Citrus Sinensis ID: 018014


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360--
MHPSFKKVQMLESDNFITELNQPLNMATDPPFHQAYKSLIEDTSNNIFGKKLVLVEECELPLIDLSRILHNDNVVDESEREECKEEIARASQQWGFFQVTNHGISKDLLEKMREEQVKVFKQPFDKKSKEDKFMNFPAGSYRWGTPTATCLNQLSWSEAFHIPMADISASAAAFTTLSSTLEQFATTVAGLARKLTAILAEKLGRESTFFQENCLPSTCYLRMNRYPPCPVPSAIHGLMPHTDSDFLTILHQDEVGGLQLVKDGKWIAVKPNPEALIVNIGDLFQAWSNDVYKSVEHRVVTNPSTERFSIAYFFCPSYDTVIQNSEPSNYRKFSFREFRLQVQEDVQKYGHKVGLPRFLISH
ccccccccHHcccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccccHHHHHHHHHHHHHHHHHccEEEEEcccccHHHHHHHHHHHHHHHcccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHcccccCEEEEccccccccccccccccccccccccEEEEccccccEEEEEccEEEEcccccccEEEEcccEEHHHccccccccccccccccccccEEEEEEEccccccccccccccccccccHHHHHHHHHHHHHHcccccccccccccc
****FKK*********************DPPFHQAYKSLIEDTSN***GKKLVLVEECELPLIDLSRILHNDN*******EECKEEIARASQQWGFFQVTNHGISKDLLEKMREEQVKVFKQPFDKKSK***FMNFPAGSYRWGTPTATCLNQLSWSEAFHIPMADISASAAAFTTLSSTLEQFATTVAGLARKLTAILAEKLGRESTFFQENCLPSTCYLRMNRYPPCPVPSAIHGLMPHTDSDFLTILHQDEVGGLQLVKDGKWIAVKPNPEALIVNIGDLFQAWSNDVYKSVEHRVVTNPSTERFSIAYFFCPSYDTVIQNSEPSNYRKFSFREFRLQVQEDVQKYGHKVGLPRFLIS*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHPSFKKVQMLESDNFITELNQPLNMATDPPFHQAYKSLIEDTSNNIFGKKLVLVEECELPLIDLSRILHNDxxxxxxxxxxxxxxxxxxxxxWGFFQVTNHGISKDLLEKMREEQVKVFKQPFDKKSKEDKFMNFPAGSYRWGTPTATCLNQLSWSEAFHIPMADISASAAAFTTLSSTLEQFATTVAGLARKLTAILAEKLGRESTFFQENCLPSTCYLRMNRYPPCPVPSAIHGLMPHTDSDFLTILHQDEVGGLQLVKDGKWIAVKPNPEALIVNIGDLFQAWSNDVYKSVEHRVVTNPSTERFSIAYFFCPSYDTVIQNSEPSNYRKFSFREFRLQVQEDVQKYGHKVGLPRFLISH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Gibberellin 2-beta-dioxygenase 8 Catalyzes the 2-beta-hydroxylation of gibberellins (GA) precursors, rendering them unable to be converted to active GAs. Hydroxylates the C20-GA GA12 and GA53, but is not active on C19-GAs, like GA1, GA4, GA9 and GA20.probableO49561

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.14.-.-Acting on paired donors, with incorporation or reduction of molecular oxygen.probable
1.14.11.-With 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors.probable
1.14.11.13Gibberellin 2-beta-dioxygenase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3OOX, chain A
Confidence level:very confident
Coverage over the Query: 57-346
View the alignment between query and template
View the model in PyMOL