Citrus Sinensis ID: 018006


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360--
MDDGQDFARDLLPKYFKHNNFSSFIRQLNTYGFRKVDPEQWEFANEDFVRGQPERLKNIHRRKPVHSHSNQNLHGQGTPLTESERQGLKDDIERLKKEKEILLLELQRHEQERQGFESQMQLLRERFQLMEQRQQKMVSFVGRALQKPGLESNFGAHLENHDRKRRLPRIDYFYDEANIEDNPMGTSQIVAGADSADISSSNMEKFEQLESSMTFWENIVQDVGQSCFQPNSSLELDESTSCADSPAISCIQLNVDARPKSPGIDMNSEPAVTAATEPVPSKEPETATTIPLQAGVNDVFWEQFLTENPGSSDAQEVQSERKECDGKKNENKPADHGKFWWNMRNVNSLAEQMGHLTPAERT
cccHHHHHHHccccccccccccHHHHHccccccccccccccEEcccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHccHHHccccccccccccccccccccccccHHHHHHHHccccccccc
**DGQDFARDLLPKYFKHNNFSSFIRQLNTYGFRKVDPEQWEFANEDFVRGQPERL***************************************************RHEQERQGFESQMQLLR*******QRQQKMVSFVGRA******************************************************************************************************************************************************GVNDVFWEQFL**********************************WWNMR*VNSLA************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDDGQDFARDLLPKYFKHNNFSSFIRQLNTYGFRKVDPEQWEFANEDFVRGQPERLKNIHRRKPVHSHSNQNLHGQGTPLTESExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxQQKMVSFVGRALQKPGLESNFGAHLENHDRKRRLPRIDYFYDEANIEDNPMGTSQIVAGADSADISSSNMEKFEQLESSMTFWENIVQDVGQSCFQPNSSLELDESTSCADSPAISCIQLNVDARPKSPGIDMNSEPAVTAATEPVPSKEPETATTIPLQAGVNDVFWEQFLTENPGSSDAQEVQSERKECDGKKNENKPADHGKFWWNMRNVNSLAEQMGHLTPAERT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Heat stress transcription factor A-4a Transcriptional activator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE).probableO49403

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2LDU, chain A
Confidence level:very confident
Coverage over the Query: 1-65
View the alignment between query and template
View the model in PyMOL
Template: 2JEE, chain A
Confidence level:probable
Coverage over the Query: 89-139
View the alignment between query and template
View the model in PyMOL