Citrus Sinensis ID: 018022


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360--
MDIEKPSNKTAGKPIQCRAAIATAPGEPLVIDEVIVDPPNSHEVRVRIICTSLCHSDVTFWKMKDFPAVFPRILGHEAIGVVESVGENVDGVVEGDVVIPHFLADCTECVGCRSKKGNLCSAFPFKISPWMPRDQTSRFKDLRGETIHHFVSVSSFSEYTVLDIAHVVKVDPTVPPNRACLLSCGVSTGVGAAWRTANVEVGSTVVIFGLGSIGLAVAEGARLCGATRIIGVDVISEKFEIGKRFGVTEFVNSKNCGDKSVSQIIIDMTDGGADYCFECVGLASLVQEAYACCRKGWGKTIVLGVDQPGSQLSLSSFEVLHSGKILMGSLFGGLKAKSDIPILLKRYMDKWSYVPFSGTRAG
ccccccccccccccEEEEEEEEcccccccEEEEEEEccccccEEEEEEEEEEcccccccccccccccccccECccccccEEEEEEcccccccccccEEEEcccccccccccccccccccccccccccccccccccccccccccccEEEEECcccccccEEEEEccEEEEcccccccccEEEEccccccccHHHEEccccccccEEEEEcccHHHHHHHHHHHHccccEEEEEEccccHHHHHHHccccEEEcccccccccHHHHHHHHccccccEEEEccccHHHHHHHHHHccccccEEEEEEEccccccEECcccccEEcccEEEEEEccccccccccHHHHHHHHcccccccccccccc
***************QCRAAIATAPGEPLVIDEVIVDPPNSHEVRVRIICTSLCHSDVTFWKMKDFPAVFPRILGHEAIGVVESVGENVDGVVEGDVVIPHFLADCTECVGCRSKKGNLCSAFPFKISPWMPRDQTSRFKDLRGETIHHFVSVSSFSEYTVLDIAHVVKVDPTVPPNRACLLSCGVSTGVGAAWRTANVEVGSTVVIFGLGSIGLAVAEGARLCGATRIIGVDVISEKFEIGKRFGVTEFVNSKNCGDKSVSQIIIDMTDGGADYCFECVGLASLVQEAYACCRKGWGKTIVLGVDQPGSQLSLSSFEVLHSGKILMGSLFGGLKAKSDIPILLKRYMDKWSYVPFSGTR**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDIEKPSNKTAGKPIQCRAAIATAPGEPLVIDEVIVDPPNSHEVRVRIICTSLCHSDVTFWKMKDFPAVFPRILGHEAIGVVESVGENVDGVVEGDVVIPHFLADCTECVGCRSKKGNLCSAFPFKISPWMPRDQTSRFKDLRGETIHHFVSVSSFSEYTVLDIAHVVKVDPTVPPNRACLLSCGVSTGVGAAWRTANVEVGSTVVIFGLGSIGLAVAEGARLCGATRIIGVDVISEKFEIGKRFGVTEFVNSKNCGDKSVSQIIIDMTDGGADYCFECVGLASLVQEAYACCRKGWGKTIVLGVDQPGSQLSLSSFEVLHSGKILMGSLFGGLKAKSDIPILLKRYMDKWSYVPFSGTRAG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Alcohol dehydrogenase-like 7 confidentQ9FH04
Alcohol dehydrogenase class-3 Class-III ADH is remarkably ineffective in oxidizing ethanol, but it readily catalyzes the oxidation of long-chain primary alcohols and the oxidation of S-(hydroxymethyl) glutathione.probableP12711
Alcohol dehydrogenase class-3 Class-III ADH is remarkably ineffective in oxidizing ethanol, but it readily catalyzes the oxidation of long-chain primary alcohols and the oxidation of S-(hydroxymethyl) glutathione.probableP28474

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.1.-.-Acting on the CH-OH group of donors.probable
1.1.1.-15-hydroxyprostaglandin dehydrogenase (NAD(+)).probable
1.1.1.1Alcohol dehydrogenase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2FZW, chain A
Confidence level:very confident
Coverage over the Query: 12-360
View the alignment between query and template
View the model in PyMOL