Citrus Sinensis ID: 017986

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360---
MGDNEIKITVKFCGRPIPITLSPDSTVLRLKNLLLPLTNVLPRGQKLIFKGKVLANEETLGVAGVTNGVKLMLIGTQGVHQGDGPILKEAQSPITSRKTDRVRDMKMVPVGKTSSERWKATGVIALAEHNLKAIPDEVWDCSPFIRVLDIRTNSIQCVPDQIDGLTGLKKLLLDANDLSNDSISWVQLAKLKHLTVLSISRNCLNSLPGILGHLTALQHLDVSNNKLTTLPTEIGLLSKLEVLKANNNRISFLPESIGNCTSLIEIDLSSNLLSELPVTLENLHYLKALHLDNNALKSLPTTLFSKCVQLSTLELHNTEITMDALRQLEGWDDFDKRRRAKHQKQLDFRVMGSTEFDEGADKS
ccccEEEEEEEcccccccccccccccHHHHHHHHcccccccccccHHHHccccccccccccccccccccEEEcccccccccccccccHHHccccccccccccccccccccccccHHHHHcccEEEccccccccccHHHHHccccccEEEccccccccccHHHHccccccEEEcccccccccccccccccccccccEEEccccccccccHHHHccccccEEcccccccccccHHHHccccccEEEccccccccccHHHHccccccEEEccccccccccHHHHccccccEEcccccccccccHHHHHccccccEEEccccccccHHHHHHccHHHHHHHHHHHcccccccccccccccccccccc
ccccEEEEccccccccccHHHcccccccEEEcccccccccccHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHcccccccccHHHHccccccEEEccccccccccHHHHHHHHHccEEEccccccccccHHHHccccccEEEcccccccccccccHHHHccccccEEEccccccccccccccccccccEEEccccccccccHHHcccccccEEEccccccccccHHHcccccccEEEccccccccccHHHcccccccEEEccccccccccHHHHHccccccEEEcccccccccccHHHHcHHHHHHHHccccccccccccccccccccccccc
MGDNEIKITVKfcgrpipitlspdstVLRLKNLllpltnvlprgqKLIFKGKVLANEETLGVAGVTNGVKLMLIGTqgvhqgdgpilkeaqspitsrktdrvrdmkmvpvgktsserWKATGVIALAEHNlkaipdevwdcspfirvldirtnsiqcvpdqidgLTGLKKLLLDANDLSNDSISWVQLAKLKHLTVLSISRNclnslpgiLGHLTALQHldvsnnklttlpteIGLLSKLEVLKANNnrisflpesignctSLIEIDlssnllselpvTLENLHYLKALHldnnalkslpttlfsKCVQLSTLELHNTEITMDALRQLEGWDDFDKRRRAKHqkqldfrvmgstefdegadks
MGDNEIKITvkfcgrpipitlspdsTVLRLKNLLLpltnvlprgQKLIFKGKVLANEETLGVAGVTNGVKLMLIGTQgvhqgdgpilkeaqspitsrktdrvrdmkmvpvgktsserwkATGVIALAEHNLKAIPDEVWDCSPFIRVLDIRTNSIQCVPDQIDGLTGLKKLLLDANDLSNDSISWVQLAKLKHLTVLSISRNCLNSLPGILGHLTALQHLDVSNNKLTTLPTEIGLLSKLEVLKANNNRISFLPESIGNCTSLIEIDLSSNLLSELPVTLENLHYLKALHLDNNALKSLPTTLFSKCVQLSTLELHNTEITMDALRQLEGWDDFDKRRRakhqkqldfrvmgstefdegadks
MGDNEIKITVKFCGRPIPITLSPDStvlrlknlllpltnvlprGQKLIFKGKVLANEETLGVAGVTNGVKLMLIGTQGVHQGDGPILKEAQSPITSRKTDRVRDMKMVPVGKTSSERWKATGVIALAEHNLKAIPDEVWDCSPFIRVLDIRTNSIQCVPDQIdgltglkkllldandlsndsISWVQLAKLKHLTVLSISRNCLNSLPGILGHLTALQHLDVSNNKLTTLPTEIGLLSKLEVLKANNNRISFLPESIGNCTSLIEIDLSSNLLSELPVTLENLHYLKALHLDNNALKSLPTTLFSKCVQLSTLELHNTEITMDALRQLEGWDDFDKRRRAKHQKQLDFRVMGSTEFDEGADKS
*****IKITVKFCGRPIPITLSPDSTVLRLKNLLLPLTNVLPRGQKLIFKGKVLANEETLGVAGVTNGVKLMLIGTQGVHQ***********************************RWKATGVIALAEHNLKAIPDEVWDCSPFIRVLDIRTNSIQCVPDQIDGLTGLKKLLLDANDLSNDSISWVQLAKLKHLTVLSISRNCLNSLPGILGHLTALQHLDVSNNKLTTLPTEIGLLSKLEVLKANNNRISFLPESIGNCTSLIEIDLSSNLLSELPVTLENLHYLKALHLDNNALKSLPTTLFSKCVQLSTLELHNTEITMDALRQLEGWDDF*****************************
***NEIK*TVKFCG**************RLKNLLLPLTNVLPRGQKLIFKGKV****************KLMLIGTQGVHQGDGPIL*E*******RKTDRVRDMKMVPVGKTSSERWKATGVIALAEHNLKAIPDEVWDCSPFIRVLDIRTNSIQCVPDQIDGLTGLKKLLLDANDLSNDSISWVQLAKLKHLTVLSISRNCLNSLPGILGHLTALQHLDVSNNKLTTLPTEIGLLSKLEVLKANNNRISFLPESIGNCTSLIEIDLSSNLLSELPVTLENLHYLKALHLDNNALKSLPTTLFSKCVQLSTLELHNTEITMDALRQLEGWDDFDKRRRAKHQKQLDF******E*DE*****
MGDNEIKITVKFCGRPIPITLSPDSTVLRLKNLLLPLTNVLPRGQKLIFKGKVLANEETLGVAGVTNGVKLMLIGTQGVHQGDGPILKEAQSPITSRKTDRVRDMKMVPVGKTSSERWKATGVIALAEHNLKAIPDEVWDCSPFIRVLDIRTNSIQCVPDQIDGLTGLKKLLLDANDLSNDSISWVQLAKLKHLTVLSISRNCLNSLPGILGHLTALQHLDVSNNKLTTLPTEIGLLSKLEVLKANNNRISFLPESIGNCTSLIEIDLSSNLLSELPVTLENLHYLKALHLDNNALKSLPTTLFSKCVQLSTLELHNTEITMDALRQLEGWDDFDKRRRAKHQKQLDFRVMGST*********
**DNEIKITVKFCGRPIPITLSPDSTVLRLKNLLLPLTNVLPRGQKLIFKGKVLANEETLGVAGVTNGVKLMLIGTQGVHQGDGPILKEAQSPITSRKTDRVRDMKMVPVGKTSSERWKATGVIALAEHNLKAIPDEVWDCSPFIRVLDIRTNSIQCVPDQIDGLTGLKKLLLDANDLSNDSISWVQLAKLKHLTVLSISRNCLNSLPGILGHLTALQHLDVSNNKLTTLPTEIGLLSKLEVLKANNNRISFLPESIGNCTSLIEIDLSSNLLSELPVTLENLHYLKALHLDNNALKSLPTTLFSKCVQLSTLELHNTEITMDALRQLEGWDDFDKRRRAKHQ********************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGDNEIKITVKFCGRPIPITLSPDSTVLRLKNLLLPLTNVLPRGQKLIFKGKVLANEETLGVAGVTNGVKLMLIGTQGVHQGDGPILKEAQSPITSRKTDRVRDMKMVPVGKTSSERWKATGVIALAEHNLKAIPDEVWDCSPFIRVLDIRTNSIQCVPDQIDGLTGLKKLLLDANDLSNDSISWVQLAKLKHLTVLSISRNCLNSLPGILGHLTALQHLDVSNNKLTTLPTEIGLLSKLEVLKANNNRISFLPESIGNCTSLIEIDLSSNLLSELPVTLENLHYLKALHLDNNALKSLPTTLFSKCVQLSTLELHNTEITMDALRQLEGWDDFDKRRRAKHQKQLDFRVMGSTEFDEGADKS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query363 2.2.26 [Sep-21-2011]
P0C895374 LRR repeats and ubiquitin yes no 1.0 0.970 0.603 1e-121
Q4H4B6 1724 Protein scribble homolog yes no 0.465 0.098 0.398 9e-22
Q6INV3238 Leucine-rich repeat-conta N/A no 0.622 0.949 0.312 1e-21
Q9D1G5239 Leucine-rich repeat-conta no no 0.617 0.937 0.323 2e-21
Q5FVI3239 Leucine-rich repeat-conta yes no 0.617 0.937 0.323 5e-21
Q5F4C4 529 Leucine-rich repeat prote no no 0.520 0.357 0.367 6e-21
Q7KRY7 1851 Protein lap4 OS=Drosophil no no 0.528 0.103 0.350 1e-20
Q8N9N7239 Leucine-rich repeat-conta yes no 0.617 0.937 0.314 1e-20
A8JAM0 1159 Coiled-coil domain-contai N/A no 0.438 0.137 0.358 4e-20
F1MCA7 1536 Leucine-rich repeat-conta no no 0.528 0.125 0.338 2e-19
>sp|P0C895|Y2010_ARATH LRR repeats and ubiquitin-like domain-containing protein At2g30105 OS=Arabidopsis thaliana GN=At2g30105 PE=1 SV=1 Back     alignment and function desciption
 Score =  435 bits (1118), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 221/366 (60%), Positives = 276/366 (75%), Gaps = 3/366 (0%)

Query: 1   MGDNEIKITVKFCGRPIPITLSPDSTVLRLKNLLLPLTNVLPRGQKLIFKGKVLANEETL 60
           M D+ IK+TVKF G+ IP+++SPD TV  LK+ L P+TNVLPRGQKLIFKGKVL    TL
Sbjct: 8   MADSTIKLTVKFGGKSIPLSVSPDCTVKDLKSQLQPITNVLPRGQKLIFKGKVLVETSTL 67

Query: 61  GVAGVTNGVKLMLIGTQGVHQGDGPILKEAQSPITSRK--TDRVRDMK-MVPVGKTSSER 117
             + V +G KLML+ +QG+HQG+GPILKEA     SR   +D+V   K  V V K  ++R
Sbjct: 68  KQSDVGSGAKLMLMASQGLHQGEGPILKEASIRPISRTVVSDKVDQRKPSVLVDKNRTDR 127

Query: 118 WKATGVIALAEHNLKAIPDEVWDCSPFIRVLDIRTNSIQCVPDQIDGLTGLKKLLLDAND 177
           WKATGVIALA+ NLK IP+EVWDC   +RVLDI  N I+ VP +I     ++KL L  N 
Sbjct: 128 WKATGVIALAQANLKEIPEEVWDCGSGVRVLDISENFIKEVPAKISSFGSMQKLFLQGNG 187

Query: 178 LSNDSISWVQLAKLKHLTVLSISRNCLNSLPGILGHLTALQHLDVSNNKLTTLPTEIGLL 237
           LS++SI W  +A LK L +LSIS N L  LP  +G LT+L+ LDV+NNKLT+LP E+GLL
Sbjct: 188 LSDESIQWEGIASLKRLMLLSISHNNLTVLPSAMGSLTSLRQLDVTNNKLTSLPNELGLL 247

Query: 238 SKLEVLKANNNRISFLPESIGNCTSLIEIDLSSNLLSELPVTLENLHYLKALHLDNNALK 297
           ++LE+LKANNNRI+ LPESIGNC+ L+E+DLS+N++SELP T   L  LK L L+N  LK
Sbjct: 248 TQLEILKANNNRITSLPESIGNCSFLMEVDLSANIISELPETFTKLRNLKTLELNNTGLK 307

Query: 298 SLPTTLFSKCVQLSTLELHNTEITMDALRQLEGWDDFDKRRRAKHQKQLDFRVMGSTEFD 357
           +LP+ LF  C+QLSTL LHNTEIT++ LRQ EG+DDFD+RRR KHQKQLDFRV+GS +FD
Sbjct: 308 TLPSALFKMCLQLSTLGLHNTEITVEFLRQFEGYDDFDERRRTKHQKQLDFRVVGSGQFD 367

Query: 358 EGADKS 363
           EGADKS
Sbjct: 368 EGADKS 373

Arabidopsis thaliana (taxid: 3702)
>sp|Q4H4B6|SCRIB_DANRE Protein scribble homolog OS=Danio rerio GN=scrib PE=1 SV=1 Back     alignment and function description
>sp|Q6INV3|LRC57_XENLA Leucine-rich repeat-containing protein 57 OS=Xenopus laevis GN=lrrc57 PE=2 SV=1 Back     alignment and function description
>sp|Q9D1G5|LRC57_MOUSE Leucine-rich repeat-containing protein 57 OS=Mus musculus GN=Lrrc57 PE=2 SV=1 Back     alignment and function description
>sp|Q5FVI3|LRC57_RAT Leucine-rich repeat-containing protein 57 OS=Rattus norvegicus GN=Lrrc57 PE=2 SV=1 Back     alignment and function description
>sp|Q5F4C4|SHOC2_CHICK Leucine-rich repeat protein SHOC-2 OS=Gallus gallus GN=SHOC2 PE=2 SV=1 Back     alignment and function description
>sp|Q7KRY7|LAP4_DROME Protein lap4 OS=Drosophila melanogaster GN=scrib PE=1 SV=1 Back     alignment and function description
>sp|Q8N9N7|LRC57_HUMAN Leucine-rich repeat-containing protein 57 OS=Homo sapiens GN=LRRC57 PE=1 SV=1 Back     alignment and function description
>sp|A8JAM0|CC135_CHLRE Coiled-coil domain-containing protein lobo homolog (Fragment) OS=Chlamydomonas reinhardtii GN=FAP50 PE=2 SV=1 Back     alignment and function description
>sp|F1MCA7|LRRC7_BOVIN Leucine-rich repeat-containing protein 7 OS=Bos taurus GN=LRRC7 PE=3 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query363
224055364371 predicted protein [Populus trichocarpa] 0.991 0.970 0.629 1e-120
118487532371 unknown [Populus trichocarpa] 0.991 0.970 0.626 1e-120
334184573367 uncharacterized protein [Arabidopsis tha 1.0 0.989 0.603 1e-119
218551735374 RecName: Full=LRR repeats and ubiquitin- 1.0 0.970 0.603 1e-119
297822733 900 ubiquitin family protein [Arabidopsis ly 1.0 0.403 0.601 1e-119
3150410 902 putative unknown protein, leucine-rich r 1.0 0.402 0.595 1e-118
449519326367 PREDICTED: LRR repeats and ubiquitin-lik 0.997 0.986 0.617 1e-118
356569504375 PREDICTED: LRR repeats and ubiquitin-lik 0.983 0.952 0.603 1e-117
388508972378 unknown [Lotus japonicus] 0.983 0.944 0.601 1e-117
449450940 1290 PREDICTED: uncharacterized protein LOC10 0.983 0.276 0.620 1e-116
>gi|224055364|ref|XP_002298494.1| predicted protein [Populus trichocarpa] gi|222845752|gb|EEE83299.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  439 bits (1129), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 229/364 (62%), Positives = 275/364 (75%), Gaps = 4/364 (1%)

Query: 3   DNEIKITVKFCGRPIPITLSPDSTVLRLKNLLLPLTNVLPRGQKLIFKGKVLANEETLGV 62
           D  I ITVKF GR IPI++S DS +  +K+LL PLTNVLPRGQKLIFKGK+L +  TL  
Sbjct: 7   DTAINITVKFSGRSIPISVSLDSKIKDVKSLLQPLTNVLPRGQKLIFKGKLLVDGMTLRE 66

Query: 63  AGVTNGVKLMLIGTQGVHQGDGPILKEAQS-PITSRKTDR---VRDMKMVPVGKTSSERW 118
           + VTNG K+ML+ +QG+HQGDGPILK+A++ PI+   T     V +   V   K   ERW
Sbjct: 67  SEVTNGAKVMLMASQGLHQGDGPILKDAKTRPISRANTSSNKTVNEKIGVLFDKNRVERW 126

Query: 119 KATGVIALAEHNLKAIPDEVWDCSPFIRVLDIRTNSIQCVPDQIDGLTGLKKLLLDANDL 178
           K TGVI LAE NLKAIP+EVW C P  RVLDI  N I  VP QI  L+ ++K LL+ N +
Sbjct: 127 KVTGVIGLAECNLKAIPEEVWTCGPSTRVLDISNNFILDVPAQIGCLSSMQKFLLNGNGM 186

Query: 179 SNDSISWVQLAKLKHLTVLSISRNCLNSLPGILGHLTALQHLDVSNNKLTTLPTEIGLLS 238
            ++ I W  L  LKHLTVLS+S N L++LP  LG L +L+ L VSNNKL++LP EIGLL+
Sbjct: 187 LDECIKWKGLTSLKHLTVLSVSHNNLSTLPSELGALCSLRQLHVSNNKLSSLPMEIGLLT 246

Query: 239 KLEVLKANNNRISFLPESIGNCTSLIEIDLSSNLLSELPVTLENLHYLKALHLDNNALKS 298
           +LEVLK NNNRIS +P  IG+C+SL E+DLSSNLL+ELPVT  +L  LKALHL NN LKS
Sbjct: 247 QLEVLKVNNNRISNVPMCIGDCSSLAEVDLSSNLLTELPVTFGDLLNLKALHLGNNGLKS 306

Query: 299 LPTTLFSKCVQLSTLELHNTEITMDALRQLEGWDDFDKRRRAKHQKQLDFRVMGSTEFDE 358
           LP+T+F  C+QLSTL+LHNTEITMD LRQLEGW DFD RRR+KHQKQLDFRV+GS EFDE
Sbjct: 307 LPSTIFKMCLQLSTLDLHNTEITMDVLRQLEGWQDFDDRRRSKHQKQLDFRVVGSAEFDE 366

Query: 359 GADK 362
           GADK
Sbjct: 367 GADK 370

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|118487532|gb|ABK95593.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|334184573|ref|NP_001189636.1| uncharacterized protein [Arabidopsis thaliana] gi|330253251|gb|AEC08345.1| uncharacterized protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|218551735|sp|P0C895.1|Y2010_ARATH RecName: Full=LRR repeats and ubiquitin-like domain-containing protein At2g30105 Back     alignment and taxonomy information
>gi|297822733|ref|XP_002879249.1| ubiquitin family protein [Arabidopsis lyrata subsp. lyrata] gi|297325088|gb|EFH55508.1| ubiquitin family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|3150410|gb|AAC16962.1| putative unknown protein, leucine-rich repeat [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449519326|ref|XP_004166686.1| PREDICTED: LRR repeats and ubiquitin-like domain-containing protein At2g30105-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356569504|ref|XP_003552940.1| PREDICTED: LRR repeats and ubiquitin-like domain-containing protein At2g30105-like [Glycine max] Back     alignment and taxonomy information
>gi|388508972|gb|AFK42552.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|449450940|ref|XP_004143220.1| PREDICTED: uncharacterized protein LOC101207176 [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query363
TAIR|locus:2142773262 AT5G07910 "AT5G07910" [Arabido 0.669 0.927 0.396 5.2e-42
MGI|MGI:1913856239 Lrrc57 "leucine rich repeat co 0.619 0.941 0.290 2.4e-21
UNIPROTKB|F1NRN7 529 SHOC2 "Leucine-rich repeat pro 0.517 0.355 0.338 8.2e-21
UNIPROTKB|Q5F4C4 529 SHOC2 "Leucine-rich repeat pro 0.517 0.355 0.338 1e-20
UNIPROTKB|E1BU15 582 SHOC2 "Leucine-rich repeat pro 0.517 0.323 0.338 1e-20
UNIPROTKB|A6QLV3 582 SHOC2 "Leucine-rich repeat pro 0.517 0.323 0.328 3.7e-20
UNIPROTKB|Q9UQ13 582 SHOC2 "Leucine-rich repeat pro 0.517 0.323 0.328 3.7e-20
UNIPROTKB|F2Z5G0 582 SHOC2 "Uncharacterized protein 0.517 0.323 0.328 3.7e-20
UNIPROTKB|Q5RAV5 582 SHOC2 "Leucine-rich repeat pro 0.517 0.323 0.328 3.7e-20
UNIPROTKB|E2R260 582 SHOC2 "Uncharacterized protein 0.517 0.323 0.328 7.7e-20
TAIR|locus:2142773 AT5G07910 "AT5G07910" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 445 (161.7 bits), Expect = 5.2e-42, P = 5.2e-42
 Identities = 98/247 (39%), Positives = 135/247 (54%)

Query:   117 RWKATGVIALAEHNLKAIPDEVWDCSPFIRVLDIRTNSIQCVPDQIXXXXXXXXXXXXXX 176
             RW++TG++ L +  LK  PDEV +    +R LD+  N I  VP +I              
Sbjct:    19 RWRSTGIVGLRDSKLKTFPDEVIEMERAVRTLDLTHNKIADVPGEISKLINMQRLLIADN 78

Query:   177 XXXXXXISWVQLAKLKHLTVLSISRNCLNSLPGILGHLTALQHLDVSNNKLTTLPTEIGL 236
                    +   L KL+ L VL +  N ++ LP  LG L  L+ L +S N L  LP  IG 
Sbjct:    79 LVERLPGN---LGKLQSLKVLMLDGNRISCLPDELGQLVRLEQLSISRNMLIYLPDTIGS 135

Query:   237 LSKLEVLKANNNRISFLPESIGNCTSLIEIDLSSNLLSELPVTLENLHYLKALHLDNNAL 296
             L  L +L  +NNR+  LPES+G+C SL E+  + N++ ELP +L NL  LK+L LDNN +
Sbjct:   136 LRNLLLLNVSNNRLKSLPESVGSCASLEEVQANDNVVEELPASLCNLIQLKSLSLDNNQV 195

Query:   297 KSLPTTLFSKCVQLSTLELHNTEITMDALRQLEGWDDFDKRRRAKHQKQLDFRVM-GSTE 355
               +P  L   C  L  L LHN  I+MD  + +EG+ DF++RR+ K  KQ+D  VM GS  
Sbjct:   196 NQIPDGLLIHCKSLQNLSLHNNPISMDQFQLMEGYQDFEERRKKKFDKQIDSNVMMGSKA 255

Query:   356 FDEGADK 362
              D G DK
Sbjct:   256 LDVGVDK 262
GO:0005886 "plasma membrane" evidence=IDA
MGI|MGI:1913856 Lrrc57 "leucine rich repeat containing 57" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1NRN7 SHOC2 "Leucine-rich repeat protein SHOC-2" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q5F4C4 SHOC2 "Leucine-rich repeat protein SHOC-2" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1BU15 SHOC2 "Leucine-rich repeat protein SHOC-2" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|A6QLV3 SHOC2 "Leucine-rich repeat protein SHOC-2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UQ13 SHOC2 "Leucine-rich repeat protein SHOC-2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F2Z5G0 SHOC2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q5RAV5 SHOC2 "Leucine-rich repeat protein SHOC-2" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms
UNIPROTKB|E2R260 SHOC2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P0C895Y2010_ARATHNo assigned EC number0.60381.00.9705yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
grail3.0053020202
SubName- Full=Putative uncharacterized protein; (371 aa)
(Populus trichocarpa)
Predicted Functional Partners:
fgenesh4_pg.C_scaffold_184000015
hypothetical protein (444 aa)
  •     0.487
gw1.VIII.2940.1
hypothetical protein (406 aa)
  •     0.460
estExt_Genewise1_v1.C_LG_IX2261
hypothetical protein (352 aa)
  •     0.457
eugene3.00120310
hypothetical protein (357 aa)
  •     0.450
fgenesh4_pg.C_scaffold_1268000001
hypothetical protein (327 aa)
  •     0.443
fgenesh4_pg.C_LG_XVIII001027
hypothetical protein (561 aa)
  •     0.443
eugene3.00120315
hypothetical protein (360 aa)
  •     0.410
fgenesh4_pg.C_scaffold_2767000001
hypothetical protein (201 aa)
  •     0.400

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query363
cd0181271 cd01812, BAG1_N, Ubiquitin-like domain of BAG1 2e-19
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-18
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 3e-18
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-13
PRK15370 754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 3e-11
cd0176969 cd01769, UBL, Ubiquitin-like domain of UBL 2e-10
smart0021372 smart00213, UBQ, Ubiquitin homologues 7e-10
PRK15370 754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 8e-10
pfam0024069 pfam00240, ubiquitin, Ubiquitin family 2e-09
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-08
cd0181374 cd01813, UBP_N, UBP ubiquitin processing protease 6e-08
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 8e-08
PRK15387 788 PRK15387, PRK15387, E3 ubiquitin-protein ligase Ss 1e-07
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-07
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-07
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-07
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 5e-07
cd0180972 cd01809, Scythe_N, Ubiquitin-like domain of Scythe 7e-07
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-06
COG4886 394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 5e-06
PRK15370 754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 8e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 9e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-05
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 4e-05
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-05
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 6e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 7e-05
cd0180577 cd01805, RAD23_N, Ubiquitin-like domain of RAD23 8e-05
cd0019669 cd00196, UBQ, Ubiquitin-like proteins 7e-04
PRK15387 788 PRK15387, PRK15387, E3 ubiquitin-protein ligase Ss 9e-04
PRK15387 788 PRK15387, PRK15387, E3 ubiquitin-protein ligase Ss 9e-04
PRK15387 788 PRK15387, PRK15387, E3 ubiquitin-protein ligase Ss 0.001
TIGR00601378 TIGR00601, rad23, UV excision repair protein Rad23 0.001
cd1221989 cd12219, UBL_TBK1_like, Ubiquitin-Like Domain Of H 0.001
cd0180676 cd01806, Nedd8, Nebb8-like ubiquitin protein 0.001
COG4886 394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.002
COG4886 394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.002
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 0.003
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 0.004
>gnl|CDD|176407 cd01812, BAG1_N, Ubiquitin-like domain of BAG1 Back     alignment and domain information 
 Score = 81.2 bits (201), Expect = 2e-19
 Identities = 31/70 (44%), Positives = 45/70 (64%)

Query: 6  IKITVKFCGRPIPITLSPDSTVLRLKNLLLPLTNVLPRGQKLIFKGKVLANEETLGVAGV 65
          I++ VK  G    +++S  +T   LK +L P+T V PR QKLIFKGK   + ETL ++GV
Sbjct: 1  IRVRVKHGGESHDLSISSQATFGDLKKMLAPVTGVEPRDQKLIFKGKERDDAETLDMSGV 60

Query: 66 TNGVKLMLIG 75
           +G K+ML+ 
Sbjct: 61 KDGSKVMLLE 70

BAG1_N N-terminal ubiquitin-like (Ubl) domain of the BAG1 protein. This domain occurs together with the BAG domain and is closely related to the Ubl domain of a family of deubiquitinases that includes Rpn11, UBP6 (USP14), USP7 (HAUSP). Length = 71
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|176364 cd01769, UBL, Ubiquitin-like domain of UBL Back     alignment and domain information
>gnl|CDD|214563 smart00213, UBQ, Ubiquitin homologues Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|215813 pfam00240, ubiquitin, Ubiquitin family Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|176408 cd01813, UBP_N, UBP ubiquitin processing protease Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|185285 PRK15387, PRK15387, E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|176404 cd01809, Scythe_N, Ubiquitin-like domain of Scythe protein Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|176400 cd01805, RAD23_N, Ubiquitin-like domain of RAD23 Back     alignment and domain information
>gnl|CDD|176352 cd00196, UBQ, Ubiquitin-like proteins Back     alignment and domain information
>gnl|CDD|185285 PRK15387, PRK15387, E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>gnl|CDD|185285 PRK15387, PRK15387, E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>gnl|CDD|185285 PRK15387, PRK15387, E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>gnl|CDD|233045 TIGR00601, rad23, UV excision repair protein Rad23 Back     alignment and domain information
>gnl|CDD|240618 cd12219, UBL_TBK1_like, Ubiquitin-Like Domain Of Human Tbk1 and similar proteins Back     alignment and domain information
>gnl|CDD|176401 cd01806, Nedd8, Nebb8-like ubiquitin protein Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 363
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.93
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.93
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.88
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.87
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.86
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.83
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.79
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.77
KOG4237498 consensus Extracellular matrix protein slit, conta 99.76
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.74
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.73
KOG0617264 consensus Ras suppressor protein (contains leucine 99.72
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.72
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.71
KOG0617264 consensus Ras suppressor protein (contains leucine 99.71
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.69
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.67
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.66
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.59
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.58
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.55
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.54
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.52
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.51
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.42
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.42
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.38
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.37
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.31
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.31
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.31
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.3
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.27
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.22
cd0181374 UBP_N UBP ubiquitin processing protease. The UBP ( 99.08
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.94
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 98.94
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.89
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.84
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.82
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.8
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.76
cd0181271 BAG1_N Ubiquitin-like domain of BAG1. BAG1_N N-ter 98.71
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.69
PLN03150623 hypothetical protein; Provisional 98.65
KOG2982 418 consensus Uncharacterized conserved protein [Funct 98.55
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.51
PLN03150623 hypothetical protein; Provisional 98.51
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.47
cd0180774 GDX_N ubiquitin-like domain of GDX. GDX contains a 98.47
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.45
cd0179173 Ubl5 UBL5 ubiquitin-like modifier. UBL5 (also know 98.43
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 98.41
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.35
cd0180972 Scythe_N Ubiquitin-like domain of Scythe protein. 98.3
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.3
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.29
cd0180577 RAD23_N Ubiquitin-like domain of RAD23. RAD23 belo 98.25
cd0179470 DC_UbP_C dendritic cell derived ubiquitin-like pro 98.25
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.24
PTZ0004476 ubiquitin; Provisional 98.24
cd0180676 Nedd8 Nebb8-like ubiquitin protein. Nedd8 (also kn 98.24
KOG1872 473 consensus Ubiquitin-specific protease [Posttransla 98.24
cd0179374 Fubi Fubi ubiquitin-like protein. Fubi is a ubiqui 98.23
cd0180478 midnolin_N Ubiquitin-like domain of midnolin. midn 98.19
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.19
KOG000570 consensus Ubiquitin-like protein [Cell cycle contr 98.18
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.18
cd0180376 Ubiquitin Ubiquitin. Ubiquitin (includes Ubq/RPL40 98.14
cd01802103 AN1_N ubiquitin-like domain of AN1. AN1 (also know 98.13
cd0179778 NIRF_N amino-terminal ubiquitin-like domain of Np9 98.12
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.08
cd0181074 ISG15_repeat2 ISG15 ubiquitin-like protein, second 98.07
cd0179870 parkin_N amino-terminal ubiquitin-like of parkin p 98.06
cd0179280 ISG15_repeat1 ISG15 ubiquitin-like protein, first 98.04
PRK15386 426 type III secretion protein GogB; Provisional 98.02
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.01
cd0179671 DDI1_N DNA damage inducible protein 1 ubiquitin-li 98.0
cd0180076 SF3a120_C Ubiquitin-like domain of Mammalian splic 97.99
smart0021364 UBQ Ubiquitin homologues. Ubiquitin-mediated prote 97.99
PRK15386 426 type III secretion protein GogB; Provisional 97.92
cd0179079 Herp_N Homocysteine-responsive endoplasmic reticul 97.9
PF0024069 ubiquitin: Ubiquitin family; InterPro: IPR000626 U 97.83
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.74
cd0180871 hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC 97.71
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.66
KOG0010 493 consensus Ubiquitin-like protein [Posttranslationa 97.64
KOG2123 388 consensus Uncharacterized conserved protein [Funct 97.62
TIGR00601378 rad23 UV excision repair protein Rad23. All protei 97.59
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.57
cd0179975 Hoil1_N Ubiquitin-like domain of HOIL1. HOIL1_N HO 97.39
cd0176969 UBL Ubiquitin-like domain of UBL. UBLs function by 97.29
cd0176387 Sumo Small ubiquitin-related modifier (SUMO). Smal 97.23
KOG2123 388 consensus Uncharacterized conserved protein [Funct 97.22
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.13
KOG4341483 consensus F-box protein containing LRR [General fu 97.11
KOG0003128 consensus Ubiquitin/60s ribosomal protein L40 fusi 97.08
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.96
cd0178984 Alp11_N Ubiquitin-like domain of Alp11 tubulin-fol 96.86
KOG4341483 consensus F-box protein containing LRR [General fu 96.71
KOG0011340 consensus Nucleotide excision repair factor NEF2, 96.61
PF1456087 Ubiquitin_2: Ubiquitin-like domain; PDB: 1WJN_A 2K 96.61
KOG0004156 consensus Ubiquitin/40S ribosomal protein S27a fus 96.6
PF1197672 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; Inter 96.52
KOG4308 478 consensus LRR-containing protein [Function unknown 96.35
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.14
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.11
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.94
KOG4308 478 consensus LRR-containing protein [Function unknown 95.89
cd0181575 BMSC_UbP_N Ubiquitin-like domain of BMSC-UbP. BMSC 95.83
cd01795107 USP48_C USP ubiquitin-specific protease. The USP ( 95.17
smart0037026 LRR Leucine-rich repeats, outliers. 94.88
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 94.88
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.88
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 94.56
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.1
PLN02560308 enoyl-CoA reductase 93.83
cd01788119 ElonginB Ubiquitin-like domain of Elongin B. Elong 93.23
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 92.87
smart0037026 LRR Leucine-rich repeats, outliers. 92.87
cd01814113 NTGP5 Ubiquitin-like NTGP5 and ATGP4. NTGP5 and AT 92.7
cd0181180 OASL_repeat1 2'-5' oligoadenylate synthetase-like 91.97
KOG0473 326 consensus Leucine-rich repeat protein [Function un 91.79
KOG3864221 consensus Uncharacterized conserved protein [Funct 91.5
KOG0473 326 consensus Leucine-rich repeat protein [Function un 91.09
KOG4248 1143 consensus Ubiquitin-like protein, regulator of apo 89.49
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 89.4
cd0019669 UBQ Ubiquitin-like proteins. Ubiquitin homologs; I 86.12
KOG000175 consensus Ubiquitin and ubiquitin-like proteins [P 85.7
TIGR00864 2740 PCC polycystin cation channel protein. Note: this 83.91
cd0180177 Tsc13_N Ubiquitin-like domain of Tsc13. Tsc13_N N- 83.72
KOG3864221 consensus Uncharacterized conserved protein [Funct 83.6
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 83.15
KOG0006446 consensus E3 ubiquitin-protein ligase (Parkin prot 80.24
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information 
Probab=99.93  E-value=4.6e-27  Score=216.50  Aligned_cols=293  Identities=21%  Similarity=0.250  Sum_probs=177.9

Q ss_pred             cCC-CCCCeEEEecceeecCCcccccccccCCcEEEEeeccCcccCCCccccccCC-CcccccccccccccccCCCCChH
Q 017986           38 TNV-LPRGQKLIFKGKVLANEETLGVAGVTNGVKLMLIGTQGVHQGDGPILKEAQS-PITSRKTDRVRDMKMVPVGKTSS  115 (363)
Q Consensus        38 ~~~-~~~~~~l~~~~~~~~d~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~-~~~~l~~l~~~~~~~~~~~~~~~  115 (363)
                      .|+ |+-.|.+.+.++.+.+.......++.+.+++.+-...-.       ..|... ....+++|.++.+.|..+....+
T Consensus        73 ~g~lp~~t~~LdlsnNkl~~id~~~f~nl~nLq~v~l~~N~Lt-------~IP~f~~~sghl~~L~L~~N~I~sv~se~L  145 (873)
T KOG4194|consen   73 KGFLPSQTQTLDLSNNKLSHIDFEFFYNLPNLQEVNLNKNELT-------RIPRFGHESGHLEKLDLRHNLISSVTSEEL  145 (873)
T ss_pred             CCcCccceeeeeccccccccCcHHHHhcCCcceeeeeccchhh-------hcccccccccceeEEeeeccccccccHHHH
Confidence            444 445567889999998887776666666666444222111       111222 22237777888888888877778


Q ss_pred             HhhcccceeecccccCccCChhhhhcCCceeEEEccCCcCccc-cccccCCCCCCEEEcCCCCCCCCCCChHhhcCCCCc
Q 017986          116 ERWKATGVIALAEHNLKAIPDEVWDCSPFIRVLDIRTNSIQCV-PDQIDGLTGLKKLLLDANDLSNDSISWVQLAKLKHL  194 (363)
Q Consensus       116 ~~~~~l~~L~l~~n~i~~i~~~~~~~~~~L~~L~L~~n~i~~i-~~~~~~l~~L~~L~L~~n~~~~~~~~~~~~~~l~~L  194 (363)
                      ..++.|+.|+|+.|.|.+||...|....++++|+|++|+|+.+ ...|..+.+|..|.|+.|.++.  ++...|.+++.|
T Consensus       146 ~~l~alrslDLSrN~is~i~~~sfp~~~ni~~L~La~N~It~l~~~~F~~lnsL~tlkLsrNritt--Lp~r~Fk~L~~L  223 (873)
T KOG4194|consen  146 SALPALRSLDLSRNLISEIPKPSFPAKVNIKKLNLASNRITTLETGHFDSLNSLLTLKLSRNRITT--LPQRSFKRLPKL  223 (873)
T ss_pred             HhHhhhhhhhhhhchhhcccCCCCCCCCCceEEeeccccccccccccccccchheeeecccCcccc--cCHHHhhhcchh
Confidence            8888888888888877777777777666777777777777766 3456667777777777777774  454566667777


Q ss_pred             CEEEcCCCcCCCC------------------------C-ccccCCCCCCEEEcccCcCCCcc-hhhcCCCCCCEEeccCC
Q 017986          195 TVLSISRNCLNSL------------------------P-GILGHLTALQHLDVSNNKLTTLP-TEIGLLSKLEVLKANNN  248 (363)
Q Consensus       195 ~~L~l~~n~l~~l------------------------~-~~l~~l~~L~~L~l~~n~i~~l~-~~~~~~~~L~~L~l~~n  248 (363)
                      +.|+|.+|+|..+                        . +.|-.+.++++|+++.|++..+. .++.+++.|+.|++++|
T Consensus       224 ~~LdLnrN~irive~ltFqgL~Sl~nlklqrN~I~kL~DG~Fy~l~kme~l~L~~N~l~~vn~g~lfgLt~L~~L~lS~N  303 (873)
T KOG4194|consen  224 ESLDLNRNRIRIVEGLTFQGLPSLQNLKLQRNDISKLDDGAFYGLEKMEHLNLETNRLQAVNEGWLFGLTSLEQLDLSYN  303 (873)
T ss_pred             hhhhccccceeeehhhhhcCchhhhhhhhhhcCcccccCcceeeecccceeecccchhhhhhcccccccchhhhhccchh
Confidence            7777766665533                        1 22333445555555555555442 23355555556666666


Q ss_pred             cCccCC-ccccCCCCCcEEECCCCCCCCCC-hhccCCCCCCEEECCCCCCCCCChhhhhCCCCCCEEEccCCccchh---
Q 017986          249 RISFLP-ESIGNCTSLIEIDLSSNLLSELP-VTLENLHYLKALHLDNNALKSLPTTLFSKCVQLSTLELHNTEITMD---  323 (363)
Q Consensus       249 ~i~~~~-~~~~~~~~L~~L~L~~n~l~~l~-~~~~~~~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~n~i~~~---  323 (363)
                      .|..+. +.+..+++|+.|+|++|+|+.++ +.+..+..|++|.|++|.++.+...+|..+++|+.|||++|.++..   
T Consensus       304 aI~rih~d~WsftqkL~~LdLs~N~i~~l~~~sf~~L~~Le~LnLs~Nsi~~l~e~af~~lssL~~LdLr~N~ls~~IED  383 (873)
T KOG4194|consen  304 AIQRIHIDSWSFTQKLKELDLSSNRITRLDEGSFRVLSQLEELNLSHNSIDHLAEGAFVGLSSLHKLDLRSNELSWCIED  383 (873)
T ss_pred             hhheeecchhhhcccceeEeccccccccCChhHHHHHHHhhhhcccccchHHHHhhHHHHhhhhhhhcCcCCeEEEEEec
Confidence            555443 34555556666666666666553 3455555566666666666666555666666666666666665432   


Q ss_pred             hhhcccCchHHHHHHH
Q 017986          324 ALRQLEGWDDFDKRRR  339 (363)
Q Consensus       324 ~~~~l~~l~~l~~~~~  339 (363)
                      .-..+.++++|.+++.
T Consensus       384 aa~~f~gl~~LrkL~l  399 (873)
T KOG4194|consen  384 AAVAFNGLPSLRKLRL  399 (873)
T ss_pred             chhhhccchhhhheee
Confidence            3344555555555443

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>cd01813 UBP_N UBP ubiquitin processing protease Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd01812 BAG1_N Ubiquitin-like domain of BAG1 Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>cd01807 GDX_N ubiquitin-like domain of GDX Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>cd01791 Ubl5 UBL5 ubiquitin-like modifier Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01809 Scythe_N Ubiquitin-like domain of Scythe protein Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>cd01805 RAD23_N Ubiquitin-like domain of RAD23 Back     alignment and domain information
>cd01794 DC_UbP_C dendritic cell derived ubiquitin-like protein Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PTZ00044 ubiquitin; Provisional Back     alignment and domain information
>cd01806 Nedd8 Nebb8-like ubiquitin protein Back     alignment and domain information
>KOG1872 consensus Ubiquitin-specific protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01793 Fubi Fubi ubiquitin-like protein Back     alignment and domain information
>cd01804 midnolin_N Ubiquitin-like domain of midnolin Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG0005 consensus Ubiquitin-like protein [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>cd01803 Ubiquitin Ubiquitin Back     alignment and domain information
>cd01802 AN1_N ubiquitin-like domain of AN1 Back     alignment and domain information
>cd01797 NIRF_N amino-terminal ubiquitin-like domain of Np95 and NIRF Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>cd01810 ISG15_repeat2 ISG15 ubiquitin-like protein, second repeat of 2 Back     alignment and domain information
>cd01798 parkin_N amino-terminal ubiquitin-like of parkin protein Back     alignment and domain information
>cd01792 ISG15_repeat1 ISG15 ubiquitin-like protein, first repeat of 2 Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>cd01796 DDI1_N DNA damage inducible protein 1 ubiquitin-like domain Back     alignment and domain information
>cd01800 SF3a120_C Ubiquitin-like domain of Mammalian splicing factor SF3a_120 Back     alignment and domain information
>smart00213 UBQ Ubiquitin homologues Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>cd01790 Herp_N Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain protein Back     alignment and domain information
>PF00240 ubiquitin: Ubiquitin family; InterPro: IPR000626 Ubiquitinylation is an ATP-dependent process that involves the action of at least three enzymes: a ubiquitin-activating enzyme (E1, IPR000011 from INTERPRO), a ubiquitin-conjugating enzyme (E2, IPR000608 from INTERPRO), and a ubiquitin ligase (E3, IPR000569 from INTERPRO, IPR003613 from INTERPRO), which work sequentially in a cascade Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>cd01808 hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC2 Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG0010 consensus Ubiquitin-like protein [Posttranslational modification, protein turnover, chaperones; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR00601 rad23 UV excision repair protein Rad23 Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>cd01799 Hoil1_N Ubiquitin-like domain of HOIL1 Back     alignment and domain information
>cd01769 UBL Ubiquitin-like domain of UBL Back     alignment and domain information
>cd01763 Sumo Small ubiquitin-related modifier (SUMO) Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG0003 consensus Ubiquitin/60s ribosomal protein L40 fusion [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>cd01789 Alp11_N Ubiquitin-like domain of Alp11 tubulin-folding cofactor B Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG0011 consensus Nucleotide excision repair factor NEF2, RAD23 component [Replication, recombination and repair] Back     alignment and domain information
>PF14560 Ubiquitin_2: Ubiquitin-like domain; PDB: 1WJN_A 2KJ6_A 2KJR_A 1V6E_A 1T0Y_A Back     alignment and domain information
>KOG0004 consensus Ubiquitin/40S ribosomal protein S27a fusion [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF11976 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; InterPro: IPR022617 This entry includes small ubiquitin-related modifier (SUMO) proteins Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>cd01815 BMSC_UbP_N Ubiquitin-like domain of BMSC-UbP Back     alignment and domain information
>cd01795 USP48_C USP ubiquitin-specific protease Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PLN02560 enoyl-CoA reductase Back     alignment and domain information
>cd01788 ElonginB Ubiquitin-like domain of Elongin B Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>cd01814 NTGP5 Ubiquitin-like NTGP5 and ATGP4 Back     alignment and domain information
>cd01811 OASL_repeat1 2'-5' oligoadenylate synthetase-like protein, repeat 1 of 2 Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4248 consensus Ubiquitin-like protein, regulator of apoptosis [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information
>cd00196 UBQ Ubiquitin-like proteins Back     alignment and domain information
>KOG0001 consensus Ubiquitin and ubiquitin-like proteins [Posttranslational modification, protein turnover, chaperones; General function prediction only] Back     alignment and domain information
>TIGR00864 PCC polycystin cation channel protein Back     alignment and domain information
>cd01801 Tsc13_N Ubiquitin-like domain of Tsc13 Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>KOG0006 consensus E3 ubiquitin-protein ligase (Parkin protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query363
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 2e-11
2o6s_A208 Structural Diversity Of The Hagfish Variable Lympho 5e-10
2kd0_A85 Nmr Solution Structure Of O64736 Protein From Arabi 2e-09
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 3e-09
3e6j_A229 Crystal Structure Of Variable Lymphocyte Receptor ( 1e-07
3cvr_A 571 Crystal Structure Of The Full Length Ipah3 Length = 1e-07
4b8c_D 727 Nuclease Module Of The Yeast Ccr4-Not Complex Lengt 5e-07
3m19_A251 Crystal Structure Of Variable Lymphocyte Receptor V 5e-07
3m18_A251 Crystal Structure Of Variable Lymphocyte Receptor V 6e-07
3rfj_A279 Design Of A Binding Scaffold Based On Variable Lymp 1e-06
1m0z_A290 Crystal Structure Of The Von Willebrand Factor Bind 1e-06
1m10_B290 Crystal Structure Of The Complex Of Glycoprotein Ib 2e-06
1sq0_B288 Crystal Structure Of The Complex Of The Wild-Type V 2e-06
3pmh_G290 Mechanism Of Sulfotyrosine-Mediated Glycoprotein Ib 2e-06
1ook_G290 Crystal Structure Of The Complex Of Platelet Recept 2e-06
3p72_A269 Structure Of Platelet Glycoprotein 1b Alpha With A 3e-06
1p9a_G290 Crystal Structure Of N-terminal Domain Of Human Pla 3e-06
1u0n_D265 The Ternary Von Willebrand Factor A1-Glycoprotein I 3e-06
1p8v_A279 Crystal Structure Of The Complex Of Platelet Recept 3e-06
1gwb_B281 Structure Of Glycoprotein 1b Length = 281 3e-06
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 9e-06
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 9e-06
2o6r_A177 Structural Diversity Of The Hagfish Variable Lympho 1e-05
3g06_A 622 The Salmonella Virulence Effector Ssph2 Functions A 1e-05
3j0a_A 844 Homology Model Of Human Toll-Like Receptor 5 Fitted 1e-05
1g9u_A 454 Crystal Structure Of Yopm-leucine Rich Effector Pro 1e-05
1ozn_A285 1.5a Crystal Structure Of The Nogo Receptor Ligand 2e-05
1p8t_A285 Crystal Structure Of Nogo-66 Receptor Length = 285 2e-05
3ula_A279 Crystal Structure Of The Tv3 Mutant F63w-Md-2-Erito 5e-05
3ul9_A278 Structure Of The Tv3 Mutant M41e Length = 278 6e-05
3ul7_A278 Crystal Structure Of The Tv3 Mutant F63w Length = 2 6e-05
2z62_A276 Crystal Structure Of The Tv3 Hybrid Of Human Tlr4 A 7e-05
3ul8_A279 Crystal Structure Of The Tv3 Mutant V134l Length = 9e-05
2wfh_A193 The Human Slit 2 Dimerization Domain D4 Length = 19 1e-04
3zyn_A321 Crystal Structure Of The N-Terminal Leucine Rich Re 2e-04
3zyo_A 411 Crystal Structure Of The N-Terminal Leucine Rich Re 2e-04
2omu_A 462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 2e-04
2omt_A 462 Crystal Structure Of Inla G194s+sHEC1 COMPLEX Lengt 2e-04
1h6u_A308 Internalin H: Crystal Structure Of Fused N-Terminal 4e-04
4fho_A231 Crystal Structure Of An Internalin C2 (Inlc2) From 5e-04
2omx_A 462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 6e-04
2z63_A570 Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 A 6e-04
2z80_A 353 Crystal Structure Of The Tlr1-Tlr2 Heterodimer Indu 8e-04
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure 
Iteration: 1

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 53/150 (35%), Positives = 80/150 (53%), Gaps = 6/150 (4%)
Query: 188 LAKLKHLTVLSISRNCLNSLP-GILGHLTALQHLDVSNNKLTTLPTEI-GLLSKLEVLKA 245
           L +L +LT L ++ N L SLP G+   LT L+ L +  N+L +LP  +   L+ L  L  
Sbjct: 81  LKELTNLTYLILTGNQLQSLPNGVFDKLTNLKELVLVENQLQSLPDGVFDKLTNLTYLNL 140
Query: 246 NNNRISFLPESIGN-CTSLIEIDLSSNLLSELPV-TLENLHYLKALHLDNNALKSLPTTL 303
            +N++  LP+ + +  T+L E+DLS N L  LP    + L  LK L L  N LKS+P  +
Sbjct: 141 AHNQLQSLPKGVFDKLTNLTELDLSYNQLQSLPEGVFDKLTQLKDLRLYQNQLKSVPDGV 200
Query: 304 FSKCVQLSTLELHNT--EITMDALRQLEGW 331
           F +   L  + LH+   + T   +R L  W
Sbjct: 201 FDRLTSLQYIWLHDNPWDCTCPGIRYLSEW 230
>pdb|2O6S|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B59 Length = 208 Back     alignment and structure
>pdb|2KD0|A Chain A, Nmr Solution Structure Of O64736 Protein From Arabidopsis Thaliana. Northeast Structural Genomics Consortium Mega Target Ar3445a Length = 85 Back     alignment and structure
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|3E6J|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor (Vlr) Rbc36 In Complex With H-Trisaccharide Length = 229 Back     alignment and structure
>pdb|3CVR|A Chain A, Crystal Structure Of The Full Length Ipah3 Length = 571 Back     alignment and structure
>pdb|4B8C|D Chain D, Nuclease Module Of The Yeast Ccr4-Not Complex Length = 727 Back     alignment and structure
>pdb|3M19|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R5.1 Length = 251 Back     alignment and structure
>pdb|3M18|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R2.1 In Complex With Hen Egg Lysozyme Length = 251 Back     alignment and structure
>pdb|3RFJ|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 279 Back     alignment and structure
>pdb|1M0Z|A Chain A, Crystal Structure Of The Von Willebrand Factor Binding Domain Of Glycoprotein Ib Alpha Length = 290 Back     alignment and structure
>pdb|1M10|B Chain B, Crystal Structure Of The Complex Of Glycoprotein Ib Alpha And The Von Willebrand Factor A1 Domain Length = 290 Back     alignment and structure
>pdb|1SQ0|B Chain B, Crystal Structure Of The Complex Of The Wild-Type Von Willebrand Factor A1 Domain And Glycoprotein Ib Alpha At 2.6 Angstrom Resolution Length = 288 Back     alignment and structure
>pdb|3PMH|G Chain G, Mechanism Of Sulfotyrosine-Mediated Glycoprotein Ib Interaction With Two Distinct Alpha-Thrombin Sites Length = 290 Back     alignment and structure
>pdb|1OOK|G Chain G, Crystal Structure Of The Complex Of Platelet Receptor Gpib-alpha And Human Alpha-thrombin Length = 290 Back     alignment and structure
>pdb|3P72|A Chain A, Structure Of Platelet Glycoprotein 1b Alpha With A Bound Peptide Inhibitor Length = 269 Back     alignment and structure
>pdb|1P9A|G Chain G, Crystal Structure Of N-terminal Domain Of Human Platelet Receptor Glycoprotein Ib-alpha At 1.7 Angstrom Resolution Length = 290 Back     alignment and structure
>pdb|1U0N|D Chain D, The Ternary Von Willebrand Factor A1-Glycoprotein Ibalpha- Botrocetin Complex Length = 265 Back     alignment and structure
>pdb|1P8V|A Chain A, Crystal Structure Of The Complex Of Platelet Receptor Gpib-alpha And Alpha-thrombin At 2.6a Length = 279 Back     alignment and structure
>pdb|1GWB|B Chain B, Structure Of Glycoprotein 1b Length = 281 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|2O6R|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B61 Length = 177 Back     alignment and structure
>pdb|3G06|A Chain A, The Salmonella Virulence Effector Ssph2 Functions As A Novel E3 Ligase Length = 622 Back     alignment and structure
>pdb|3J0A|A Chain A, Homology Model Of Human Toll-Like Receptor 5 Fitted Into An Electron Microscopy Single Particle Reconstruction Length = 844 Back     alignment and structure
>pdb|1G9U|A Chain A, Crystal Structure Of Yopm-leucine Rich Effector Protein From Yersinia Pestis Length = 454 Back     alignment and structure
>pdb|1OZN|A Chain A, 1.5a Crystal Structure Of The Nogo Receptor Ligand Binding Domain Reveals A Convergent Recognition Scaffold Mediating Inhibition Of Myelination Length = 285 Back     alignment and structure
>pdb|1P8T|A Chain A, Crystal Structure Of Nogo-66 Receptor Length = 285 Back     alignment and structure
>pdb|3ULA|A Chain A, Crystal Structure Of The Tv3 Mutant F63w-Md-2-Eritoran Complex Length = 279 Back     alignment and structure
>pdb|3UL9|A Chain A, Structure Of The Tv3 Mutant M41e Length = 278 Back     alignment and structure
>pdb|3UL7|A Chain A, Crystal Structure Of The Tv3 Mutant F63w Length = 278 Back     alignment and structure
>pdb|2Z62|A Chain A, Crystal Structure Of The Tv3 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 276 Back     alignment and structure
>pdb|3UL8|A Chain A, Crystal Structure Of The Tv3 Mutant V134l Length = 279 Back     alignment and structure
>pdb|2WFH|A Chain A, The Human Slit 2 Dimerization Domain D4 Length = 193 Back     alignment and structure
>pdb|3ZYN|A Chain A, Crystal Structure Of The N-Terminal Leucine Rich Repeats Of Netrin-G Ligand-3 Length = 321 Back     alignment and structure
>pdb|3ZYO|A Chain A, Crystal Structure Of The N-Terminal Leucine Rich Repeats And Immunoglobulin Domain Of Netrin-G Ligand-3 Length = 411 Back     alignment and structure
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure
>pdb|2OMT|A Chain A, Crystal Structure Of Inla G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|1H6U|A Chain A, Internalin H: Crystal Structure Of Fused N-Terminal Domains Length = 308 Back     alignment and structure
>pdb|4FHO|A Chain A, Crystal Structure Of An Internalin C2 (Inlc2) From Listeria Monocytogenes Str. 4b F2365 At 1.90 A Resolution Length = 231 Back     alignment and structure
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2Z63|A Chain A, Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 570 Back     alignment and structure
>pdb|2Z80|A Chain A, Crystal Structure Of The Tlr1-Tlr2 Heterodimer Induced By Binding Of A Tri-Acylated Lipopeptide Length = 353 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query363
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-44
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-38
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-38
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-36
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-33
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-31
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 2e-18
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 8e-33
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-30
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-29
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-20
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-32
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-27
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-14
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 8e-14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-32
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 8e-30
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-23
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-14
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-31
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-29
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-28
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-27
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-21
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-19
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 1e-31
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 4e-29
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 6e-27
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-24
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 9e-14
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 3e-31
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 2e-28
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 3e-27
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 5e-24
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 1e-18
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-31
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-26
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-21
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 4e-13
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-31
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-28
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-22
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-09
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 8e-31
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 9e-28
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-26
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 7e-23
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-22
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-22
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-20
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-18
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-30
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-30
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-27
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-22
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 5e-19
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-06
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-30
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-26
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 9e-26
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-18
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 8e-12
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-30
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 3e-29
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 1e-28
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-26
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-30
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-25
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 8e-25
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-15
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-08
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-30
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-27
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-25
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-25
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-23
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-21
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-20
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-19
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-15
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-14
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-29
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-27
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-26
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-25
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-25
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-25
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-24
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-20
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-16
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-10
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 7e-29
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-28
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-28
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 8e-28
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-27
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-27
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-27
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 7e-27
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-24
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 9e-24
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-13
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-28
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-28
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-27
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-18
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-28
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-27
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-26
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-24
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-28
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-27
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-26
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-22
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-19
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-17
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-16
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-15
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-12
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-28
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-26
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-18
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 4e-17
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-28
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-28
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-20
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-20
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-19
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-14
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-14
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-07
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-04
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-28
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-28
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-27
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 9e-26
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-23
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-17
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-28
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-26
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-26
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 6e-24
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-23
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 6e-23
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-19
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-19
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-15
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-27
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-26
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-26
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-24
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-17
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-16
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-09
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 3e-27
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 3e-25
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-25
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 8e-25
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-21
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-14
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 5e-13
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 7e-07
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 4e-27
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-26
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-25
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 4e-15
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-12
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-27
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-16
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-26
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-24
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 8e-16
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 8e-16
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-14
1o6v_A466 Internalin A; bacterial infection, extracellular r 8e-26
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-25
1o6v_A 466 Internalin A; bacterial infection, extracellular r 5e-25
1o6v_A 466 Internalin A; bacterial infection, extracellular r 3e-20
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-20
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-09
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-25
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-19
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-13
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 8e-25
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-23
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-23
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-17
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-11
2kd0_A85 LRR repeats and ubiquitin-like domain-containing p 3e-24
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-24
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-20
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-20
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-19
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 8e-18
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-16
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-16
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-12
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-23
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-23
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-22
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-20
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-20
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 9e-18
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 8e-07
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-23
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 2e-14
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-14
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 2e-12
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-07
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-23
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-21
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 7e-19
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 2e-18
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 4e-10
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-10
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 2e-23
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 8e-23
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 6e-18
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-13
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 5e-23
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 8e-17
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-22
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-22
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-16
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-22
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-15
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-15
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-14
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-13
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-12
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-08
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-21
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-20
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 7e-12
2xwt_C 239 Thyrotropin receptor; signaling protein-immune sys 7e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 5e-21
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 7e-20
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 9e-13
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-20
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 7e-15
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-11
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-20
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-20
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-18
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-17
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-20
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-20
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-18
1xeu_A 263 Internalin C; cellular invasion, leucine-rich repe 3e-13
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-12
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 6e-20
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 7e-19
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-16
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 9e-14
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-19
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 6e-14
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-12
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-19
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-12
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-18
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-16
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-10
1v86_A95 DNA segment, CHR 7, wayne state university 128, ex 3e-18
1wgg_A96 Ubiquitin carboxyl-terminal hydrolase 14; ubiquiti 1e-16
3e6j_A229 Variable lymphocyte receptor diversity region; var 4e-16
3e6j_A229 Variable lymphocyte receptor diversity region; var 9e-05
1v5t_A90 8430435I17RIK protein; hypothetical protein, ubiqu 5e-16
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-15
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-09
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-05
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 9e-15
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 3e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-14
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-10
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 5e-14
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-09
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 8e-09
3shq_A320 UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila 2e-13
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-13
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-08
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-12
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-06
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 3e-12
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 1e-11
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 2e-11
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 9e-06
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 2e-05
1wx8_A96 Riken cDNA 4931431F19; ubiquitin-like domain, ubiq 4e-12
1w8a_A192 SLIT protein; signaling protein, secreted protein, 9e-12
1w8a_A192 SLIT protein; signaling protein, secreted protein, 4e-11
1w8a_A192 SLIT protein; signaling protein, secreted protein, 4e-10
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 1e-11
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 6e-09
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 3e-08
1wxv_A92 BAG-family molecular chaperone regulator-1; struct 2e-11
1yqb_A100 Ubiquilin 3; structural genomics consortium, ubiqu 3e-11
3m62_B106 UV excision repair protein RAD23; armadillo-like r 2e-10
2kan_A94 Uncharacterized protein AR3433A; ubiquitin fold, a 3e-10
1j8c_A125 Ubiquitin-like protein hplic-2; ubiquitin-like dom 4e-10
2klc_A101 Ubiquilin-1; ubiquitin-like, structural genomics, 5e-10
1wx7_A106 Ubiquilin 3; ubiquitin-like domain, structural gen 6e-10
3m63_B101 Ubiquitin domain-containing protein DSK2; armadill 1e-09
4dwf_A90 HLA-B-associated transcript 3; ubiquitin-like doma 2e-09
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 5e-09
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-08
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 8e-07
4eew_A88 Large proline-rich protein BAG6; ubiquitin-like fo 6e-09
2dzi_A81 Ubiquitin-like protein 4A; GDX, structural genomic 9e-09
2bwf_A77 Ubiquitin-like protein DSK2; signaling protein, UB 1e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-08
3u5c_F225 RP14, S2, YS8, 40S ribosomal protein S5; translati 2e-08
1oqy_A368 HHR23A, UV excision repair protein RAD23 homolog A 2e-08
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 3e-08
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 1e-06
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 5e-05
1ttn_A106 DC-UBP, dendritic cell-derived ubiquitin-like prot 4e-08
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 5e-08
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 3e-06
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 2e-05
1wh3_A87 59 kDa 2'-5'-oligoadenylate synthetase like protei 6e-08
2wyq_A85 HHR23A, UV excision repair protein RAD23 homolog A 6e-08
1uel_A95 HHR23B, UV excision repair protein RAD23 homolog B 8e-08
3dbh_I88 NEDD8; cell cycle, activating enzyme, apoptosis, m 1e-07
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 1e-07
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 5e-06
1ndd_A76 NEDD8, protein (ubiquitin-like protein NEDD8); pro 2e-07
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-07
3u5e_m128 60S ribosomal protein L40; translation, ribosome, 2e-07
3b1l_X76 E3 ubiquitin-protein ligase parkin; proteasome, AL 2e-07
3n3k_B85 Ubiquitin; hydrolase, protease, thiol protease, DU 3e-07
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-07
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-07
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-07
2kk8_A84 Uncharacterized protein AT4G05270; solution arabid 4e-07
4fbj_B88 NEDD8; effector-HOST target complex, glutamine dea 6e-07
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 6e-07
1wgd_A93 Homocysteine-responsive endoplasmic reticulum- res 8e-07
2hj8_A88 Interferon-induced 17 kDa protein; HR2873B, human 1e-06
3phx_B79 Ubiquitin-like protein ISG15; OTU domain, DE-ubiqu 2e-06
3mtn_B85 UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquit 2e-06
2xzm_9189 RPS31E; ribosome, translation; 3.93A {Tetrahymena 4e-06
1sif_A88 Ubiquitin; hydrophobic mutants, folding, stability 4e-06
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 5e-06
2kdi_A114 Ubiquitin, vacuolar protein sorting-associated pro 5e-06
2kdb_A99 Homocysteine-responsive endoplasmic reticulum- res 6e-06
1yx5_B98 Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo s 6e-06
1we7_A115 SF3A1 protein; structural genomics, ubiquitin-like 7e-06
3k9o_B96 Ubiquitin, UBB+1; E2-25K, complex structure, ATP-b 1e-05
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 2e-05
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 4e-05
2l7r_A93 Ubiquitin-like protein FUBI; structural genomics, 2e-05
2ojr_A111 Ubiquitin; lanthide-binding TAG, terbium, TB, SAD 3e-05
3a9j_A76 Ubiquitin; protein complex, cytoplasm, isopeptide 3e-05
1v5o_A102 1700011N24RIK protein; hypothetical protein, ubiqu 4e-05
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 5e-05
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 5e-04
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 6e-04
1we6_A111 Splicing factor, putative; structural genomics, ub 9e-05
3rt3_B159 Ubiquitin-like protein ISG15; ubiquitin-like domai 2e-04
1wy8_A89 NP95-like ring finger protein, isoform A; ubiquiti 2e-04
3b08_A152 Polyubiquitin-C, ubiquitin; protein complex, signa 2e-04
2faz_A78 Ubiquitin-like containing PHD and ring finger DOM 2e-04
2gow_A125 HCG-1 protein, ubiquitin-like protein 3; BC059385, 3e-04
1wia_A95 Hypothetical ubiquitin-like protein (riken cDNA 20 4e-04
3u30_A172 Ubiquitin, linear DI-ubiquitin; immune system; 2.4 4e-04
1x1m_A107 Ubiquitin-like protein SB132; structural genomics, 6e-04
3plu_A93 Ubiquitin-like modifier HUB1; ubiquitin-like, HUB- 8e-04
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>2kd0_A LRR repeats and ubiquitin-like domain-containing protein AT2G30105; ubiquitin-like protein, NESG, leucine-rich repeat, structural genomics; NMR {Arabidopsis thaliana} Length = 85 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1v86_A DNA segment, CHR 7, wayne state university 128, expressed; ubiquitin fold, structural genomics, D7WSU128E protein; HET: DNA; NMR {Mus musculus} SCOP: d.15.1.1 Length = 95 Back     alignment and structure
>1wgg_A Ubiquitin carboxyl-terminal hydrolase 14; ubiquitin specific protease 14, USP14, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Length = 96 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>1v5t_A 8430435I17RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 2kx3_A Length = 90 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} Length = 320 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1wx8_A Riken cDNA 4931431F19; ubiquitin-like domain, ubiquilin 1-like, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Length = 96 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>1wxv_A BAG-family molecular chaperone regulator-1; structural genomics, apoptosis, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 92 Back     alignment and structure
>1yqb_A Ubiquilin 3; structural genomics consortium, ubiquitin, ubiquitin-like domain, structural genomics, signaling protein SGC; 2.00A {Homo sapiens} SCOP: d.15.1.1 Length = 100 Back     alignment and structure
>3m62_B UV excision repair protein RAD23; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Length = 106 Back     alignment and structure
>2kan_A Uncharacterized protein AR3433A; ubiquitin fold, alpha+beta, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} Length = 94 Back     alignment and structure
>1j8c_A Ubiquitin-like protein hplic-2; ubiquitin-like domain, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 125 Back     alignment and structure
>2klc_A Ubiquilin-1; ubiquitin-like, structural genomics, PSI-2, protein structur initiative, northeast structural genomics consortium, NESG; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>1wx7_A Ubiquilin 3; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 106 Back     alignment and structure
>3m63_B Ubiquitin domain-containing protein DSK2; armadillo-like repeats, UBL conjugation pathway, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>4dwf_A HLA-B-associated transcript 3; ubiquitin-like domain, BAT3 protein, PF00240, structural GEN joint center for structural genomics, JCSG; 1.80A {Homo sapiens} PDB: 1wx9_A Length = 90 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>4eew_A Large proline-rich protein BAG6; ubiquitin-like fold, GP78-binding, chaperone; 1.30A {Homo sapiens} Length = 88 Back     alignment and structure
>2dzi_A Ubiquitin-like protein 4A; GDX, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2bwf_A Ubiquitin-like protein DSK2; signaling protein, UBA, signaling proteins; 1.15A {Saccharomyces cerevisiae} SCOP: d.15.1.1 PDB: 2bwe_S Length = 77 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3u5c_F RP14, S2, YS8, 40S ribosomal protein S5; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3izb_F 3o30_D 3o2z_D 3u5g_F 3jyv_G* 2noq_F 1s1h_G 3iz6_F Length = 225 Back     alignment and structure
>1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A Length = 368 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>1ttn_A DC-UBP, dendritic cell-derived ubiquitin-like protein; ubiquitin-like domain, solution structure, signaling protein; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 106 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>1wh3_A 59 kDa 2'-5'-oligoadenylate synthetase like protein; P59 OASL, ubiquitin family, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 87 Back     alignment and structure
>2wyq_A HHR23A, UV excision repair protein RAD23 homolog A; DNA binding protein, DNA excision repair, proteasomal degrad polyubiquitin; 1.65A {Homo sapiens} PDB: 1p98_A 1p9d_U 1p1a_A Length = 85 Back     alignment and structure
>1uel_A HHR23B, UV excision repair protein RAD23 homolog B; UBL, UIM, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 95 Back     alignment and structure
>3dbh_I NEDD8; cell cycle, activating enzyme, apoptosis, membrane, UBL conjugation pathway, ATP-binding, ligase, nucleotide- binding, polymorphism; 2.85A {Homo sapiens} SCOP: k.45.1.1 PDB: 3dbr_I 3dbl_I Length = 88 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>1ndd_A NEDD8, protein (ubiquitin-like protein NEDD8); proteolysis, signaling protei; 1.60A {Homo sapiens} SCOP: d.15.1.1 PDB: 1r4m_I 1r4n_I* 1xt9_B 2ko3_A 3gzn_I* 2bkr_B 2nvu_I* 3dqv_A 1bt0_A Length = 76 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>3u5e_m 60S ribosomal protein L40; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 3u5i_m 4a18_K 4a19_K 4a1b_K 4a1d_K 4adx_5 3izc_p 3izs_p 3iz5_p 3izr_p Length = 128 Back     alignment and structure
>3b1l_X E3 ubiquitin-protein ligase parkin; proteasome, ALFA-beta-protein; 1.85A {Mus musculus} PDB: 1mg8_A 2zeq_A 2knb_A 1iyf_A Length = 76 Back     alignment and structure
>3n3k_B Ubiquitin; hydrolase, protease, thiol protease, DUB, zinc ribbon, inhibitor, ubiqu acetylation, cytoplasm, isopeptide bond, nucleus; 2.60A {Homo sapiens} Length = 85 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2kk8_A Uncharacterized protein AT4G05270; solution arabidopsis thaliana, uncharacterized putative protein, NESG, structural genomics; NMR {Arabidopsis thaliana} Length = 84 Back     alignment and structure
>4fbj_B NEDD8; effector-HOST target complex, glutamine deamidase, deamidati bacterial effector, cell cycle-protein binding complex; 1.60A {Homo sapiens} PDB: 4f8c_B Length = 88 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>1wgd_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; ENDPLASMIC reticulum stress, UBL domain; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 93 Back     alignment and structure
>2hj8_A Interferon-induced 17 kDa protein; HR2873B, human ISG15, structure, northeast structural genomics consortium, protein structure initiative, NESG; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>3phx_B Ubiquitin-like protein ISG15; OTU domain, DE-ubiquitinase, DE-isgylase, hydrolase-protein complex; 1.60A {Homo sapiens} Length = 79 Back     alignment and structure
>3mtn_B UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquitin-specific protease activity, hydrolase, ubiquitin B structural genomics consortium, SGC; 2.70A {Homo sapiens} Length = 85 Back     alignment and structure
>2xzm_9 RPS31E; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_9 Length = 189 Back     alignment and structure
>1sif_A Ubiquitin; hydrophobic mutants, folding, stability, structural protein; 2.18A {Homo sapiens} SCOP: d.15.1.1 Length = 88 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2kdi_A Ubiquitin, vacuolar protein sorting-associated protein 27 fusion protein; ubiquitin interacting motif, UIM, protein domain interface; NMR {Saccharomyces cerevisiae} Length = 114 Back     alignment and structure
>2kdb_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; UBL domain, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>1yx5_B Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo sapiens} SCOP: d.15.1.1 PDB: 1yx6_B Length = 98 Back     alignment and structure
>1we7_A SF3A1 protein; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 1zkh_A Length = 115 Back     alignment and structure
>3k9o_B Ubiquitin, UBB+1; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 2k25_A 2kx0_A Length = 96 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2l7r_A Ubiquitin-like protein FUBI; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; NMR {Homo sapiens} Length = 93 Back     alignment and structure
>2ojr_A Ubiquitin; lanthide-binding TAG, terbium, TB, SAD phasing, protein binding; 2.60A {Homo sapiens} Length = 111 Back     alignment and structure
>3a9j_A Ubiquitin; protein complex, cytoplasm, isopeptide bond, metal-binding, zinc; 1.18A {Mus musculus} PDB: 3a1q_B 2znv_B 3a9k_A 3h7p_A 3jsv_A 3dvg_Y 3dvn_Y 3nob_A 2o6v_D* 3jw0_X 3jvz_X 3nhe_B* 1aar_A 1d3z_A 1f9j_A 1fxt_B 1g6j_A 1nbf_C 1cmx_B 1q5w_B ... Length = 76 Back     alignment and structure
>1v5o_A 1700011N24RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Length = 102 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>1we6_A Splicing factor, putative; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Length = 111 Back     alignment and structure
>3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A Length = 159 Back     alignment and structure
>1wy8_A NP95-like ring finger protein, isoform A; ubiquitin-like domain, NP95/ICBP90-like ring finger (NIRF), ubiquitin ligase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 89 Back     alignment and structure
>3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B Length = 152 Back     alignment and structure
>2faz_A Ubiquitin-like containing PHD and ring finger DOM protein 1; cell cycle, DNA damage, DNA repair, DNA-binding, ligase, Met binding, nuclear protein; 2.00A {Homo sapiens} SCOP: d.15.1.1 Length = 78 Back     alignment and structure
>2gow_A HCG-1 protein, ubiquitin-like protein 3; BC059385, structural genomics, protein structure initiative, PSI; NMR {Homo sapiens} Length = 125 Back     alignment and structure
>1wia_A Hypothetical ubiquitin-like protein (riken cDNA 2010008E23); 'structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Length = 95 Back     alignment and structure
>3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} Length = 172 Back     alignment and structure
>1x1m_A Ubiquitin-like protein SB132; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.15.1.1 Length = 107 Back     alignment and structure
>3plu_A Ubiquitin-like modifier HUB1; ubiquitin-like, HUB-1, SNU66, peptide binding protein; 1.40A {Saccharomyces cerevisiae} PDB: 3plv_A 1m94_A 1p0r_A Length = 93 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query363
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.95
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.95
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.95
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.94
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.94
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.94
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.94
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.94
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.94
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.94
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.94
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 99.94
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.94
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.94
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.94
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.93
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.93
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.93
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.93
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.93
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.93
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.93
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.93
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.93
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.93
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.93
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.93
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.93
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.93
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.92
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.92
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.92
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.92
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.92
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.92
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.92
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.92
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.92
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.92
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.91
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.91
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.91
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.91
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.91
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.91
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.91
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.91
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.91
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.91
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.91
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.91
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.91
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.91
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.9
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.9
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.9
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.9
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.9
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.9
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.9
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.89
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.89
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.89
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.89
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.89
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.89
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.88
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.88
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.88
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.88
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.88
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.88
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.88
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.88
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.88
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.87
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.87
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.86
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.86
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.86
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.86
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.86
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.85
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.84
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.84
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.84
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.83
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.83
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.83
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.82
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.82
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.81
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.81
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.81
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.81
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.81
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.81
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.79
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.79
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.78
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.78
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.78
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.77
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.76
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.76
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.76
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.76
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.75
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.75
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.74
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.73
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.73
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.71
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.69
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.68
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.68
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.67
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.66
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.66
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.66
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.66
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.66
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.65
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.62
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.61
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.61
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.59
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.57
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 99.57
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.56
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.55
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.55
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 99.53
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.5
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.49
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.48
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.48
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.48
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.47
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.47
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.38
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.35
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.34
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.32
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.25
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.17
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.15
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.1
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.1
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.05
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.0
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.95
1v5t_A90 8430435I17RIK protein; hypothetical protein, ubiqu 98.9
1wgg_A96 Ubiquitin carboxyl-terminal hydrolase 14; ubiquiti 98.88
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.81
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.79
3plu_A93 Ubiquitin-like modifier HUB1; ubiquitin-like, HUB- 98.75
1v86_A95 DNA segment, CHR 7, wayne state university 128, ex 98.73
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.71
3shq_A320 UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila 98.7
2kd0_A85 LRR repeats and ubiquitin-like domain-containing p 98.7
1wxv_A92 BAG-family molecular chaperone regulator-1; struct 98.69
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.67
2lxa_A87 Ubiquitin-like protein MDY2; ubiquitin-like domain 98.67
3phx_B79 Ubiquitin-like protein ISG15; OTU domain, DE-ubiqu 98.64
2bwf_A77 Ubiquitin-like protein DSK2; signaling protein, UB 98.62
2kk8_A84 Uncharacterized protein AT4G05270; solution arabid 98.6
4a20_A98 Ubiquitin-like protein MDY2; protein binding, GET- 98.59
2kan_A94 Uncharacterized protein AR3433A; ubiquitin fold, a 98.58
2dzi_A81 Ubiquitin-like protein 4A; GDX, structural genomic 98.58
3v6c_B91 Ubiquitin; structural genomics, structural genomic 98.56
4eew_A88 Large proline-rich protein BAG6; ubiquitin-like fo 98.55
3dbh_I88 NEDD8; cell cycle, activating enzyme, apoptosis, m 98.53
2dzm_A100 FAS-associated factor 1; ubiquitin-like domain, HF 98.51
2hj8_A88 Interferon-induced 17 kDa protein; HR2873B, human 98.51
4fbj_B88 NEDD8; effector-HOST target complex, glutamine dea 98.51
3m62_B106 UV excision repair protein RAD23; armadillo-like r 98.5
2klc_A101 Ubiquilin-1; ubiquitin-like, structural genomics, 98.5
4hcn_B98 Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidas 98.5
2l7r_A93 Ubiquitin-like protein FUBI; structural genomics, 98.5
3mtn_B85 UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquit 98.49
3n3k_B85 Ubiquitin; hydrolase, protease, thiol protease, DU 98.48
4dwf_A90 HLA-B-associated transcript 3; ubiquitin-like doma 98.48
1uh6_A100 Ubiquitin-like 5; beta-grAsp fold, structural geno 98.47
1yqb_A100 Ubiquilin 3; structural genomics consortium, ubiqu 98.46
3m63_B101 Ubiquitin domain-containing protein DSK2; armadill 98.44
1wh3_A87 59 kDa 2'-5'-oligoadenylate synthetase like protei 98.44
2wyq_A85 HHR23A, UV excision repair protein RAD23 homolog A 98.41
1wy8_A89 NP95-like ring finger protein, isoform A; ubiquiti 98.41
1j8c_A125 Ubiquitin-like protein hplic-2; ubiquitin-like dom 98.4
1uel_A95 HHR23B, UV excision repair protein RAD23 homolog B 98.4
1wx8_A96 Riken cDNA 4931431F19; ubiquitin-like domain, ubiq 98.39
1ttn_A106 DC-UBP, dendritic cell-derived ubiquitin-like prot 98.38
1sif_A88 Ubiquitin; hydrophobic mutants, folding, stability 98.38
2faz_A78 Ubiquitin-like containing PHD and ring finger DOM 98.38
1v5o_A102 1700011N24RIK protein; hypothetical protein, ubiqu 98.35
1ndd_A76 NEDD8, protein (ubiquitin-like protein NEDD8); pro 98.35
1wx7_A106 Ubiquilin 3; ubiquitin-like domain, structural gen 98.34
3vdz_A111 Ubiquitin-40S ribosomal protein S27A; gadolinium, 98.33
3a9j_A76 Ubiquitin; protein complex, cytoplasm, isopeptide 98.32
3k9o_B96 Ubiquitin, UBB+1; E2-25K, complex structure, ATP-b 98.31
1wju_A100 NEDD8 ultimate buster-1; ubiquitin-like domain, st 98.3
1x1m_A107 Ubiquitin-like protein SB132; structural genomics, 98.29
1wgd_A93 Homocysteine-responsive endoplasmic reticulum- res 98.28
2ojr_A111 Ubiquitin; lanthide-binding TAG, terbium, TB, SAD 98.27
1yx5_B98 Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo s 98.26
2daf_A118 FLJ35834 protein; hypothetical protein FLJ35834, u 98.26
3u30_A172 Ubiquitin, linear DI-ubiquitin; immune system; 2.4 98.22
2kdi_A114 Ubiquitin, vacuolar protein sorting-associated pro 98.21
2kdb_A99 Homocysteine-responsive endoplasmic reticulum- res 98.21
2fnj_B118 Transcription elongation factor B polypeptide 2; b 98.17
2uyz_B79 Small ubiquitin-related modifier 1; sumoylation, c 98.16
1we6_A111 Splicing factor, putative; structural genomics, ub 98.11
1wyw_B97 Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Ho 98.11
1wia_A95 Hypothetical ubiquitin-like protein (riken cDNA 20 98.11
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.1
3rt3_B159 Ubiquitin-like protein ISG15; ubiquitin-like domai 98.07
3rt3_B159 Ubiquitin-like protein ISG15; ubiquitin-like domai 98.06
3q3f_A189 Ribonuclease/ubiquitin chimeric protein; domain SW 98.06
1we7_A115 SF3A1 protein; structural genomics, ubiquitin-like 98.06
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.04
3l0w_B169 Monoubiquitinated proliferating cell nuclear antig 98.04
2kjr_A95 CG11242; UBL, ubiquitin, ubiquitin-like, structura 98.03
1v6e_A95 Cytoskeleton-associated protein 1; tubulin-specifi 98.02
4ajy_B118 Transcription elongation factor B polypeptide 2; E 98.02
3b1l_X76 E3 ubiquitin-protein ligase parkin; proteasome, AL 97.27
2kj6_A97 Tubulin folding cofactor B; methods development, N 98.01
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.97
4dbg_A105 Ranbp-type and C3HC4-type zinc finger-containing; 97.94
1v2y_A105 3300001G02RIK protein; hypothetical protein, ubiqu 97.92
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.92
3b08_A152 Polyubiquitin-C, ubiquitin; protein complex, signa 97.91
2gow_A125 HCG-1 protein, ubiquitin-like protein 3; BC059385, 97.87
3ai5_A307 Yeast enhanced green fluorescent protein, ubiquit; 97.84
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.84
3u5e_m128 60S ribosomal protein L40; translation, ribosome, 97.84
4b6w_A86 Tubulin-specific chaperone; CAP-Gly, ubiquitin-lik 97.83
1se9_A126 Ubiquitin family; ubiquitin-like, cell-free, wheat 97.83
1t0y_A122 Tubulin folding cofactor B; ubiquitin-like, cytosk 97.82
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.8
1wgh_A116 Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fo 97.8
3b08_A152 Polyubiquitin-C, ubiquitin; protein complex, signa 97.79
3u30_A172 Ubiquitin, linear DI-ubiquitin; immune system; 2.4 97.77
1oqy_A368 HHR23A, UV excision repair protein RAD23 homolog A 97.74
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.71
2dzj_A88 Synaptic glycoprotein SC2; ubiquitin-like fold, st 97.69
3u5c_f152 40S ribosomal protein S31; translation, ribosome, 97.69
1wf9_A107 NPL4 family protein; beta-grAsp fold like domain, 97.52
1wjn_A97 Tubulin-folding protein TBCE; ubiquitin-like domai 97.41
2kzr_A86 Ubiquitin thioesterase OTU1; structural genomics, 97.35
2xzm_9189 RPS31E; ribosome, translation; 3.93A {Tetrahymena 97.27
2io0_B91 Small ubiquitin-related modifier 2 precursor; SUMO 97.2
2io1_B94 Small ubiquitin-related modifier 3 precursor; SUMO 97.05
1wm3_A72 Ubiquitin-like protein SMT3B; ubiquitin fold, half 96.97
3a4r_A79 Nfatc2-interacting protein; ubiquitin fold, coiled 96.96
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.65
2d07_B93 Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Ho 96.3
1wz0_A104 Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-li 96.17
2k8h_A110 Small ubiquitin protein; SUMO, post-translational 95.97
2eke_C106 Ubiquitin-like protein SMT3; UBC9, SUMO binding mo 95.85
3kyd_D115 Small ubiquitin-related modifier 1; SUMO, thioeste 93.99
3pge_A200 SUMO-modified proliferating cell nuclear antigen; 93.11
4efo_A94 Serine/threonine-protein kinase TBK1; ubiquitin li 92.94
3tix_A207 Ubiquitin-like protein SMT3, RNA-induced transcri 92.52
2pjh_A80 Protein NPL4, nuclear protein localization protein 92.01
2jxx_A97 Nfatc2-interacting protein; nuclear factor of acti 87.87
2l76_A95 Nfatc2-interacting protein; ubiquitin-like domain, 84.96
2lz0_A100 Uncharacterized protein; hypothetical leucine rich 82.24
3uf8_A209 Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- 81.58
2lz0_A100 Uncharacterized protein; hypothetical leucine rich 81.15
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
Probab=99.95  E-value=1.3e-26  Score=220.74  Aligned_cols=228  Identities=20%  Similarity=0.328  Sum_probs=207.1

Q ss_pred             cccccccccccccccCCCCChHHhhcccceeecccccCccCChhhhhcCCceeEEEccCCcCccccc-cccCCCCCCEEE
Q 017986           94 ITSRKTDRVRDMKMVPVGKTSSERWKATGVIALAEHNLKAIPDEVWDCSPFIRVLDIRTNSIQCVPD-QIDGLTGLKKLL  172 (363)
Q Consensus        94 ~~~l~~l~~~~~~~~~~~~~~~~~~~~l~~L~l~~n~i~~i~~~~~~~~~~L~~L~L~~n~i~~i~~-~~~~l~~L~~L~  172 (363)
                      ...++.+.+.++.+..+....|..++.|++|++++|.++.++...|..+++|++|+|++|+++.++. .|..+++|++|+
T Consensus        63 ~~~l~~L~L~~n~i~~~~~~~~~~l~~L~~L~Ls~n~i~~i~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~  142 (440)
T 3zyj_A           63 STNTRLLNLHENQIQIIKVNSFKHLRHLEILQLSRNHIRTIEIGAFNGLANLNTLELFDNRLTTIPNGAFVYLSKLKELW  142 (440)
T ss_dssp             CTTCSEEECCSCCCCEECTTTTSSCSSCCEEECCSSCCCEECGGGGTTCSSCCEEECCSSCCSSCCTTTSCSCSSCCEEE
T ss_pred             CCCCcEEEccCCcCCeeCHHHhhCCCCCCEEECCCCcCCccChhhccCCccCCEEECCCCcCCeeCHhHhhccccCceee
Confidence            4568899999999999988899999999999999999999999999999999999999999998865 588999999999


Q ss_pred             cCCCCCCCCCCChHhhcCCCCcCEEEcCCC-cCCCCC-ccccCCCCCCEEEcccCcCCCcchhhcCCCCCCEEeccCCcC
Q 017986          173 LDANDLSNDSISWVQLAKLKHLTVLSISRN-CLNSLP-GILGHLTALQHLDVSNNKLTTLPTEIGLLSKLEVLKANNNRI  250 (363)
Q Consensus       173 L~~n~~~~~~~~~~~~~~l~~L~~L~l~~n-~l~~l~-~~l~~l~~L~~L~l~~n~i~~l~~~~~~~~~L~~L~l~~n~i  250 (363)
                      +++|.+..  ++...|..+++|++|++++| .+..++ ..+..+++|++|++++|.++.+|. +..+++|+.|++++|.+
T Consensus       143 L~~N~i~~--~~~~~~~~l~~L~~L~l~~~~~l~~i~~~~~~~l~~L~~L~L~~n~l~~~~~-~~~l~~L~~L~Ls~N~l  219 (440)
T 3zyj_A          143 LRNNPIES--IPSYAFNRIPSLRRLDLGELKRLSYISEGAFEGLSNLRYLNLAMCNLREIPN-LTPLIKLDELDLSGNHL  219 (440)
T ss_dssp             CCSCCCCE--ECTTTTTTCTTCCEEECCCCTTCCEECTTTTTTCSSCCEEECTTSCCSSCCC-CTTCSSCCEEECTTSCC
T ss_pred             CCCCcccc--cCHHHhhhCcccCEeCCCCCCCcceeCcchhhcccccCeecCCCCcCccccc-cCCCcccCEEECCCCcc
Confidence            99999985  45457899999999999985 677776 468889999999999999999874 78899999999999999


Q ss_pred             ccC-CccccCCCCCcEEECCCCCCCCC-ChhccCCCCCCEEECCCCCCCCCChhhhhCCCCCCEEEccCCccchhh
Q 017986          251 SFL-PESIGNCTSLIEIDLSSNLLSEL-PVTLENLHYLKALHLDNNALKSLPTTLFSKCVQLSTLELHNTEITMDA  324 (363)
Q Consensus       251 ~~~-~~~~~~~~~L~~L~L~~n~l~~l-~~~~~~~~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~n~i~~~~  324 (363)
                      +.+ +..+..+++|+.|++++|.++.+ +..+..+++|+.|+|++|+++.++...|..+++|+.|+|++|++.|++
T Consensus       220 ~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~N~l~~~~~~~~~~l~~L~~L~L~~Np~~CdC  295 (440)
T 3zyj_A          220 SAIRPGSFQGLMHLQKLWMIQSQIQVIERNAFDNLQSLVEINLAHNNLTLLPHDLFTPLHHLERIHLHHNPWNCNC  295 (440)
T ss_dssp             CEECTTTTTTCTTCCEEECTTCCCCEECTTSSTTCTTCCEEECTTSCCCCCCTTTTSSCTTCCEEECCSSCEECSS
T ss_pred             CccChhhhccCccCCEEECCCCceeEEChhhhcCCCCCCEEECCCCCCCccChhHhccccCCCEEEcCCCCccCCC
Confidence            976 46789999999999999999977 556889999999999999999999999999999999999999999876
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1v5t_A 8430435I17RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 2kx3_A Back     alignment and structure
>1wgg_A Ubiquitin carboxyl-terminal hydrolase 14; ubiquitin specific protease 14, USP14, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3plu_A Ubiquitin-like modifier HUB1; ubiquitin-like, HUB-1, SNU66, peptide binding protein; 1.40A {Saccharomyces cerevisiae} PDB: 3plv_A 1m94_A 1p0r_A Back     alignment and structure
>1v86_A DNA segment, CHR 7, wayne state university 128, expressed; ubiquitin fold, structural genomics, D7WSU128E protein; HET: DNA; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} Back     alignment and structure
>2kd0_A LRR repeats and ubiquitin-like domain-containing protein AT2G30105; ubiquitin-like protein, NESG, leucine-rich repeat, structural genomics; NMR {Arabidopsis thaliana} Back     alignment and structure
>1wxv_A BAG-family molecular chaperone regulator-1; structural genomics, apoptosis, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2lxa_A Ubiquitin-like protein MDY2; ubiquitin-like domain, protein-protein interaction, SGT2 BIN domain, GET pathway, protein binding; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3phx_B Ubiquitin-like protein ISG15; OTU domain, DE-ubiquitinase, DE-isgylase, hydrolase-protein complex; 1.60A {Homo sapiens} Back     alignment and structure
>2bwf_A Ubiquitin-like protein DSK2; signaling protein, UBA, signaling proteins; 1.15A {Saccharomyces cerevisiae} SCOP: d.15.1.1 PDB: 2bwe_S Back     alignment and structure
>2kk8_A Uncharacterized protein AT4G05270; solution arabidopsis thaliana, uncharacterized putative protein, NESG, structural genomics; NMR {Arabidopsis thaliana} Back     alignment and structure
>4a20_A Ubiquitin-like protein MDY2; protein binding, GET-pathway, tail-anchored proteins; 1.78A {Saccharomyces cerevisiae} PDB: 2lxc_A 4goc_A Back     alignment and structure
>2kan_A Uncharacterized protein AR3433A; ubiquitin fold, alpha+beta, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} Back     alignment and structure
>2dzi_A Ubiquitin-like protein 4A; GDX, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3v6c_B Ubiquitin; structural genomics, structural genomics consortium, SGC, UB protease, hydrolase-signaling protein complex; 1.70A {Homo sapiens} PDB: 3v6e_B Back     alignment and structure
>4eew_A Large proline-rich protein BAG6; ubiquitin-like fold, GP78-binding, chaperone; 1.30A {Homo sapiens} Back     alignment and structure
>3dbh_I NEDD8; cell cycle, activating enzyme, apoptosis, membrane, UBL conjugation pathway, ATP-binding, ligase, nucleotide- binding, polymorphism; 2.85A {Homo sapiens} SCOP: d.15.1.1 PDB: 3dbr_I 3dbl_I Back     alignment and structure
>2dzm_A FAS-associated factor 1; ubiquitin-like domain, HFAF1, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2hj8_A Interferon-induced 17 kDa protein; HR2873B, human ISG15, structure, northeast structural genomics consortium, protein structure initiative, NESG; NMR {Homo sapiens} Back     alignment and structure
>4fbj_B NEDD8; effector-HOST target complex, glutamine deamidase, deamidati bacterial effector, cell cycle-protein binding complex; 1.60A {Homo sapiens} PDB: 4f8c_B Back     alignment and structure
>3m62_B UV excision repair protein RAD23; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2klc_A Ubiquilin-1; ubiquitin-like, structural genomics, PSI-2, protein structur initiative, northeast structural genomics consortium, NESG; NMR {Homo sapiens} Back     alignment and structure
>4hcn_B Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidase, NEDD8, protein binding; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2l7r_A Ubiquitin-like protein FUBI; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; NMR {Homo sapiens} Back     alignment and structure
>3mtn_B UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquitin-specific protease activity, hydrolase, ubiquitin B structural genomics consortium, SGC; 2.70A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3n3k_B Ubiquitin; hydrolase, protease, thiol protease, DUB, zinc ribbon, inhibitor, ubiqu acetylation, cytoplasm, isopeptide bond, nucleus; 2.60A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>4dwf_A HLA-B-associated transcript 3; ubiquitin-like domain, BAT3 protein, PF00240, structural GEN joint center for structural genomics, JCSG; 1.80A {Homo sapiens} PDB: 1wx9_A Back     alignment and structure
>1uh6_A Ubiquitin-like 5; beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1yqb_A Ubiquilin 3; structural genomics consortium, ubiquitin, ubiquitin-like domain, structural genomics, signaling protein SGC; 2.00A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3m63_B Ubiquitin domain-containing protein DSK2; armadillo-like repeats, UBL conjugation pathway, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1wh3_A 59 kDa 2'-5'-oligoadenylate synthetase like protein; P59 OASL, ubiquitin family, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2wyq_A HHR23A, UV excision repair protein RAD23 homolog A; DNA binding protein, DNA excision repair, proteasomal degrad polyubiquitin; 1.65A {Homo sapiens} PDB: 1p98_A 1p9d_U 1p1a_A Back     alignment and structure
>1wy8_A NP95-like ring finger protein, isoform A; ubiquitin-like domain, NP95/ICBP90-like ring finger (NIRF), ubiquitin ligase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1j8c_A Ubiquitin-like protein hplic-2; ubiquitin-like domain, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1uel_A HHR23B, UV excision repair protein RAD23 homolog B; UBL, UIM, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1wx8_A Riken cDNA 4931431F19; ubiquitin-like domain, ubiquilin 1-like, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1ttn_A DC-UBP, dendritic cell-derived ubiquitin-like protein; ubiquitin-like domain, solution structure, signaling protein; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1sif_A Ubiquitin; hydrophobic mutants, folding, stability, structural protein; 2.18A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2faz_A Ubiquitin-like containing PHD and ring finger DOM protein 1; cell cycle, DNA damage, DNA repair, DNA-binding, ligase, Met binding, nuclear protein; 2.00A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1v5o_A 1700011N24RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1ndd_A NEDD8, protein (ubiquitin-like protein NEDD8); proteolysis, signaling protei; 1.60A {Homo sapiens} SCOP: d.15.1.1 PDB: 1r4m_I 1r4n_I* 1xt9_B 2ko3_A 3gzn_I* 2bkr_B 2nvu_I* 3dqv_A 1bt0_A Back     alignment and structure
>1wx7_A Ubiquilin 3; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3vdz_A Ubiquitin-40S ribosomal protein S27A; gadolinium, MRI contrast agent, peptide-based contrast agent lanthanide binding TAG; 2.40A {Synthetic construct} PDB: 2ojr_A Back     alignment and structure
>3a9j_A Ubiquitin; protein complex, cytoplasm, isopeptide bond, metal-binding, zinc; 1.18A {Mus musculus} PDB: 3a1q_B 2znv_B 3a9k_A 3h7p_A 3jsv_A 3dvg_Y 3dvn_Y 3nob_A 2o6v_D* 3jw0_X 3jvz_X 3nhe_B* 1aar_A 1d3z_A 1f9j_A 1fxt_B 1g6j_A 1nbf_C 1cmx_B 1q5w_B ... Back     alignment and structure
>3k9o_B Ubiquitin, UBB+1; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 2k25_A 2kx0_A Back     alignment and structure
>1wju_A NEDD8 ultimate buster-1; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1x1m_A Ubiquitin-like protein SB132; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1wgd_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; ENDPLASMIC reticulum stress, UBL domain; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2ojr_A Ubiquitin; lanthide-binding TAG, terbium, TB, SAD phasing, protein binding; 2.60A {Homo sapiens} Back     alignment and structure
>1yx5_B Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo sapiens} SCOP: d.15.1.1 PDB: 1yx6_B Back     alignment and structure
>2daf_A FLJ35834 protein; hypothetical protein FLJ35834, ubiquitin-like domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} Back     alignment and structure
>2kdi_A Ubiquitin, vacuolar protein sorting-associated protein 27 fusion protein; ubiquitin interacting motif, UIM, protein domain interface; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2kdb_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; UBL domain, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>2fnj_B Transcription elongation factor B polypeptide 2; beta-sandwich, lectin-like, SPRY, protein transport/signaling protein complex; 1.80A {Mus musculus} SCOP: d.15.1.1 PDB: 1lm8_B 1lqb_A 1vcb_A 2c9w_B 2izv_B 2jz3_B 2xai_C 3dcg_A 3zrc_A* 3zrf_A Back     alignment and structure
>2uyz_B Small ubiquitin-related modifier 1; sumoylation, cell division, nuclear protein, ubiquitin-like modifier, UBL conjugation pathway; 1.4A {Homo sapiens} SCOP: d.15.1.1 PDB: 2vrr_B 2iy0_B 2iy1_B 2g4d_B 2las_A 2io2_B 1z5s_B 3uip_B* 1tgz_B* 2bf8_B Back     alignment and structure
>1we6_A Splicing factor, putative; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>1wyw_B Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 1y8r_C* 2asq_A 2pe6_B 1a5r_A 2kqs_A 3kyc_D* 3rzw_C Back     alignment and structure
>1wia_A Hypothetical ubiquitin-like protein (riken cDNA 2010008E23); 'structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A Back     alignment and structure
>3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A Back     alignment and structure
>3q3f_A Ribonuclease/ubiquitin chimeric protein; domain SWAP, oligomerization, ubiquitin insertion, hydrolase binding; 2.17A {Bacillus amyloliquefaciens} Back     alignment and structure
>1we7_A SF3A1 protein; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 1zkh_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3l0w_B Monoubiquitinated proliferating cell nuclear antigen, proliferating cell nuclear antigen; replication, DNA damage, DNA repair; 2.80A {Saccharomyces cerevisiae} PDB: 3l10_B Back     alignment and structure
>2kjr_A CG11242; UBL, ubiquitin, ubiquitin-like, structural genomics, PSI-2, protein structure initiative; NMR {Drosophila melanogaster} Back     alignment and structure
>1v6e_A Cytoskeleton-associated protein 1; tubulin-specific chaperone B, tubulin folding cofactor B, microtubule, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>4ajy_B Transcription elongation factor B polypeptide 2; E3 ubiquitin ligase, transcription factor, hypoxic signaling transcription; 1.73A {Homo sapiens} PDB: 1lqb_A 1vcb_A 2c9w_B 2izv_B 2jz3_B 2xai_C 3dcg_A 3zrc_A* 3zrf_A 3ztc_A* 3ztd_A* 3zun_A* 1lm8_B 4b95_A* 2fnj_B 4b9k_A* 4awj_A* Back     alignment and structure
>3b1l_X E3 ubiquitin-protein ligase parkin; proteasome, ALFA-beta-protein; 1.85A {Mus musculus} PDB: 1mg8_A 2zeq_A 2knb_A 1iyf_A Back     alignment and structure
>2kj6_A Tubulin folding cofactor B; methods development, NESG, solution PSI-2, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4dbg_A Ranbp-type and C3HC4-type zinc finger-containing; ubiquitin fold, ubiquitination, ligase; 2.71A {Homo sapiens} PDB: 2lgy_A Back     alignment and structure
>1v2y_A 3300001G02RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B Back     alignment and structure
>2gow_A HCG-1 protein, ubiquitin-like protein 3; BC059385, structural genomics, protein structure initiative, PSI; NMR {Homo sapiens} Back     alignment and structure
>3ai5_A Yeast enhanced green fluorescent protein, ubiquit; ubiquitin, fusion protein, fluore protein, transcription; HET: CR2; 1.40A {Aequorea victoria} PDB: 3ako_B* Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3u5e_m 60S ribosomal protein L40; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 3u5i_m 4b6a_m 4a18_K 4a19_K 4a1b_K 4a1d_K 4adx_5 3izc_p 3izs_p 3iz5_p 3izr_p Back     alignment and structure
>4b6w_A Tubulin-specific chaperone; CAP-Gly, ubiquitin-like; HET: MSE; 2.35A {Trypanosoma brucei brucei strain 927} Back     alignment and structure
>1se9_A Ubiquitin family; ubiquitin-like, cell-free, wheat GERM, structural genomics, protein structure initiative, CESG; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>1t0y_A Tubulin folding cofactor B; ubiquitin-like, cytoskeleton, microtubule, CESG, structural genomics, protein structure initiative, PSI; NMR {Caenorhabditis elegans} SCOP: d.15.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1wgh_A Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B Back     alignment and structure
>3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} Back     alignment and structure
>1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>2dzj_A Synaptic glycoprotein SC2; ubiquitin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3u5c_f 40S ribosomal protein S31; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3u5g_f Back     alignment and structure
>1wf9_A NPL4 family protein; beta-grAsp fold like domain, hypothetical protein, structural genomics, NPPSFA; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>1wjn_A Tubulin-folding protein TBCE; ubiquitin-like domain, progressive motor neuropathy, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2kzr_A Ubiquitin thioesterase OTU1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative, hydrolase; NMR {Mus musculus} Back     alignment and structure
>2xzm_9 RPS31E; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_9 Back     alignment and structure
>2io0_B Small ubiquitin-related modifier 2 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.30A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2io1_B Small ubiquitin-related modifier 3 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.60A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1wm3_A Ubiquitin-like protein SMT3B; ubiquitin fold, half-open barrel, two helices, protein transport; 1.20A {Homo sapiens} SCOP: d.15.1.1 PDB: 1wm2_A 3uin_B 3uio_B 2ckh_B Back     alignment and structure
>3a4r_A Nfatc2-interacting protein; ubiquitin fold, coiled coil, cytoplasm, methylation, nucleus, transcription; 1.00A {Mus musculus} PDB: 3a4s_C 3rd2_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>2d07_B Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 2rpq_A 2awt_A 2io3_B 2iyd_B 1u4a_A 2k1f_A Back     alignment and structure
>1wz0_A Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-like molecule, structural genomics, sentrin2, NPPFSA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2k8h_A Small ubiquitin protein; SUMO, post-translational modifier, signaling protein; NMR {Trypanosoma brucei} Back     alignment and structure
>2eke_C Ubiquitin-like protein SMT3; UBC9, SUMO binding motif, SBM, ligase/protein binding complex; 1.90A {Saccharomyces cerevisiae} SCOP: d.15.1.1 Back     alignment and structure
>3kyd_D Small ubiquitin-related modifier 1; SUMO, thioester, adenylation, inhibitor, TETR intermediate, ligase, nucleus, phosphoprotein; HET: VMX; 2.61A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3pge_A SUMO-modified proliferating cell nuclear antigen; DNA replication, DNA binding protein; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>4efo_A Serine/threonine-protein kinase TBK1; ubiquitin like domain, transferase; 1.77A {Homo sapiens} Back     alignment and structure
>3tix_A Ubiquitin-like protein SMT3, RNA-induced transcri silencing complex protein TAS3; PIN, rossmann fold, SPOC, alpha-helical hairpin, heterochrom silencing, RITS, RNAI, argonaute; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>2pjh_A Protein NPL4, nuclear protein localization protein 4 homolog; UFD1, NPL4, AAA, protein binding, transport protein; NMR {Mus musculus} Back     alignment and structure
>2jxx_A Nfatc2-interacting protein; nuclear factor of activated T-cells, cytoplasmic 2- interacting protein, ubiquitin like homologue; NMR {Homo sapiens} Back     alignment and structure
>2l76_A Nfatc2-interacting protein; ubiquitin-like domain, structural genomics, PSI-biology, Pro structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2lz0_A Uncharacterized protein; hypothetical leucine rich repeat protein, structural genomic unknown function; NMR {Bacteroides capillosus} Back     alignment and structure
>3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 4giv_A* 1euv_B 3v60_A 3v61_A 3v62_A* Back     alignment and structure
>2lz0_A Uncharacterized protein; hypothetical leucine rich repeat protein, structural genomic unknown function; NMR {Bacteroides capillosus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 363
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-18
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-08
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 6e-14
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-12
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-10
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-09
d1jl5a_ 353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-08
d1jl5a_ 353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-07
d1jl5a_ 353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-06
d1jl5a_ 353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-04
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-13
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-13
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-11
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 0.002
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 6e-12
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-09
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 8e-09
d2bwfa173 d.15.1.1 (A:2-74) DSK2 {Baker's yeast (Saccharomyc 1e-11
d1v5ta_90 d.15.1.1 (A:) 8430435i17rik protein {Mouse (Mus mu 3e-11
d1v86a_95 d.15.1.1 (A:) hypothetical D7wsu128e protein {Mous 1e-10
d1wxva181 d.15.1.1 (A:7-87) Bag-family molecular chaperone r 1e-09
d1wgga_96 d.15.1.1 (A:) Ubiquitin carboxyl-terminal hydrolas 4e-09
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-08
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-08
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 8e-05
d1wx8a183 d.15.1.1 (A:8-90) 4931431F19Rik {Mouse (Mus muscul 4e-08
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 5e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-07
d1p9ag_ 266 c.10.2.7 (G:) von Willebrand factor binding domain 5e-07
d1p9ag_ 266 c.10.2.7 (G:) von Willebrand factor binding domain 5e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.003
d1j8ca_103 d.15.1.1 (A:) Ubiquitin-like N-terminal domain of 1e-07
d1oqya477 d.15.1.1 (A:1-77) Ubiquitin-like domain of Rad23 h 1e-07
d1t0ya_90 d.15.1.1 (A:) Ubiquitin-like domain of tubulin fol 3e-07
d1uh6a_100 d.15.1.1 (A:) Ubiquitin-like protein 5, ubl5 {Mous 3e-07
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-07
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-07
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-06
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 7e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 0.004
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 3e-07
d2astb2 284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-05
d1z2ma276 d.15.1.1 (A:79-154) Interferon-induced 15 kDa prot 5e-07
d1z2ma176 d.15.1.1 (A:3-78) Interferon-induced 15 kDa protei 7e-07
d1bt0a_73 d.15.1.1 (A:) Rub1 {Mouse-ear cress (Arabidopsis t 8e-07
d1zkha186 d.15.1.1 (A:1-86) Splicing factor 3 subunit 1, C-t 8e-07
d1wgda_93 d.15.1.1 (A:) Homocysteine-responsive endoplasmic 1e-06
d1yqba184 d.15.1.1 (A:15-98) Ubiquilin-3 {Human (Homo sapien 1e-06
d1wiaa_95 d.15.1.1 (A:) Ubiquitin-like protein bab25500 (201 1e-06
d1v2ya_105 d.15.1.1 (A:) Ubiquitin-like protein 3300001g02rik 2e-06
d2zeqa178 d.15.1.1 (A:1-78) Ubiquitin-like domain of parkin 3e-06
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 3e-06
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 3e-06
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 2e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 2e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.002
d2ca6a1 344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 3e-06
d2ca6a1 344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 3e-05
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 4e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.004
d1wjua_100 d.15.1.1 (A:) NEDD8 ultimate buster-1, NUB1 {Human 3e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 4e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 3e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.004
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 5e-06
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 5e-04
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 7e-04
d1wx9a173 d.15.1.1 (A:8-80) Large proline-rich protein BAT3 6e-06
d1x1ma194 d.15.1.1 (A:8-101) Ubiquitin-like protein 7 {Mouse 1e-05
d1se9a_101 d.15.1.1 (A:) Hypothetical protein At3g01050 {Thal 2e-05
d1wgha_116 d.15.1.1 (A:) Ubiquitin-like protein 3, Ubl3 {Mous 2e-05
d2c9wb1103 d.15.1.1 (B:2-104) Elongin B {Human (Homo sapiens) 2e-05
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 4e-05
d1uela_95 d.15.1.1 (A:) Ubiquitin-like domain of Rad23 homol 6e-05
d1euvb_79 d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Baker's yea 3e-04
d1wjna_97 d.15.1.1 (A:) Tubulin-folding protein TbcE {Mouse 3e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 4e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 6e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 7e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.004
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 4e-04
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 0.004
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 0.004
d1v5oa_102 d.15.1.1 (A:) 1700011n24rik protein {Mouse (Mus mu 5e-04
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 7e-04
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 0.002
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

 Score = 82.4 bits (202), Expect = 4e-18
 Identities = 40/178 (22%), Positives = 75/178 (42%), Gaps = 29/178 (16%)

Query: 139 WDCSPFIRVLDIRTNSIQCVPDQIDGLTGLKKLLLDANDLSNDSISWVQLAKLKHLTVLS 198
                 +  L +  N ++ +   +  LT L  L L  N +SN       L+ L  LT L 
Sbjct: 215 LGILTNLDELSLNGNQLKDIG-TLASLTNLTDLDLANNQISN----LAPLSGLTKLTELK 269

Query: 199 ISRNCLNSLPGILG---------------------HLTALQHLDVSNNKLTTLPTEIGLL 237
           +  N ++++  + G                     +L  L +L +  N ++ +   +  L
Sbjct: 270 LGANQISNISPLAGLTALTNLELNENQLEDISPISNLKNLTYLTLYFNNISDIS-PVSSL 328

Query: 238 SKLEVLKANNNRISFLPESIGNCTSLIEIDLSSNLLSELPVTLENLHYLKALHLDNNA 295
           +KL+ L   NN++S +  S+ N T++  +    N +S+L   L NL  +  L L++ A
Sbjct: 329 TKLQRLFFANNKVSDVS-SLANLTNINWLSAGHNQISDLT-PLANLTRITQLGLNDQA 384
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d2bwfa1 d.15.1.1 (A:2-74) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 73 Back     information, alignment and structure
>d1v5ta_ d.15.1.1 (A:) 8430435i17rik protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 90 Back     information, alignment and structure
>d1v86a_ d.15.1.1 (A:) hypothetical D7wsu128e protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 95 Back     information, alignment and structure
>d1wxva1 d.15.1.1 (A:7-87) Bag-family molecular chaperone regulator-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 81 Back     information, alignment and structure
>d1wgga_ d.15.1.1 (A:) Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (Mus musculus) [TaxId: 10090]} Length = 96 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1wx8a1 d.15.1.1 (A:8-90) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} Length = 83 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1j8ca_ d.15.1.1 (A:) Ubiquitin-like N-terminal domain of PLIC-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1oqya4 d.15.1.1 (A:1-77) Ubiquitin-like domain of Rad23 homolog A (Hhr23a) {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1t0ya_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 90 Back     information, alignment and structure
>d1uh6a_ d.15.1.1 (A:) Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 100 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1z2ma2 d.15.1.1 (A:79-154) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1z2ma1 d.15.1.1 (A:3-78) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1bt0a_ d.15.1.1 (A:) Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 73 Back     information, alignment and structure
>d1zkha1 d.15.1.1 (A:1-86) Splicing factor 3 subunit 1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d1wgda_ d.15.1.1 (A:) Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein, HERPUD1 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1yqba1 d.15.1.1 (A:15-98) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1wiaa_ d.15.1.1 (A:) Ubiquitin-like protein bab25500 (2010008E23Rik) {Mouse (Mus musculus) [TaxId: 10090]} Length = 95 Back     information, alignment and structure
>d1v2ya_ d.15.1.1 (A:) Ubiquitin-like protein 3300001g02rik {Mouse (Mus musculus) [TaxId: 10090]} Length = 105 Back     information, alignment and structure
>d2zeqa1 d.15.1.1 (A:1-78) Ubiquitin-like domain of parkin {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1wjua_ d.15.1.1 (A:) NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1wx9a1 d.15.1.1 (A:8-80) Large proline-rich protein BAT3 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure
>d1x1ma1 d.15.1.1 (A:8-101) Ubiquitin-like protein 7 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1se9a_ d.15.1.1 (A:) Hypothetical protein At3g01050 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 101 Back     information, alignment and structure
>d1wgha_ d.15.1.1 (A:) Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 116 Back     information, alignment and structure
>d2c9wb1 d.15.1.1 (B:2-104) Elongin B {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1uela_ d.15.1.1 (A:) Ubiquitin-like domain of Rad23 homolog B (Hhr23B) {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1euvb_ d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]} Length = 79 Back     information, alignment and structure
>d1wjna_ d.15.1.1 (A:) Tubulin-folding protein TbcE {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1v5oa_ d.15.1.1 (A:) 1700011n24rik protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 102 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query363
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.91
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.9
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.9
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.86
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.85
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.85
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.84
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.84
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.84
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.83
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.8
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.79
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.79
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.78
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.78
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.77
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.77
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.74
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.67
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.65
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.65
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.64
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.63
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.61
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.55
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.54
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.53
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.5
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.49
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.48
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.46
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.41
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.4
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.34
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.32
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.1
d1v5ta_90 8430435i17rik protein {Mouse (Mus musculus) [TaxId 98.98
d2bwfa173 DSK2 {Baker's yeast (Saccharomyces cerevisiae) [Ta 98.98
d1wgga_96 Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (M 98.86
d1wh3a_87 2'-5'-oligoadenylate synthetase-like protein, OASL 98.81
d1v86a_95 hypothetical D7wsu128e protein {Mouse (Mus musculu 98.77
d1m94a_73 Ubiquitin-like modifier protein hub1 {Baker's yeas 98.75
d1z2ma276 Interferon-induced 15 kDa protein {Human (Homo sap 98.75
d1wxva181 Bag-family molecular chaperone regulator-1 {Human 98.69
d2zeqa178 Ubiquitin-like domain of parkin {Mouse (Mus muscul 98.68
d1bt0a_73 Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxI 98.66
d1wx8a183 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090] 98.64
d1ttna180 Dendritic cell-derived ubiquitin-like protein {Hum 98.64
d1ogwa_76 Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} 98.63
d1yqba184 Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} 98.63
d1j8ca_103 Ubiquitin-like N-terminal domain of PLIC-2 {Human 98.6
d1uh6a_100 Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculu 98.59
d1z2ma176 Interferon-induced 15 kDa protein {Human (Homo sap 98.58
d1oqya477 Ubiquitin-like domain of Rad23 homolog A (Hhr23a) 98.57
d1wx9a173 Large proline-rich protein BAT3 {Human (Homo sapie 98.49
d2faza176 Ubiquitin-like PHD and RING finger domain-containi 98.46
d1wy8a176 Ubiquitin-like PHD and RING finger domain-containi 98.43
d1uela_95 Ubiquitin-like domain of Rad23 homolog B (Hhr23B) 98.34
d1wgha_116 Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculu 98.29
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.29
d1v2ya_105 Ubiquitin-like protein 3300001g02rik {Mouse (Mus m 98.28
d1v5oa_102 1700011n24rik protein {Mouse (Mus musculus) [TaxId 98.28
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.24
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.21
d1wjua_100 NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens 98.2
d1we6a_111 Splicing factor 3 subunit 1, C-terminal domain {Th 98.16
d1zkha186 Splicing factor 3 subunit 1, C-terminal domain {Hu 98.15
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.1
d1wiaa_95 Ubiquitin-like protein bab25500 (2010008E23Rik) {M 98.1
d1se9a_101 Hypothetical protein At3g01050 {Thale cress (Arabi 98.06
d1v6ea_95 Ubiquitin-like domain of tubulin folding cofactor 98.01
d2c9wb1103 Elongin B {Human (Homo sapiens) [TaxId: 9606]} 97.94
d1wgda_93 Homocysteine-responsive endoplasmic reticulum-resi 97.72
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.68
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.65
d1t0ya_90 Ubiquitin-like domain of tubulin folding cofactor 97.56
d1wjna_97 Tubulin-folding protein TbcE {Mouse (Mus musculus) 97.51
d1euvb_79 SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomy 97.4
d2uyzb177 SUMO-1 (smt3 homologue) {Human (Homo sapiens) [Tax 96.51
d1x1ma194 Ubiquitin-like protein 7 {Mouse (Mus musculus) [Ta 95.04
d1wm3a_72 SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} 93.46
d1wf9a194 NPL4-like protein 1 {Thale cress (Arabidopsis thal 82.38
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: von Willebrand factor binding domain of glycoprotein Ib alpha
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.91  E-value=2.8e-23  Score=182.27  Aligned_cols=198  Identities=29%  Similarity=0.371  Sum_probs=172.4

Q ss_pred             cccceeecccccCccCChhhhhcCCceeEEEccCCcCcccc-ccccCCCCCCEEEcCCCCCCCCCCChHhhcCCCCcCEE
Q 017986          119 KATGVIALAEHNLKAIPDEVWDCSPFIRVLDIRTNSIQCVP-DQIDGLTGLKKLLLDANDLSNDSISWVQLAKLKHLTVL  197 (363)
Q Consensus       119 ~~l~~L~l~~n~i~~i~~~~~~~~~~L~~L~L~~n~i~~i~-~~~~~l~~L~~L~L~~n~~~~~~~~~~~~~~l~~L~~L  197 (363)
                      ..+.+++.+++.++.+|.++.   +++++|+|++|+++.++ ..|.++++|++|++++|.++.  ++  .+..+++|++|
T Consensus        10 ~~~~~v~C~~~~L~~iP~~lp---~~l~~L~Ls~N~i~~l~~~~f~~l~~L~~L~L~~N~l~~--l~--~~~~l~~L~~L   82 (266)
T d1p9ag_          10 ASHLEVNCDKRNLTALPPDLP---KDTTILHLSENLLYTFSLATLMPYTRLTQLNLDRAELTK--LQ--VDGTLPVLGTL   82 (266)
T ss_dssp             TTCCEEECTTSCCSSCCSCCC---TTCCEEECTTSCCSEEEGGGGTTCTTCCEEECTTSCCCE--EE--CCSCCTTCCEE
T ss_pred             CCCeEEEccCCCCCeeCcCcC---cCCCEEECcCCcCCCcCHHHhhccccccccccccccccc--cc--ccccccccccc
Confidence            344567899999999997653   57999999999999886 468899999999999999874  32  35678999999


Q ss_pred             EcCCCcCCCCCccccCCCCCCEEEcccCcCCCcc-hhhcCCCCCCEEeccCCcCccCCcc-ccCCCCCcEEECCCCCCCC
Q 017986          198 SISRNCLNSLPGILGHLTALQHLDVSNNKLTTLP-TEIGLLSKLEVLKANNNRISFLPES-IGNCTSLIEIDLSSNLLSE  275 (363)
Q Consensus       198 ~l~~n~l~~l~~~l~~l~~L~~L~l~~n~i~~l~-~~~~~~~~L~~L~l~~n~i~~~~~~-~~~~~~L~~L~L~~n~l~~  275 (363)
                      ++++|+++.++..+..+++|+.|+++++.+..++ ..+..+.+++.|++++|.+..++.. +..+++++.+++++|.++.
T Consensus        83 ~Ls~N~l~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~l~~l~~L~l~~n~l~~l~~~~~~~l~~l~~l~l~~N~l~~  162 (266)
T d1p9ag_          83 DLSHNQLQSLPLLGQTLPALTVLDVSFNRLTSLPLGALRGLGELQELYLKGNELKTLPPGLLTPTPKLEKLSLANNNLTE  162 (266)
T ss_dssp             ECCSSCCSSCCCCTTTCTTCCEEECCSSCCCCCCSSTTTTCTTCCEEECTTSCCCCCCTTTTTTCTTCCEEECTTSCCSC
T ss_pred             ccccccccccccccccccccccccccccccceeeccccccccccccccccccccceeccccccccccchhcccccccccc
Confidence            9999999998888899999999999999998774 5567889999999999999988754 6778999999999999998


Q ss_pred             CC-hhccCCCCCCEEECCCCCCCCCChhhhhCCCCCCEEEccCCccchhh
Q 017986          276 LP-VTLENLHYLKALHLDNNALKSLPTTLFSKCVQLSTLELHNTEITMDA  324 (363)
Q Consensus       276 l~-~~~~~~~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~n~i~~~~  324 (363)
                      ++ ..+..+++|++|+|++|.|+.+|.++| .+++|+.|+|++|++.|++
T Consensus       163 ~~~~~~~~l~~L~~L~Ls~N~L~~lp~~~~-~~~~L~~L~L~~Np~~CdC  211 (266)
T d1p9ag_         163 LPAGLLNGLENLDTLLLQENSLYTIPKGFF-GSHLLPFAFLHGNPWLCNC  211 (266)
T ss_dssp             CCTTTTTTCTTCCEEECCSSCCCCCCTTTT-TTCCCSEEECCSCCBCCSG
T ss_pred             cCccccccccccceeecccCCCcccChhHC-CCCCCCEEEecCCCCCCCc
Confidence            85 457889999999999999999998755 6899999999999999875
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5ta_ d.15.1.1 (A:) 8430435i17rik protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bwfa1 d.15.1.1 (A:2-74) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wgga_ d.15.1.1 (A:) Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wh3a_ d.15.1.1 (A:) 2'-5'-oligoadenylate synthetase-like protein, OASL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v86a_ d.15.1.1 (A:) hypothetical D7wsu128e protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1m94a_ d.15.1.1 (A:) Ubiquitin-like modifier protein hub1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z2ma2 d.15.1.1 (A:79-154) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wxva1 d.15.1.1 (A:7-87) Bag-family molecular chaperone regulator-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2zeqa1 d.15.1.1 (A:1-78) Ubiquitin-like domain of parkin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bt0a_ d.15.1.1 (A:) Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wx8a1 d.15.1.1 (A:8-90) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ttna1 d.15.1.1 (A:21-100) Dendritic cell-derived ubiquitin-like protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogwa_ d.15.1.1 (A:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yqba1 d.15.1.1 (A:15-98) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8ca_ d.15.1.1 (A:) Ubiquitin-like N-terminal domain of PLIC-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uh6a_ d.15.1.1 (A:) Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z2ma1 d.15.1.1 (A:3-78) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oqya4 d.15.1.1 (A:1-77) Ubiquitin-like domain of Rad23 homolog A (Hhr23a) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wx9a1 d.15.1.1 (A:8-80) Large proline-rich protein BAT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2faza1 d.15.1.1 (A:1-76) Ubiquitin-like PHD and RING finger domain-containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wy8a1 d.15.1.1 (A:8-83) Ubiquitin-like PHD and RING finger domain-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uela_ d.15.1.1 (A:) Ubiquitin-like domain of Rad23 homolog B (Hhr23B) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgha_ d.15.1.1 (A:) Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v2ya_ d.15.1.1 (A:) Ubiquitin-like protein 3300001g02rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v5oa_ d.15.1.1 (A:) 1700011n24rik protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjua_ d.15.1.1 (A:) NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1we6a_ d.15.1.1 (A:) Splicing factor 3 subunit 1, C-terminal domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zkha1 d.15.1.1 (A:1-86) Splicing factor 3 subunit 1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1wiaa_ d.15.1.1 (A:) Ubiquitin-like protein bab25500 (2010008E23Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1se9a_ d.15.1.1 (A:) Hypothetical protein At3g01050 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1v6ea_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c9wb1 d.15.1.1 (B:2-104) Elongin B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgda_ d.15.1.1 (A:) Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein, HERPUD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1t0ya_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1wjna_ d.15.1.1 (A:) Tubulin-folding protein TbcE {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1euvb_ d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]} Back     information, alignment and structure
>d2uyzb1 d.15.1.1 (B:20-96) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ma1 d.15.1.1 (A:8-101) Ubiquitin-like protein 7 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wm3a_ d.15.1.1 (A:) SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf9a1 d.15.1.1 (A:8-101) NPL4-like protein 1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure