Citrus Sinensis ID: 017986

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360---
MGDNEIKITVKFCGRPIPITLSPDSTVLRLKNLLLPLTNVLPRGQKLIFKGKVLANEETLGVAGVTNGVKLMLIGTQGVHQGDGPILKEAQSPITSRKTDRVRDMKMVPVGKTSSERWKATGVIALAEHNLKAIPDEVWDCSPFIRVLDIRTNSIQCVPDQIDGLTGLKKLLLDANDLSNDSISWVQLAKLKHLTVLSISRNCLNSLPGILGHLTALQHLDVSNNKLTTLPTEIGLLSKLEVLKANNNRISFLPESIGNCTSLIEIDLSSNLLSELPVTLENLHYLKALHLDNNALKSLPTTLFSKCVQLSTLELHNTEITMDALRQLEGWDDFDKRRRAKHQKQLDFRVMGSTEFDEGADKS
ccccEEEEEEEcccccccccccccccHHHHHHHccccccccccccHHHHccccccccccccccccccccEEEcccccccccccccccHHHccccccccccccccccccccccccHHHHHcccEEEccccccccccHHHHHccccccEEEccccccccccHHHHccccccEEEcccccccccccccccccccccccEEEcccccccccccHHHccccccEEcccccccccccHHHHccccccEEEccccccccccHHHcccccccEEEccccccccccHHHHccccccEEcccccccccccHHHHHccccccEEEccccccccHHHHHHccHHHHHHHHHHHcccccccccccccccccccccc
***NEIKITVKFCGRPIPITLSPDSTVLRLKNLLLPLTNVLPRGQKLIFKGKVLANEETLGVAGVTNGVKLMLIGTQGVHQGDGPIL*E*******RKTDRVRDMKMVPVGKTSSERWKATGVIALAEHNLKAIPDEVWDCSPFIRVLDIRTNSIQCVPDQIDGLTGLKKLLLDANDLSNDSISWVQLAKLKHLTVLSISRNCLNSLPGILGHLTALQHLDVSNNKLTTLPTEIGLLSKLEVLKANNNRISFLPESIGNCTSLIEIDLSSNLLSELPVTLENLHYLKALHLDNNALKSLPTTLFSKCVQLSTLELHNTEITMDALRQLEGWDDFDKRRRAKHQKQLDF***************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGDNEIKITVKFCGRPIPITLSPDSTVLRLKNLLLPLTNVLPRGQKLIFKGKVLANEETLGVAGVTNGVKLMLIGTQGVHQGDGPILKEAQSPITSRKTDRVRDMKMVPVGKTSSERWKATGVIALAEHNLKAIPDEVWDCSPFIRVLDIRTNSIQCVPDQIDGLTGLKKLLLDANDLSNDSISWVQLAKLKHLTVLSISRNCLNSLPGILGHLTALQHLDVSNNKLTTLPTEIGLLSKLEVLKANNNRISFLPESIGNCTSLIEIDLSSNLLSELPVTLENLHYLKALHLDNNALKSLPTTLFSKCVQLSTLELHNTEITMDALRQLEGWDDFDKRRRAKHQKQLDFRVMGSTEFDEGADKS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
LRR repeats and ubiquitin-like domain-containing protein At2g30105 probableP0C895

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1ZIW, chain A
Confidence level:very confident
Coverage over the Query: 95-331
View the alignment between query and template
View the model in PyMOL
Template: 3J0A, chain A
Confidence level:very confident
Coverage over the Query: 34-322
View the alignment between query and template
View the model in PyMOL
Template: 2KD0, chain A
Confidence level:confident
Coverage over the Query: 3-77
View the alignment between query and template
View the model in PyMOL