Citrus Sinensis ID: 017888


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360----
MKSAVAITSKIHLNLNLRRNHLYSPLSRSIFLGKAKPVFQSPPLIRTHSSNPNPNPIMASSSKPEQARAPPALPLPTPPVAKFKVGLCQLSVTADKERNIAHARRAIEEAAEKGAKLILLPEIWNSPYSHDSFPVYAEDIDAGGDASPSTAMLSEVARLLKITIVGGSIPERSGDRLYNTCCVFGSDGKLIAKHRKIHLFDIDIPGKITFIESKSLTAGETPTIVDTDVGRIGIGICYDIRFQELAMIYGARGAHLICYPGAFNMTTGPLHWELLQRARATDNQLYVATCSPARDEGAGYVAWGHSTLVGPFGEVLATTEHAEDIIIAEIDYSILELRRTSLPLSKQRRGDLYQLVDIQRLNSQ
cccccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEcccccHHHHHHHHHHHHHHHHHccccEEEccccccccccccccccccccccccccccHHHHHHHHHHHHcccEEEEcccccccccCEEEEEEEEcccccEEEEcccccccccccccccEEEcccccccccccEEEEcccCEEEEEEEEccccHHHHHHHHHccccEEEEcccccccccHHHHHHHHHHHHHcccEEEEEEcccccccccccccccEEEEccccHHHHcccccccEEEEEccHHHHHHHHHHcccccccccccccHHHHHHcccc
*****AITSKIHLNLNLRRNHLYSPLSRSIFLGKAKPV*****************************************VAKFKVGLCQLSVTADKERNIAHARRAIEEAAEKGAKLILLPEIWNSPYSHDSFPVYAEDIDA*GDASPSTAMLSEVARLLKITIVGGSIPERSGDRLYNTCCVFGSDGKLIAKHRKIHLFDIDIPGKITFIESKSLTAGETPTIVDTDVGRIGIGICYDIRFQELAMIYGARGAHLICYPGAFNMTTGPLHWELLQRARATDNQLYVATCSPARDEGAGYVAWGHSTLVGPFGEVLATTEHAEDIIIAEIDYSILELRRTSLPLSKQRRGDLYQLVDIQ*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKSAVAITSKIHLNLNLRRNHLYSPLSRSIFLGKAKPVFQSPPLIRTHSSNPNPNPIMASSSKPEQARAPPALPLPTPPVAKFKVGLCQLSVxxxxxxxxxxxxxxxxxxxxxGAKLILLPEIWNSPYSHDSFPVYAEDIDAGGDASPSTAMLSEVARLLKITIVGGSIPERSGDRLYNTCCVFGSDGKLIAKHRKIHLFDIDIPGKITFIESKSLTAGETPTIVDTDVGRIGIGICYDIRFQELAMIYGARGAHLICYPGAFNMTTGPLHWELLQRARATDNQLYVATCSPARDEGAGYVAWGHSTLVGPFGEVLATTEHAEDIIIAEIDYSILELRRTSLPLSKQRRGDLYQLVDIQRLNSQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Omega-amidase NIT2 Has a omega-amidase activity. The role of omega-amidase is to remove potentially toxic intermediates by converting alpha-ketoglutaramate and alpha-ketosuccinamate to biologically useful alpha-ketoglutarate and oxaloacetate, respectively.probableQ5R4L6
Omega-amidase NIT2 Has a omega-amidase activity. The role of omega-amidase is to remove potentially toxic intermediates by converting alpha-ketoglutaramate and alpha-ketosuccinamate to biologically useful alpha-ketoglutarate and oxaloacetate, respectively. Overexpression decreases the colony-forming capacity of cultured cells by arresting cells in the G2 phase of the cell cycle.probableQ9NQR4
Omega-amidase NIT2 Has a omega-amidase activity. The role of omega-amidase is to remove potentially toxic intermediates by converting alpha-ketoglutaramate and alpha-ketosuccinamate to biologically useful alpha-ketoglutarate and oxaloacetate, respectively.probableQ2T9R6

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.5.-.-Acting on carbon-nitrogen bonds, other than peptide bonds.probable
3.5.1.-11-cis-retinol dehydrogenase.probable
3.5.1.3Omega-amidase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1F89, chain A
Confidence level:very confident
Coverage over the Query: 80-199,210-350
View the alignment between query and template
View the model in PyMOL