Citrus Sinensis ID: 017919

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360----

MVFSSIPAYLDPANWQQQPNPQTGASTGVSTQFVQPQAPPPPPPQPHGSGGGGAGSIRPGSMADRARMANVPMPEAALKCPRCESTNTKFCYFNNYSLSQPRHFCKTCRRYWTRGGALRNVPVGGGCRRNKRSKGGSSGSSKSPVNSTDRQTASGNNSTSTMSCNNSGGASDILGLGPQIPQLRFMTPNLHHFTSEFPSGDIGLNYGSLTAPPVANELNFGGSLLSSLSGLDQWRLQQQAHHHQQFPFLGGLDSSSSSPSGLYPFEGGVEASGYGVGGSAGQIRPKISSTGIVSQLAAAAAPVKMEESSHHHHQQQQEINLSRQFLGMQGNEHQYWSSTTAAGAAAAGWTDLSSFSSSSTSNPL

cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccccccccccccccccccEEEcccccccccHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccHHcccccccccccccccccccccccccccccccccccccccccccccc

*VFSSIPAYL*******************************************************************LKCPRCESTNTKFCYFNNYSLSQPRHFCKTCRRYWTRGGALRNVPVGGG**********************************************ILGLGPQIPQLRFMTPNLHHFTSEFPSGDIGLNYGSLTAPPVANELNFGGSLLSSLSGLDQWRLQQQAHHHQQFPFL************************************************************************************QYWSSTTAAGAAAAGWTD*************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Dof zinc finger protein DOF2.4	Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence.	probable	O80928

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1QYP, chain A
Confidence level:probable
Coverage over the Query: 73-114
View the alignment between query and template
View the model in PyMOL