Citrus Sinensis ID: 018003

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360--
MATIVSSSSFFSVSLPGRLGNSRRCSVKPNPSPIFIRKFVAKIRASSTAFVETKPSEPSFVENEASTSKNVLACPICYKPLTWIGDSSLSIESAAGSSLQCNTCKKTYSGVGTHFDMTAASGSKDYGELMSPATEFFRMPFMSFIYERGWRQNFVWGGFPGPEKEFELMKGYLKPVLGGNIIDASCGSGLFSRIFAKSGLFSLVVALDYSENMLKQCYEFVQQESNFPKENFLLVRADISRLPFASSSIDAVHAGAAIHCWSSPSTGVAEISRVLRPGGVFVGTTYIVDGPFNLIPFSRLLRQVCFLDLKIVGFSIPVLGFDDLKRIFRQFQLVVNLKLFYGHIQHYIVKIPSLCNLLNYVN
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccCCcccccccccccccEEccccccccccccccccccHHHHcccHHHHHHHHHHHHHHccccccccHHHHHHHHHcccccccccEEEEcccccHHHHHHHHHccccEEEEEEccHHHHHHHHHHHHHccccccccEEEEEcccccccccccccHHHHHHHHccccccHHHHHHHHccccccccEEEEEEccccccccccHHHHHHHHHHcccHHHcccccccccHHHHHHHHHHcccEEEEEEEcccEEEEEEEccHHHHHHHccc
********************************PIFIRKFVAKIRAS***********************NVLACPICYKPLTWIGDSSLSIESAAGSSLQCNTCKKTYSGVGTHFDMTAASGSKDYGELMSPATEFFRMPFMSFIYERGWRQNFVWGGFPGPEKEFELMKGYLKPVLGGNIIDASCGSGLFSRIFAKSGLFSLVVALDYSENMLKQCYEFVQQESNFPKENFLLVRADISRLPFASSSIDAVHAGAAIHCWSSPSTGVAEISRVLRPGGVFVGTTYIVDGPFNLIPFSRLLRQVCFLDLKIVGFSIPVLGFDDLKRIFRQFQLVVNLKLFYGHIQHYIVKIPSLCNLLNYVN
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATIVSSSSFFSVSLPGRLGNSRRCSVKPNPSPIFIRKFVAKIRASSTAFVETKPSEPSFVENEASTSKNVLACPICYKPLTWIGDSSLSIESAAGSSLQCNTCKKTYSGVGTHFDMTAASGSKDYGELMSPATEFFRMPFMSFIYERGWRQNFVWGGFPGPEKEFELMKGYLKPVLGGNIIDASCGSGLFSRIFAKSGLFSLVVALDYSENMLKQCYEFVQQESNFPKENFLLVRADISRLPFASSSIDAVHAGAAIHCWSSPSTGVAEISRVLRPGGVFVGTTYIVDGPFNLIPFSRLLRQVCFLDLKIVGFSIPVLGFDDLKRIFRQFQLVVNLKLFYGHIQHYIVKIPSLCNLLNYVN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Uncharacterized methyltransferase At1g78140, chloroplastic probableQ8LBV4

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1VE3, chain A
Confidence level:very confident
Coverage over the Query: 169-352
View the alignment between query and template
View the model in PyMOL
Template: 1P91, chain A
Confidence level:very confident
Coverage over the Query: 71-85,97-138,150-289
View the alignment between query and template
View the model in PyMOL