7SK snRNA methylphosphate capping enzyme; structur 94.06
3mz0_A 344 Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; 94.04
3sm3_A235 SAM-dependent methyltransferases; NESG, structural 93.96
1uzm_A247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 93.96
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 93.94
4gek_A261 TRNA (CMO5U34)-methyltransferase; structural genom 93.93
3uxy_A266 Short-chain dehydrogenase/reductase SDR; structura 93.92
3ruf_A 351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 93.92
1qyc_A 308 Phenylcoumaran benzylic ether reductase PT1; NADPH 93.9
3c3y_A237 Pfomt, O-methyltransferase; plant secondary metabo 93.9
3uce_A223 Dehydrogenase; rossmann fold, oxidoreductase; HET: 93.89
2yut_A207 Putative short-chain oxidoreductase; alpha and bet 93.88
2z1m_A 345 GDP-D-mannose dehydratase; short-chain dehydrogena 93.86
1y1p_A 342 ARII, aldehyde reductase II; rossmann fold, short 93.84
3ec7_A 357 Putative dehydrogenase; alpha-beta, structural gen 93.79
1sui_A247 Caffeoyl-COA O-methyltransferase; rossmann fold, p 93.76
2nac_A393 NAD-dependent formate dehydrogenase; oxidoreductas 93.73
2fr1_A486 Erythromycin synthase, eryai; short chain dehydrog 93.68
3jtm_A351 Formate dehydrogenase, mitochondrial; mitochondrio 93.66
3btv_A 438 Galactose/lactose metabolism regulatory protein GA 93.66
2dkn_A255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 93.61
3slg_A 372 PBGP3 protein; structural genomics, seattle struct 93.6
1uay_A242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 93.6
3dr5_A221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 93.59
3ius_A 286 Uncharacterized conserved protein; APC63810, silic 93.58
2cmg_A262 Spermidine synthase; transferase, putrescine amino 93.57
3d7l_A202 LIN1944 protein; APC89317, structural genomics, PS 93.57
1ydw_A 362 AX110P-like protein; structural genomics, protein 93.56
2a9f_A398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 93.54
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 93.52
3i23_A 349 Oxidoreductase, GFO/IDH/MOCA family; structural ge 93.52
2ho3_A 325 Oxidoreductase, GFO/IDH/MOCA family; streptococcus 93.51
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protei 93.5
2gcg_A330 Glyoxylate reductase/hydroxypyruvate reductase; NA 93.49
4e4y_A244 Short chain dehydrogenase family protein; structur 93.46
3dli_A240 Methyltransferase; PSI-II, NYSGXRC, structural gen 93.46
3fhl_A 362 Putative oxidoreductase; NAD-binding domain, PSI-2 93.46
1p9l_A245 Dihydrodipicolinate reductase; oxidoreductase, lys 93.44
3gg9_A352 D-3-phosphoglycerate dehydrogenase oxidoreductase; 93.42
2et6_A 604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 93.41
4e21_A 358 6-phosphogluconate dehydrogenase (decarboxylating; 93.37
3mgg_A276 Methyltransferase; NYSGXRC, PSI-II, protein struct 93.37
3dxy_A218 TRNA (guanine-N(7)-)-methyltransferase; rossmann f 93.37
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Back     alignment and structure
Probab=100.00  E-value=2.6e-60  Score=438.06  Aligned_cols=345  Identities=40%  Similarity=0.653  Sum_probs=310.2

Q ss_pred             chhcceeEEEecCCceEEEEecCC--------CCCCCcEEEEEeeeeeCcccHhhhhccccCCccCCCCcccCccceEEE
Q 017868           14 GEEVNMAAWLLGVNTLKIQPFELP--------SLGPYDVLVRMKAVGICGSDVHYLKTLRCADFVVKEPMVIGHECAGVI   85 (365)
Q Consensus        14 ~~~~~~~~~~~~~~~l~~~~~~~p--------~~~~~eVlI~v~~~~l~~~D~~~~~g~~~~~~~~~~p~~~G~e~~G~V   85 (365)
                      ++++|+++++.+++.+++.++|.|        +|+++||+|||.++++|++|++.+.+...+.....+|.++|||++|+|
T Consensus         5 ~~~~mka~~~~~~~~l~~~~~~~P~~~~~~~~~~~~~eVlVkv~a~gi~~~D~~~~~~~~~~~~~~~~p~v~G~E~~G~V   84 (363)
T 3m6i_A            5 ASKTNIGVFTNPQHDLWISEASPSLESVQKGEELKEGEVTVAVRSTGICGSDVHFWKHGCIGPMIVECDHVLGHESAGEV   84 (363)
T ss_dssp             CCSCCEEEEECTTCCEEEEECSSCHHHHHHTCSCCTTEEEEEEEEEECCHHHHHHHHHSBSSSCBCCSCEECCCEEEEEE
T ss_pred             CcccceeEEEeCCCcEEEEEecCCccccccCCCcCCCeEEEEEeEEeecHhhHHHHcCCCCCCccCCCCcccCcceEEEE
Confidence            557799999999999999999999        999999999999999999999988865444444577999999999999


Q ss_pred             EEeCCCCCCCCCCCEEEEcCCcCCCCCccccCCCCCCCCCccccccCCCCcceeeEEeecCCceEECCCCCCcchhccch
Q 017868           86 EKVGSEVKTLVPGDRVALEPGISCWRCDHCKGGRYNLCPEMKFFATPPVHGSLANQVVHPADLCFKLPDNVSLEEGAMCE  165 (365)
Q Consensus        86 ~~vG~~v~~~~~Gd~V~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~v~~~~~~~iP~~~~~~~a~~~~  165 (365)
                      +++|++|++|++||||++.+..+|++|.+|+.+.+++|.+..+.+....+|+|+||+++++++++++|+ +++++|+++.
T Consensus        85 ~~vG~~v~~~~vGdrV~~~~~~~cg~C~~c~~g~~~~c~~~~~~g~~~~~G~~aey~~v~~~~~~~iP~-~s~~~aa~~~  163 (363)
T 3m6i_A           85 IAVHPSVKSIKVGDRVAIEPQVICNACEPCLTGRYNGCERVDFLSTPPVPGLLRRYVNHPAVWCHKIGN-MSYENGAMLE  163 (363)
T ss_dssp             EEECTTCCSCCTTCEEEECCEECCSCSHHHHTTCGGGCTTCEETTSTTSCCSCBSEEEEEGGGEEECTT-CCHHHHHHHH
T ss_pred             EEECCCCCCCCCCCEEEEecccCCCCCHHHHCcCcccCCCccccCCCCCCccceeEEEEehhhEEECCC-CCHHHHHhhh
Confidence            999999999999999999999999999999999999999998888766789999999999999999999 9999999888


Q ss_pred             hhHHHHHHHHhcCCCCCCEEEEEcCCHHHHHHHHHHHHHCCCCeEEEEeCChhHHHHHHHcCCCEEEeCCC---CcccHH
Q 017868          166 PLSVGLHACRRANIGPETNVLIMGAGPIGLVTMLGAPRAFGAPRIVIVDVDDYRLSVAKEIGADNIVKVST---NLQDIA  242 (365)
Q Consensus       166 ~~~~a~~~~~~~~~~~g~~vlI~G~g~~G~~ai~~l~~~~g~~~vi~v~~~~~~~~~~~~~g~~~~~~~~~---~~~~~~  242 (365)
                      +++|||++++.+++++|++|||+|+|++|++++| +++.+|+++|++++++++|.++++++ ++.++++..   ..+++.
T Consensus       164 ~~~ta~~~l~~~~~~~g~~VlV~GaG~vG~~aiq-lak~~Ga~~Vi~~~~~~~~~~~a~~l-~~~~~~~~~~~~~~~~~~  241 (363)
T 3m6i_A          164 PLSVALAGLQRAGVRLGDPVLICGAGPIGLITML-CAKAAGACPLVITDIDEGRLKFAKEI-CPEVVTHKVERLSAEESA  241 (363)
T ss_dssp             HHHHHHHHHHHHTCCTTCCEEEECCSHHHHHHHH-HHHHTTCCSEEEEESCHHHHHHHHHH-CTTCEEEECCSCCHHHHH
T ss_pred             HHHHHHHHHHHcCCCCCCEEEEECCCHHHHHHHH-HHHHcCCCEEEEECCCHHHHHHHHHh-chhcccccccccchHHHH
Confidence            8999999998899999999999999999999999 99999997799999999999999999 766555432   235666


Q ss_pred             HHHHHHHHHhCCCceEEEeCCCCHHHHHHHHHhcccCCEEEEEccCCCCccccchHhhhcCcEEEeecccCCcHHHHHHH
Q 017868          243 EEVEKIQKAMGTGIDVSFDCAGLNKTMSTALGATCAGGKVCLVGMGHHEMTVPLTPAAVREVDVVGVFRYKNTWPLCLEL  322 (365)
Q Consensus       243 ~~i~~~~~~~~~~~d~vid~~g~~~~~~~~~~~l~~~G~~~~~g~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~  322 (365)
                      +.+++.+  .+.++|+|||++|.+..+..++++|+++|+++.+|.......++...+..+++++.+++.+.+.+++++++
T Consensus       242 ~~v~~~t--~g~g~Dvvid~~g~~~~~~~~~~~l~~~G~iv~~G~~~~~~~~~~~~~~~~~~~i~g~~~~~~~~~~~~~l  319 (363)
T 3m6i_A          242 KKIVESF--GGIEPAVALECTGVESSIAAAIWAVKFGGKVFVIGVGKNEIQIPFMRASVREVDLQFQYRYCNTWPRAIRL  319 (363)
T ss_dssp             HHHHHHT--SSCCCSEEEECSCCHHHHHHHHHHSCTTCEEEECCCCCSCCCCCHHHHHHHTCEEEECCSCSSCHHHHHHH
T ss_pred             HHHHHHh--CCCCCCEEEECCCChHHHHHHHHHhcCCCEEEEEccCCCCccccHHHHHhcCcEEEEccCCHHHHHHHHHH
Confidence            6666654  26799999999998878899999999999999999766655666777899999999998888899999999


Q ss_pred             HHcCCCCCCCceEEEecCChhhHHHHHHHHhcC-CCceEEEEeC
Q 017868          323 LRSGKIDVKPLVTHRFGFSQKEVEEAFETSARG-GTAIKVMFNL  365 (365)
Q Consensus       323 l~~g~~~~~~~~~~~~~~~~~~~~~a~~~~~~~-~~~gk~vi~~  365 (365)
                      +++|++.+.+.++++|+|  +++.+|++.++++ ...+|+||++
T Consensus       320 ~~~g~i~~~~~i~~~~~l--~~~~~A~~~~~~~~~~~~Kvvi~~  361 (363)
T 3m6i_A          320 VENGLVDLTRLVTHRFPL--EDALKAFETASDPKTGAIKVQIQS  361 (363)
T ss_dssp             HHTTSSCCGGGEEEEEEG--GGHHHHHHHHHCGGGCCSEEEEEC
T ss_pred             HHhCCCChHHceeeeeeH--HHHHHHHHHHhccCCCeEEEEEec
Confidence            999999888889999999  9999999999987 6889999874



>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Back     alignment and structure
>4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Back     alignment and structure
>3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* Back     alignment and structure
>2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Back     alignment and structure
>1h2b_A Alcohol dehydrogenase; oxidoreductase, archaea, hyperthermophIle, zinc; HET: OCA NAJ; 1.62A {Aeropyrum pernix} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* Back     alignment and structure
>1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Back     alignment and structure
>2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... Back     alignment and structure
>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A Back     alignment and structure
>2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* Back     alignment and structure
>1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>4eez_A Alcohol dehydrogenase 1; site-saturation mutagenesis, directed evolution, isobutyraldehyde, biofuel, oxidoreductase; HET: PG4; 1.90A {Lactococcus lactis subsp} PDB: 4eex_A* Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Back     alignment and structure
>1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A Back     alignment and structure
>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Back     alignment and structure
>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Back     alignment and structure
>3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A Back     alignment and structure
>4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Back     alignment and structure
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Back     alignment and structure
>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Back     alignment and structure
>4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} Back     alignment and structure
>3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} Back     alignment and structure
>3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} Back     alignment and structure
>3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} Back     alignment and structure
>3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* Back     alignment and structure
>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Back     alignment and structure
>3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} Back     alignment and structure
>4a27_A Synaptic vesicle membrane protein VAT-1 homolog-L; oxidoreductase; 2.10A {Homo sapiens} Back     alignment and structure
>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Back     alignment and structure
>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1zsy_A Mitochondrial 2-enoyl thioester reductase; medium-chain dehydrogenase/reductase, oxidoreductase, 2-ENOY thioester reductase; 1.75A {Homo sapiens} PDB: 2vcy_A Back     alignment and structure
>1gu7_A Enoyl-[acyl-carrier-protein] reductase [NADPH, B-specific] 1,mitochondrial; oxidoreductase, thioester reduction, fatty acids; 1.70A {Candida tropicalis} SCOP: b.35.1.2 c.2.1.1 PDB: 1guf_A* 1n9g_B* 1n9g_A* 1gyr_A 1h0k_A Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Back     alignment and structure
>3nx4_A Putative oxidoreductase; csgid, structural genomics, center for struc genomics of infectious diseases, PSI, protein structure INI; HET: MSE NAP; 1.90A {Salmonella enterica subsp} PDB: 1o89_A 1o8c_A* Back     alignment and structure
>2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} Back     alignment and structure
>1tt7_A YHFP; alcohol dehydrogenase, Zn-dependent, NAD, structural genomics, protein structure initiative, PSI; 2.70A {Bacillus subtilis} SCOP: b.35.1.2 c.2.1.1 PDB: 1y9e_A* Back     alignment and structure
>3iup_A Putative NADPH:quinone oxidoreductase; YP_296108.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE NDP; 1.70A {Ralstonia eutropha} Back     alignment and structure
>2zb4_A Prostaglandin reductase 2; rossmann fold, alternative splicing, cytoplasm, NADP, oxidoreductase; HET: NAP 5OP; 1.63A {Homo sapiens} PDB: 2zb7_A* 2zb8_A* 2w98_A* 2vna_A* 2w4q_A* 1vj1_A 2zb3_A* Back     alignment and structure
>1xa0_A Putative NADPH dependent oxidoreductases; structural genomics, protein structure initiative, MCSG; HET: DTY; 2.80A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Back     alignment and structure
>2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* Back     alignment and structure
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Back     alignment and structure
>3cea_A MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreductase FA NAD-binding rossmann fold, structural genomics; HET: NAD; 2.40A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>1nvm_B Acetaldehyde dehydrogenase (acylating), 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Back     alignment and structure
>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Back     alignment and structure
>3e18_A Oxidoreductase; dehydrogenase, NAD-binding, structural genom protein structure initiative, PSI, NEW YORK structural GENO research consortium; HET: NAD; 1.95A {Listeria innocua} Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>4had_A Probable oxidoreductase protein; structural genomics, protein structure initiative, nysgrc, PSI-biology; 2.00A {Rhizobium etli} Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Back     alignment and structure
>2ph5_A Homospermidine synthase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: NAD; 2.50A {Legionella pneumophila subsp} Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Back     alignment and structure
>4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>4hkt_A Inositol 2-dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium, oxidoreductase; HET: MSE; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Back     alignment and structure
>3rc1_A Sugar 3-ketoreductase; sugar biosynthesis, TDP binding, NADP binding binding protein; HET: TLO NAP; 1.71A {Actinomadura kijaniata} PDB: 3rbv_A* 3rc2_A* 3rcb_A* 3rc7_A* 3rc9_A* Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Back     alignment and structure
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Back     alignment and structure
>3ezy_A Dehydrogenase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.04A {Thermotoga maritima} Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>2glx_A 1,5-anhydro-D-fructose reductase; NADP(H) dependent reductase, rossmann-fold, sugar metabolism, 1,5-anhydro-D-mannitol, oxidoreductase; HET: NDP; 2.20A {Ensifer adhaerens} Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>3q2i_A Dehydrogenase; rossmann fold, UDP-sugar binding, NAD binding oxidoreductase; HET: NAD HP7; 1.50A {Chromobacterium violaceum} PDB: 3q2k_A* Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A* Back     alignment and structure
>1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Back     alignment and structure
>3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3v1t_C 3v1u_A* 4fw8_A* 3q6i_A* 3m1l_A Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Back     alignment and structure
>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>3db2_A Putative NADPH-dependent oxidoreductase; two domain protein, rossman fold, putative dehydrogenase, ST genomics; 1.70A {Desulfitobacterium hafniense dcb-2} Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Back     alignment and structure
>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 Back     alignment and structure
>3e9m_A Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis} Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* Back     alignment and structure
>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Back     alignment and structure
>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* Back     alignment and structure
>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Back     alignment and structure
>3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, MYO-inosi dehydrogenase, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum} Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* Back     alignment and structure
>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 Back     alignment and structure
>3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} Back     alignment and structure
>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Back     alignment and structure
>4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens} Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Back     alignment and structure
>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Back     alignment and structure
>4fb5_A Probable oxidoreductase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, GFO/IDH/MOCA family; 2.61A {Rhizobium etli} Back     alignment and structure
>1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Back     alignment and structure
>3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Back     alignment and structure
>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Back     alignment and structure
>3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Back     alignment and structure
>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Back     alignment and structure
>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* Back     alignment and structure
>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>4gqa_A NAD binding oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: MSE; 2.42A {Klebsiella pneumoniae} Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* Back     alignment and structure
>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Back     alignment and structure
>1zh8_A Oxidoreductase; TM0312, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI; HET: MSE NAP; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A* Back     alignment and structure
>2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>3evn_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics; 2.00A {Streptococcus agalactiae serogroup V} Back     alignment and structure
>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* Back     alignment and structure
>2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 Back     alignment and structure
>1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Back     alignment and structure
>3s8m_A Enoyl-ACP reductase; rossmann fold, oxidoreductase, NADH binding, fatty acid SYNT enoyl-ACP; 1.60A {Xanthomonas oryzae PV} Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* Back     alignment and structure
>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} Back     alignment and structure
>3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>3ohs_X Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; dimeric dihydrodiol dehydrogenase, MDD, oxidoreductase; 1.90A {Macaca fascicularis} PDB: 2o48_X 2poq_X* 2o4u_X Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>2ixa_A Alpha-N-acetylgalactosaminidase; NAD, A-ECO conversion, hydrolase; HET: NAD; 2.3A {Flavobacterium meningosepticum} PDB: 2ixb_A* Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* Back     alignment and structure
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* Back     alignment and structure
>2z5l_A Tylkr1, tylactone synthase starter module and modules 1 & 2; short-chain dehydrogenase/reductase, rossman fold; 1.95A {Streptomyces fradiae} Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Back     alignment and structure
>1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>3zu3_A Putative reductase YPO4104/Y4119/YP_4011; oxidoreductase, fatty acid biosynthesis II, short-chain dehydrogenase reductase superfamily; HET: NAI; 1.80A {Yersinia pestis} PDB: 3zu4_A* 3zu5_A* 3zu2_A* Back     alignment and structure
>2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} Back     alignment and structure
>3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* Back     alignment and structure
>3qp9_A Type I polyketide synthase pikaii; rossmann fold, ketoreductase, epimerization, oxidoreductase; 1.88A {Streptomyces venezuelae} Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Back     alignment and structure
>3moi_A Probable dehydrogenase; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics; 2.50A {Bordetella bronchiseptica} Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Back     alignment and structure
>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 Back     alignment and structure
>4h3v_A Oxidoreductase domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 1.68A {Kribbella flavida} Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Back     alignment and structure
>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* Back     alignment and structure
>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} Back     alignment and structure
>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A Back     alignment and structure
>2nvw_A Galactose/lactose metabolism regulatory protein GAL80; transcription, galactose metabolism, repressor; 2.10A {Kluyveromyces lactis} SCOP: c.2.1.3 d.81.1.5 PDB: 3e1k_A Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Back     alignment and structure
>3e82_A Putative oxidoreductase; NAD, GFO/IDH/MOCA family, PSI-2, NYSGXRC, 11136F, structural genomics, protein structure initiative; 2.04A {Klebsiella pneumoniae subsp} Back     alignment and structure
>4ggo_A Trans-2-enoyl-COA reductase; rossmann fold, oxidoreductase; 2.00A {Treponema denticola atcc 35405} PDB: 4ggp_A Back     alignment and structure
>4eue_A Putative reductase CA_C0462; TER, biofuel, synthetic biology, catalytic mechan substrate specificity, oxidoreductase; HET: NAI; 2.00A {Clostridium acetobutylicum} PDB: 4euf_A* 4euh_A* Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} Back     alignment and structure
>3kux_A Putative oxidoreductase; oxidoreductase family, csgid, structural genomics, center FO structural genomics of infectious diseases; HET: MSE; 2.75A {Yersinia pestis} Back     alignment and structure
>3hdj_A Probable ornithine cyclodeaminase; APC62486, bordetella pertussis TOH structural genomics, PSI-2, protein structure initiative; 1.70A {Bordetella pertussis} Back     alignment and structure
>3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} Back     alignment and structure
>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* Back     alignment and structure
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Back     alignment and structure
>3gdo_A Uncharacterized oxidoreductase YVAA; structural genomics, putative oxidoreductase YVAA, oxidoredu PSI-2, protein structure initiative; 2.03A {Bacillus subtilis subsp} PDB: 3gfg_A Back     alignment and structure
>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} Back     alignment and structure
>3mz0_A Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; MYO-inositol dehydrogenase, bsidh, oxidoreductase; HET: MSE PGE; 1.54A {Bacillus subtilis} PDB: 3nt2_A* 3nt4_A* 3nt5_A* 3nto_A* 3ntq_A* 3ntr_A* Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} Back     alignment and structure
>3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus} Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>3ec7_A Putative dehydrogenase; alpha-beta, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; HET: MSE NAD EPE; 2.15A {Salmonella typhimurium} Back     alignment and structure
>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* Back     alignment and structure
>2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A Back     alignment and structure
>2fr1_A Erythromycin synthase, eryai; short chain dehydrogenase/reductase, oxidoreductase; HET: NDP; 1.79A {Saccharopolyspora erythraea} SCOP: c.2.1.2 c.2.1.2 PDB: 2fr0_A* Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Back     alignment and structure
>3btv_A Galactose/lactose metabolism regulatory protein GAL80; eukaryotic transcription repressor, acetylation, carbohydrate metabolism; 2.10A {Saccharomyces cerevisiae} PDB: 3bts_A 3v2u_A* 3btu_A Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Back     alignment and structure
>1ydw_A AX110P-like protein; structural genomics, protein structure initiative, center for eukaryotic structural genomics, CESG, AT4G09670; 2.49A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.5 PDB: 2q4e_A Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>3i23_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.30A {Enterococcus faecalis} PDB: 3fd8_A* 3hnp_A Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Back     alignment and structure
>3fhl_A Putative oxidoreductase; NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 1.93A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>1p9l_A Dihydrodipicolinate reductase; oxidoreductase, lysine biosynthesis, NADH binding specificity, TB structural genomics consortium; HET: NAD PDC PG4; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 PDB: 1c3v_A* 1yl5_A 1yl7_A* 1yl6_A* Back     alignment and structure
>3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Back     alignment and structure
>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 365
d1pl8a1185 b.35.1.2 (A:1-145,A:317-356) Ketose reductase (sor 4e-37
d1pl8a2171 c.2.1.1 (A:146-316) Ketose reductase (sorbitol deh 1e-33
d1e3ja2170 c.2.1.1 (A:143-312) Ketose reductase (sorbitol deh 4e-30
d1e3ja1178 b.35.1.2 (A:4-142,A:313-351) Ketose reductase (sor 5e-30
d1p0fa1198 b.35.1.2 (A:1001-1163,A:1338-1372) Alcohol dehydro 9e-26
d1piwa1192 b.35.1.2 (A:1-152,A:321-360) Cinnamyl alcohol dehy 4e-25
d1kola1201 b.35.1.2 (A:2-160,A:356-397) Formaldehyde dehydrog 1e-24
d1cdoa1199 b.35.1.2 (A:1-164,A:340-374) Alcohol dehydrogenase 3e-22
d1vj0a1184 b.35.1.2 (A:2-155,A:338-367) Hypothetical protein 5e-22
d1llua1175 b.35.1.2 (A:2-143,A:310-342) Alcohol dehydrogenase 2e-21
d1rjwa1171 b.35.1.2 (A:1-137,A:306-339) Alcohol dehydrogenase 3e-21
d2fzwa1197 b.35.1.2 (A:1-162,A:339-373) Alcohol dehydrogenase 5e-21
d1e3ia1202 b.35.1.2 (A:1-167,A:342-376) Alcohol dehydrogenase 5e-21
d1jvba1177 b.35.1.2 (A:1-143,A:314-347) Alcohol dehydrogenase 8e-21
d1jqba1177 b.35.1.2 (A:1001-1139,A:1314-1351) Bacterial secon 3e-20
d1uufa1179 b.35.1.2 (A:3-144,A:313-349) Hypothetical protein 4e-20
d1h2ba1171 b.35.1.2 (A:17-154,A:327-359) Alcohol dehydrogenas 2e-19
d2jhfa1198 b.35.1.2 (A:1-163,A:340-374) Alcohol dehydrogenase 3e-17
d1f8fa1194 b.35.1.2 (A:4-162,A:337-371) Benzyl alcohol dehydr 1e-16
d1kola2195 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Ps 8e-13
d1jqba2174 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol 4e-12
d1f8fa2174 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase { 4e-12
d1vj0a2182 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {T 3e-10
d1tt7a1162 b.35.1.2 (A:2-127,A:295-330) Hypothetical protein 6e-10
d1cdoa2175 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Ga 2e-09
d2jhfa2176 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse ( 2e-09
d1xa0a1152 b.35.1.2 (A:1-118,A:295-328) B. subtilis YhfP homo 4e-09
d1h2ba2172 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeo 5e-09
d1p0fa2174 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog 5e-09
d1e3ia2174 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse ( 9e-09
d2fzwa2176 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human ( 1e-08
d1d1ta2176 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human ( 2e-08
d1rjwa2168 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillu 2e-07
d1o89a1146 b.35.1.2 (A:1-115,A:293-323) Hypothetical protein 1e-06
d1llua2166 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudom 1e-06
d1jvba2170 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeo 5e-06
d1piwa2168 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase 8e-06
d1gu7a1175 b.35.1.2 (A:23-160,A:350-386) 2,4-dienoyl-CoA redu 8e-05
d1qora1147 b.35.1.2 (A:2-112,A:292-327) Quinone oxidoreductas 9e-05
d1uufa2168 c.2.1.1 (A:145-312) Hypothetical protein YahK {Esc 3e-04
d1yb5a1150 b.35.1.2 (A:6-120,A:295-329) Quinone oxidoreductas 9e-04
d2d1ya1248 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {T 0.001
d1iz0a1131 b.35.1.2 (A:1-98,A:270-302) Quinone oxidoreductase 0.002
>d1pl8a1 b.35.1.2 (A:1-145,A:317-356) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Length = 185 Back     information, alignment and structure

class: All beta proteins
fold: GroES-like
superfamily: GroES-like
family: Alcohol dehydrogenase-like, N-terminal domain
domain: Ketose reductase (sorbitol dehydrogenase)
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  130 bits (327), Expect = 4e-37
 Identities = 78/177 (44%), Positives = 104/177 (58%), Gaps = 2/177 (1%)

Query: 18  NMAAWLLGVNTLKIQPFELPSLGPYDVLVRMKAVGICGSDVHYLKTLRCADFVVKEPMVI 77
           N++  + G   L+++ + +P  GP +VL+RM +VGICGSDVHY +  R  +F+VK+PMV+
Sbjct: 8   NLSLVVHGPGDLRLENYPIPEPGPNEVLLRMHSVGICGSDVHYWEYGRIGNFIVKKPMVL 67

Query: 78  GHECAGVIEKVGSEVKTLVPGDRVALEPGISCWRCDHCKGGRYNLCPEMKFFATPPVHGS 137
           GHE +G +EKVGS VK L PGDRVA+EPG      + CK GRYNL P + F ATPP  G+
Sbjct: 68  GHEASGTVEKVGSSVKHLKPGDRVAIEPGAPRENDEFCKMGRYNLSPSIFFCATPPDDGN 127

Query: 138 LANQVVHPADLCFKLPDNVSLEEGAMCEPLSVGLHACRRANIGPETNVLIMGAGPIG 194
           L     H A  C+KLPDNV         PL   L A      G    +++    P  
Sbjct: 128 LCRFYKHNAAFCYKLPDNVKPLV-THRFPLEKALEAFETFKKGLGLKIML-KCDPSD 182


>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Length = 171 Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Length = 170 Back     information, alignment and structure
>d1e3ja1 b.35.1.2 (A:4-142,A:313-351) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Length = 178 Back     information, alignment and structure
>d1p0fa1 b.35.1.2 (A:1001-1163,A:1338-1372) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Length = 198 Back     information, alignment and structure
>d1piwa1 b.35.1.2 (A:1-152,A:321-360) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 192 Back     information, alignment and structure
>d1kola1 b.35.1.2 (A:2-160,A:356-397) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Length = 201 Back     information, alignment and structure
>d1cdoa1 b.35.1.2 (A:1-164,A:340-374) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Length = 199 Back     information, alignment and structure
>d1vj0a1 b.35.1.2 (A:2-155,A:338-367) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Length = 184 Back     information, alignment and structure
>d1llua1 b.35.1.2 (A:2-143,A:310-342) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Length = 175 Back     information, alignment and structure
>d1rjwa1 b.35.1.2 (A:1-137,A:306-339) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 171 Back     information, alignment and structure
>d2fzwa1 b.35.1.2 (A:1-162,A:339-373) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Length = 197 Back     information, alignment and structure
>d1e3ia1 b.35.1.2 (A:1-167,A:342-376) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Length = 202 Back     information, alignment and structure
>d1jvba1 b.35.1.2 (A:1-143,A:314-347) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 177 Back     information, alignment and structure
>d1jqba1 b.35.1.2 (A:1001-1139,A:1314-1351) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Length = 177 Back     information, alignment and structure
>d1uufa1 b.35.1.2 (A:3-144,A:313-349) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Length = 179 Back     information, alignment and structure
>d1h2ba1 b.35.1.2 (A:17-154,A:327-359) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Length = 171 Back     information, alignment and structure
>d2jhfa1 b.35.1.2 (A:1-163,A:340-374) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Length = 198 Back     information, alignment and structure
>d1f8fa1 b.35.1.2 (A:4-162,A:337-371) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Length = 194 Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Length = 195 Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Length = 174 Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Length = 174 Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Length = 182 Back     information, alignment and structure
>d1tt7a1 b.35.1.2 (A:2-127,A:295-330) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Length = 162 Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Length = 175 Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Length = 176 Back     information, alignment and structure
>d1xa0a1 b.35.1.2 (A:1-118,A:295-328) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Length = 152 Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Length = 172 Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Length = 174 Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Length = 174 Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Length = 176 Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Length = 176 Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 168 Back     information, alignment and structure
>d1o89a1 b.35.1.2 (A:1-115,A:293-323) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Length = 146 Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Length = 166 Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 170 Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 168 Back     information, alignment and structure
>d1gu7a1 b.35.1.2 (A:23-160,A:350-386) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Length = 175 Back     information, alignment and structure
>d1qora1 b.35.1.2 (A:2-112,A:292-327) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Length = 147 Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Length = 168 Back     information, alignment and structure
>d1yb5a1 b.35.1.2 (A:6-120,A:295-329) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Length = 150 Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Length = 248 Back     information, alignment and structure
>d1iz0a1 b.35.1.2 (A:1-98,A:270-302) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Length = 131 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query365
d1e3ja1178 Ketose reductase (sorbitol dehydrogenase) {Silverl 100.0
d1pl8a1185 Ketose reductase (sorbitol dehydrogenase) {Human ( 100.0
d1h2ba1171 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 100.0
d1llua1175 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 100.0
d1cdoa1199 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 100.0
d1vj0a1184 Hypothetical protein TM0436 {Thermotoga maritima [ 100.0
d1f8fa1194 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 100.0
d1e3ia1202 Alcohol dehydrogenase {Mouse (Mus musculus), class 99.98
d1piwa1192 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 99.98
d1jvba1177 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 99.98
d2fzwa1197 Alcohol dehydrogenase {Human (Homo sapiens), diffe 99.98
d1rjwa1171 Alcohol dehydrogenase {Bacillus stearothermophilus 99.97
d1kola1201 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 99.97
d1p0fa1198 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 99.97
d1jqba1177 Bacterial secondary alcohol dehydrogenase {Clostri 99.97
d1uufa1179 Hypothetical protein YahK {Escherichia coli [TaxId 99.97
d2jhfa1198 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 99.96
d1yb5a1150 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 99.96
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 99.96
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 99.96
d1qora1147 Quinone oxidoreductase {Escherichia coli [TaxId: 5 99.94
d1xa0a1152 B. subtilis YhfP homologue {Bacillus stearothermop 99.93
d1iz0a1131 Quinone oxidoreductase {Thermus thermophilus [TaxI 99.93
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 99.92
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 99.92
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 99.92
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 99.91
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 99.91
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 99.91
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 99.91
d1o89a1146 Hypothetical protein YhdH {Escherichia coli [TaxId 99.91
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 99.9
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 99.9
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 99.9
d1gu7a1175 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 99.9
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 99.9
d1tt7a1162 Hypothetical protein YhfP {Bacillus subtilis [TaxI 99.9
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 99.89
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 99.89
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 99.89
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 99.88
d1gu7a2189 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 99.88
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 99.88
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 99.87
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 99.87
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 99.87
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 99.87
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 99.87
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 99.87
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 99.83
d1o89a2177 Hypothetical protein YhdH {Escherichia coli [TaxId 99.77
d1tt7a2167 Hypothetical protein YhfP {Bacillus subtilis [TaxI 99.76
d1vj1a1166 Putative zinc-binding alcohol dehydrogenase {Mouse 99.66
d1v3va1147 Leukotriene b4 12-hydroxydehydrogenase/prostagland 99.65
d1o8ca277 Hypothetical protein YhdH {Escherichia coli [TaxId 99.35
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 97.6
d1jg1a_215 Protein-L-isoaspartyl O-methyltransferase {Archaeo 97.56
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 97.54
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 97.53
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 97.47
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 97.43
d1yb2a1250 Hypothetical protein Ta0852 {Thermoplasma acidophi 97.32
d1o54a_266 Hypothetical protein TM0748 {Thermotoga maritima [ 97.31
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 97.29
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 97.17
d1wmaa1275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 97.14
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 97.13
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 97.13
d1vbfa_224 Protein-L-isoaspartyl O-methyltransferase {Sulfolo 97.1
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 97.06
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 97.03
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 97.03
d1i1na_224 Protein-L-isoaspartyl O-methyltransferase {Human ( 97.02
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 97.02
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 96.92
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 96.92
d1i9ga_264 Probable methyltransferase Rv2118c {Mycobacterium 96.88
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 96.87
d1kpia_291 CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} 96.86
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 96.84
d1kpga_285 CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} 96.82
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 96.78
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 96.77
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 96.73
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 96.73
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 96.72
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 96.69
d2fk8a1280 Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri 96.66
d1r18a_223 Protein-L-isoaspartyl O-methyltransferase {Fruit f 96.65
d2b25a1324 Hypothetical protein FLJ20628 {Human (Homo sapiens 96.65
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 96.65
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 96.63
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 96.59
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 96.59
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 96.59
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 96.58
d1bdba_276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 96.58
d1dhra_236 Dihydropteridin reductase (pteridine reductase) {R 96.49
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 96.48
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 96.47
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 96.44
d1yo6a1250 Putative carbonyl reductase sniffer {Caenorhabditi 96.42
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 96.4
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 96.39
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 96.38
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 96.38
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 96.36
d1nkva_245 Hypothetical Protein YjhP {Escherichia coli [TaxId 96.34
d1o5ia_234 beta-keto acyl carrier protein reductase {Thermoto 96.33
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 96.32
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 96.31
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 96.31
d1yxma1297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 96.28
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 96.26
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 96.22
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 96.19
d1xxla_234 Hypothetical protein YcgJ {Bacillus subtilis [TaxI 96.18
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 96.15
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 96.15
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 96.14
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 96.12
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 96.12
d2avna1246 Hypothetical methyltransferase TM1389 {Thermotoga 96.11
d1ooea_235 Dihydropteridin reductase (pteridine reductase) {N 96.04
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 96.04
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 96.01
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 96.01
d1vl5a_231 Hypothetical protein BH2331 {Bacillus halodurans [ 96.01
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 95.99
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 95.97
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 95.96
d2fr1a1259 Erythromycin synthase, eryAI, 1st ketoreductase mo 95.91
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 95.9
d1nw3a_328 Catalytic, N-terminal domain of histone methyltran 95.86
d1edoa_244 beta-keto acyl carrier protein reductase {Oil seed 95.84
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 95.78
d1gz6a_ 302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 95.71
d1snya_248 Carbonyl reductase sniffer {Fruit fly (Drosophila 95.7
d1zmta1252 Halohydrin dehalogenase HheC {Agrobacterium tumefa 95.69
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 95.65
d1u2za_406 Catalytic, N-terminal domain of histone methyltran 95.59
d2pd4a1274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 95.56
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 95.53
d2o57a1282 Putative sarcosine dimethylglycine methyltransfera 95.53
d2czca2172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 95.5
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 95.47
d1nt2a_209 Fibrillarin homologue {Archaeon Archaeoglobus fulg 95.4
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 95.38
d2bd0a1240 Bacterial sepiapterin reductase {Chlorobium tepidu 95.29
d1qsga_258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 95.21
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 95.06
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 94.97
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 94.9
d1cf2o1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 94.79
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 94.73
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 94.61
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 94.57
d1zx0a1229 Guanidinoacetate methyltransferase {Human (Homo sa 94.49
d1g8aa_227 Fibrillarin homologue {Archaeon Pyrococcus horikos 94.44
d1b7go1178 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 94.41
d1ve3a1226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 94.32
d2as0a2324 Hypothetical protein PH1915, middle and C-terminal 94.3
d1yl7a1135 Dihydrodipicolinate reductase {Mycobacterium tuber 94.21
d1g8sa_230 Fibrillarin homologue {Archaeon Methanococcus jann 94.2
d1nvmb1157 Acetaldehyde dehydrogenase (acylating) {Pseudomona 94.16
d1oaaa_259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 94.11
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 94.1
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 93.83
d2h7ma1268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 93.82
d1wzna1251 Hypothetical methyltransferase PH1305 {Archaeon Py 93.76
d1iy9a_274 Spermidine synthase {Bacillus subtilis [TaxId: 142 93.74
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 93.68
d1jbqa_355 Cystathionine beta-synthase {Human (Homo sapiens) 93.62
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 93.59
d1ydwa1184 Probable oxidoreductase At4g09670 {Thale cress (Ar 93.43
d1jtva_285 Human estrogenic 17beta-hydroxysteroid dehydrogena 93.37
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 93.34
d2b2ca1312 Spermidine synthase {Caenorhabditis elegans [TaxId 93.29
d1xj5a_290 Spermidine synthase {Thale cress (Arabidopsis thal 93.26
d1mxha_266 Dihydropteridin reductase (pteridine reductase) {T 93.22
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 93.05
d1inla_295 Spermidine synthase {Thermotoga maritima [TaxId: 2 92.97
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 92.93
d2o07a1285 Spermidine synthase {Human (Homo sapiens) [TaxId: 92.88
d1wxxa2318 Hypothetical protein TTHA1280, middle and C-termin 92.78
d2fyta1311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 92.7
d2i6ga1198 Putative methyltransferase TehB {Salmonella typhim 92.69
d2bhsa1292 O-acetylserine sulfhydrylase (Cysteine synthase) { 92.69
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 92.68
d1y1pa1 342 Aldehyde reductase II {Sporobolomyces salmonicolor 92.45
d2frna1260 Hypothetical protein PH0793 {Pyrococcus horikoshii 92.44
d1im8a_225 Hypothetical protein HI0319 (YecO) {Haemophilus in 92.24
d1uira_312 Spermidine synthase {Thermus thermophilus [TaxId: 92.19
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcu 92.15
d1orra_ 338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 92.12
d2b78a2317 Hypothetical protein SMu776, middle and C-terminal 92.03
d1udca_ 338 Uridine diphosphogalactose-4-epimerase (UDP-galact 92.0
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 91.92
d1r0ka2150 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Z 91.9
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 91.87
d1zh8a1181 Hypothetical protein TM0312 {Thermotoga maritima [ 91.86
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 91.83
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 91.79
d1e7wa_284 Dihydropteridin reductase (pteridine reductase) {L 91.78
d1ri5a_252 mRNA cap (Guanine N-7) methyltransferase {Fungus ( 91.77
d1y7la1310 O-acetylserine sulfhydrylase (Cysteine synthase) { 91.68
d2fcaa1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil 91.59
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 91.48
d1rkxa_ 356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 91.48
d1oria_316 Protein arginine N-methyltransferase 1, PRMT1 {Rat 91.37
d1xeaa1167 Putative oxidoreductase VCA1048 {Vibrio cholerae [ 91.35
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 91.21
d1y8ca_246 Putative methyltransferase CAC2371 {Clostridium ac 91.19
d1h6da1221 Glucose-fructose oxidoreductase, N-terminal domain 91.05
d1p91a_268 rRNA methyltransferase RlmA {Escherichia coli [Tax 90.96
d1i24a_ 393 Sulfolipid biosynthesis protein SQD1 {Thale cress 90.82
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 90.74
d1mjfa_276 Putative spermidine synthetase PF0127 (SpeE) {Arch 90.55
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 90.43
d1ne2a_197 Hypothetical protein Ta1320 {Archaeon Thermoplasma 90.4
d1fjha_257 3-alpha-hydroxysteroid dehydrogenase {Comamonas te 90.3
d1j5pa4132 Hypothetical protein TM1643 {Thermotoga maritima [ 90.26
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 90.22
d2p7ia1225 Hypothetical protein ECA1738 {Erwinia carotovora [ 90.22
d1tlta1164 Virulence factor MviM {Escherichia coli [TaxId: 56 90.17
d1g6q1_ 328 Arginine methyltransferase, HMT1 {Baker's yeast (S 90.15
d1leha1230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 90.03
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 89.9
d2gh1a1281 Methyltransferase BC2162 {Bacillus cereus [TaxId: 89.68
d1uaya_241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 89.68
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 89.53
d1qyda_ 312 Pinoresinol-lariciresinol reductase {Giant arborvi 89.44
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 89.29
d2ex4a1222 Adrenal gland protein AD-003 (C9orf32) {Human (Hom 89.21
d1id1a_153 Rck domain from putative potassium channel Kch {Es 89.18
d1xvaa_292 Glycine N-methyltransferase {Rat (Rattus norvegicu 89.02
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 88.98
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 88.86
d2c5aa1 363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 88.78
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 88.73
d1seza1 373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 88.53
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 88.27
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 88.21
d1f06a1170 Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb 88.1
d1wkva1382 O-acetylserine sulfhydrylase (Cysteine synthase) { 88.01
d1sqga2284 Ribosomal RNA small subunit methyltransferase B, R 87.96
d3c96a1 288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 87.95
d1z7wa1320 O-acetylserine sulfhydrylase (Cysteine synthase) { 87.89
d1fcja_302 O-acetylserine sulfhydrylase (Cysteine synthase) { 87.83
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 87.83
d1diha1162 Dihydrodipicolinate reductase {Escherichia coli [T 87.79
d1xtpa_254 Hypothetical protein Lmaj004091aaa (LmjF30.0810) { 87.78
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 87.68
d1omoa_320 Archaeal alanine dehydrogenase {Archaeon Archaeogl 87.59
d1v9la1242 Glutamate dehydrogenase {Pyrobaculum islandicum [T 87.58
d1n7ha_ 339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 87.43
d1vlma_208 Possible histamine N-methyltransferase TM1293 {The 87.2
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 87.1
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 87.08
d2blla1 342 Polymyxin resistance protein ArnA (PrmI) {Escheric 86.68
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 86.63
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 86.59
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 86.57
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 86.52
d1xgka_ 350 Negative transcriptional regulator NmrA {Aspergill 86.46
d2dula1 375 N(2),N(2)-dimethylguanosine tRNA methyltransferase 86.35
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 86.32
d1kewa_ 361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 86.31
d1qyca_ 307 Phenylcoumaran benzylic ether reductase {Loblolly 86.31
d1z45a2 347 Uridine diphosphogalactose-4-epimerase (UDP-galact 86.29
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 86.21
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 86.18
d2nvwa1237 Galactose/lactose metabolism regulatory protein GA 86.07
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 86.02
d1gtma1239 Glutamate dehydrogenase {Archaeon Pyrococcus furio 85.93
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 85.9
d1b5qa1 347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 85.64
d1ek6a_ 346 Uridine diphosphogalactose-4-epimerase (UDP-galact 85.44
d1dssg1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 85.41
d1u8fo1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 85.08
d1uh5a_ 329 Enoyl-ACP reductase {Malaria parasite (Plasmodium 84.89
d1db3a_ 357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 84.77
d1b26a1234 Glutamate dehydrogenase {Thermotoga maritima [TaxI 84.66
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 84.48
d1bgva1255 Glutamate dehydrogenase {Clostridium symbiosum [Ta 84.15
d1k0ia1 292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 84.11
d1jqea_280 Histamine methyltransferase {Human (Homo sapiens) 83.82
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 83.59
d1ixka_313 Hypothetical methyltransferase PH1374 {Archaeon Py 83.56
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 83.55
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 83.48
d1d7oa_ 297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 83.45
d2i76a2153 Hypothetical protein TM1727 {Thermotoga maritima [ 83.43
d1yzha1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep 83.42
d1tdja1331 Threonine deaminase {Escherichia coli [TaxId: 562] 83.35
d2iida1 370 L-aminoacid oxidase {Malayan pit viper (Calloselas 83.27
d1gy8a_ 383 Uridine diphosphogalactose-4-epimerase (UDP-galact 83.19
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 83.18
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 83.12
d1rpna_ 321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 83.03
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 83.02
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 83.01
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 82.99
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 82.95
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 82.84
d1hwxa1293 Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 82.83
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 82.82
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 82.55
d1p3ha_99 Chaperonin-10 (GroES) {Mycobacterium tuberculosis 82.46
d1q0qa2151 1-deoxy-D-xylulose-5-phosphate reductoisomerase {E 82.43
d1susa1227 Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicag 82.3
d2bi7a1 314 UDP-galactopyranose mutase, N-terminal domain {Kle 81.92
d1tw3a2253 Carminomycin 4-O-methyltransferase {Streptomyces p 81.86
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 81.74
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 81.65
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 81.44
d1ej0a_180 RNA methyltransferase FtsJ {Escherichia coli [TaxI 81.32
d1x7da_340 Ornithine cyclodeaminase {Pseudomonas putida [TaxI 81.16
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 81.12
d1gado1166 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 80.8
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 80.76
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 80.57
d2dw4a2 449 Lysine-specific histone demethylase 1, LSD1 {Human 80.52
d1obfo1173 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 80.3
d1o58a_293 O-acetylserine sulfhydrylase (Cysteine synthase) { 80.26
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 80.14
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 80.06
>d1e3ja1 b.35.1.2 (A:4-142,A:313-351) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
class: All beta proteins
fold: GroES-like
superfamily: GroES-like
family: Alcohol dehydrogenase-like, N-terminal domain
domain: Ketose reductase (sorbitol dehydrogenase)
species: Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]
Probab=100.00  E-value=1.3e-38  Score=260.71  Aligned_cols=173  Identities=46%  Similarity=0.820  Sum_probs=162.5

Q ss_pred             ceeEEEecCCceEEEEecCCCCCCCcEEEEEeeeeeCcccHhhhhccccCCccCCCCcccCccceEEEEEeCCCCCCCCC
Q 017868           18 NMAAWLLGVNTLKIQPFELPSLGPYDVLVRMKAVGICGSDVHYLKTLRCADFVVKEPMVIGHECAGVIEKVGSEVKTLVP   97 (365)
Q Consensus        18 ~~~~~~~~~~~l~~~~~~~p~~~~~eVlI~v~~~~l~~~D~~~~~g~~~~~~~~~~p~~~G~e~~G~V~~vG~~v~~~~~   97 (365)
                      +++++++++++|+++++|+|+|+++||||||.+++||++|++.+.+.........+|.++|||++|+|+++|+++++|++
T Consensus         2 ~maAVl~g~~~l~~~e~~~P~~~~~evlVkv~a~gic~sD~~~~~~~~~~~~~~~~p~i~GhE~~G~Vv~vG~~v~~~~~   81 (178)
T d1e3ja1           2 NLSAVLYKQNDLRLEQRPIPEPKEDEVLLQMAYVGICGSDVHYYEHGRIADFIVKDPMVIGHEASGTVVKVGKNVKHLKK   81 (178)
T ss_dssp             CEEEEEEETTEEEEEECCCCCCCTTEEEEEEEEEEECHHHHHHHHHSBSSSCBCCSCEECCCEEEEEEEEECTTCCSCCT
T ss_pred             ceEEEEEcCCcEEEEEeECCCCCCCEEEEEEEEEcccCchhhhhccCccccccccCCeeeccccceEEEecCcccCCCCC
Confidence            67888899999999999999999999999999999999999999887666666678999999999999999999999999


Q ss_pred             CCEEEEcCCcCCCCCccccCCCCCCCCCccccccCCCCcceeeEEeecCCceEECCCCCCcchhccch-hhHHHHHHHHh
Q 017868           98 GDRVALEPGISCWRCDHCKGGRYNLCPEMKFFATPPVHGSLANQVVHPADLCFKLPDNVSLEEGAMCE-PLSVGLHACRR  176 (365)
Q Consensus        98 Gd~V~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~v~~~~~~~iP~~~~~~~a~~~~-~~~~a~~~~~~  176 (365)
                      ||||+..+..+|+.|++|..++.++|++..+.+....+|+|+||+.+++++++++|+++++++|+.+. ++.|||++++.
T Consensus        82 GdrV~~~~~~~~~~c~~c~~g~~~~c~~~~~~~~~~~~G~~aey~~v~~~~~~~iP~~~~~~~aa~~~~~~~ta~~a~~~  161 (178)
T d1e3ja1          82 GDRVAVEPGVPCRRCQFCKEGKYNLCPDLTFCATPPDDGNLARYYVHAADFCHKLPDNCNVKQLVTHSFKLEQTVDAFEA  161 (178)
T ss_dssp             TCEEEECCEECCSSSHHHHTTCGGGCTTCEETTBTTBCCSCBSEEEEEGGGEEECCTTCCCGGGEEEEEEGGGHHHHHHH
T ss_pred             CCEEEECcccccCCccccccCCccccccccceeccccccccceeeeecccceeeCCCCCCHHHHHHHHhHHHHHHHHHHH
Confidence            99999999999999999999999999999999888889999999999999999999999999999885 88999999999


Q ss_pred             cCCCCCCEEEEEcC
Q 017868          177 ANIGPETNVLIMGA  190 (365)
Q Consensus       177 ~~~~~g~~vlI~G~  190 (365)
                      +++++|++|||+|+
T Consensus       162 ~~~~~g~~VlVig~  175 (178)
T d1e3ja1         162 ARKKADNTIKVMIS  175 (178)
T ss_dssp             HHHCCTTCSEEEEE
T ss_pred             hCCCCCCEEEEEcc
Confidence            99999999999864



>d1pl8a1 b.35.1.2 (A:1-145,A:317-356) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2ba1 b.35.1.2 (A:17-154,A:327-359) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1llua1 b.35.1.2 (A:2-143,A:310-342) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1cdoa1 b.35.1.2 (A:1-164,A:340-374) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1vj0a1 b.35.1.2 (A:2-155,A:338-367) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1f8fa1 b.35.1.2 (A:4-162,A:337-371) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1e3ia1 b.35.1.2 (A:1-167,A:342-376) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1piwa1 b.35.1.2 (A:1-152,A:321-360) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jvba1 b.35.1.2 (A:1-143,A:314-347) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2fzwa1 b.35.1.2 (A:1-162,A:339-373) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1rjwa1 b.35.1.2 (A:1-137,A:306-339) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1kola1 b.35.1.2 (A:2-160,A:356-397) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1p0fa1 b.35.1.2 (A:1001-1163,A:1338-1372) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1jqba1 b.35.1.2 (A:1001-1139,A:1314-1351) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1uufa1 b.35.1.2 (A:3-144,A:313-349) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2jhfa1 b.35.1.2 (A:1-163,A:340-374) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1yb5a1 b.35.1.2 (A:6-120,A:295-329) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1qora1 b.35.1.2 (A:2-112,A:292-327) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xa0a1 b.35.1.2 (A:1-118,A:295-328) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1iz0a1 b.35.1.2 (A:1-98,A:270-302) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1o89a1 b.35.1.2 (A:1-115,A:293-323) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1gu7a1 b.35.1.2 (A:23-160,A:350-386) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1tt7a1 b.35.1.2 (A:2-127,A:295-330) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1v3va1 b.35.1.2 (A:1-112,A:295-329) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1jbqa_ c.79.1.1 (A:) Cystathionine beta-synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2bhsa1 c.79.1.1 (A:2-293) O-acetylserine sulfhydrylase (Cysteine synthase) {Escherichia coli, isoform B (CysM) [TaxId: 562]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1r0ka2 c.2.1.3 (A:3-126,A:265-290) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Back     information, alignment and structure
>d1y7la1 c.79.1.1 (A:2-311) O-acetylserine sulfhydrylase (Cysteine synthase) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1h6da1 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1wkva1 c.79.1.1 (A:2-383) O-acetylserine sulfhydrylase (Cysteine synthase) {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1z7wa1 c.79.1.1 (A:3-322) O-acetylserine sulfhydrylase (Cysteine synthase) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1fcja_ c.79.1.1 (A:) O-acetylserine sulfhydrylase (Cysteine synthase) {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1omoa_ c.2.1.13 (A:) Archaeal alanine dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d2dula1 c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2nvwa1 c.2.1.3 (A:2-154,A:374-457) Galactose/lactose metabolism regulatory protein GAL80 {Yeast (Kluyveromyces lactis) [TaxId: 28985]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1gtma1 c.2.1.7 (A:181-419) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dssg1 c.2.1.3 (G:1-148,G:313-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {South China Sea lobster (Palinurus versicolor) [TaxId: 150436]} Back     information, alignment and structure
>d1u8fo1 c.2.1.3 (O:3-151,O:316-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human(Homo sapiens), liver isoform [TaxId: 9606]} Back     information, alignment and structure
>d1uh5a_ c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b26a1 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1tdja1 c.79.1.1 (A:5-335) Threonine deaminase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p3ha_ b.35.1.1 (A:) Chaperonin-10 (GroES) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1q0qa2 c.2.1.3 (A:1-125,A:275-300) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1susa1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ej0a_ c.66.1.2 (A:) RNA methyltransferase FtsJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x7da_ c.2.1.13 (A:) Ornithine cyclodeaminase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gado1 c.2.1.3 (O:0-148,O:313-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1obfo1 c.2.1.3 (O:1-152,O:315-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Achromobacter xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1o58a_ c.79.1.1 (A:) O-acetylserine sulfhydrylase (Cysteine synthase) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure