Citrus Sinensis ID: 018067

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-
MGQAPEQEHPKNAFGWAAKDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHMIKNEWGNTIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYANKYHDGTITYGGYSDIMVADEHFVVRIPEGTPLDATAPLLCAGITVYSPLRFYGLDKPGMHVGVVGLGGLGHVAVKFAKAMGVKVTVISTSPSKKSEAIERLGADSFLVSRDQDEMQAAMGTMDGIIDTVSAVHPLMPLIGLLKSQGKLVLVGAPEKPLELPAFSLLMGRKIVGGSMIGGMKETQEMIDFAAKHNIRADIEVIPADYVNTALERLAKADVRYRFVIDVANTMKSTP
cccccccccccEEEEEEECccccccccEEEEccccccccEEEEEEEEccccHHHHHHcccccccccccccccEEEEEEEEEcccccccccccEEEEcCEcccccccHHHccccccccccccEEEccccccccccccccccEEEEcccEEEEcccccccccccccccccccccHHHHHccccccccEEEEEEEccHHHHHHHHHHHcccEEEEEEcccccHHHHHHHccccEEEEcccHHHHHHHHccccEEEEcccccccHHHHHHccccccEEEEEccccccccccccccccccEEEEEccccccHHHHHHHHHHHHccccccEEEEccccHHHHHHHHHcccccEEEEEEccccccccc
************AFGWAAKDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHMIKNEWGNTIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYANKYHDGTITYGGYSDIMVADEHFVVRIPEGTPLDATAPLLCAGITVYSPLRFYGLDKPGMHVGVVGLGGLGHVAVKFAKAMGVKVTVISTSPSK***AIERLGADSFLVSRDQDEMQAAMGTMDGIIDTVSAVHPLMPLIGLLKSQGKLVLVGAPEKPLELPAFSLLMGRKIVGGSMIGGMKETQEMIDFAAKHNIRADIEVIPADYVNTALERLAKADVRYRFVIDVANT*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGQAPEQEHPKNAFGWAAKDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHMIKNEWGNTIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYANKYHDGTITYGGYSDIMVADEHFVVRIPEGTPLDATAPLLCAGITVYSPLRFYGLDKPGMHVGVVGLGGLGHVAVKFAKAMGVKVTVISTSPSKKSEAIERLGADSFLVSRDQDEMQAAMGTMDGIIDTVSAVHPLMPLIGLLKSQGKLVLVGAPEKPLELPAFSLLMGRKIVGGSMIGGMKETQEMIDFAAKHNIRADIEVIPADYVNTALERLAKADVRYRFVIDVANTMKSTP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cinnamyl alcohol dehydrogenase 8 Involved in lignin biosynthesis. Catalyzes the final step specific for the production of lignin monomers. Catalyzes the NADPH-dependent reduction of coniferaldehyde, 5-hydroxyconiferaldehyde, sinapaldehyde, 4-coumaraldehyde and caffeyl aldehyde to their respective alcohols.confidentQ02972
Mannitol dehydrogenase (Fragment) Oxidizes mannitol to mannose. Provides the initial step by which translocated mannitol is committed to central metabolism and, by regulating mannitol pool size, is important in regulating salt tolerance at the cellular level.probableP42754
Probable formaldehyde dehydrogenase AdhA Functions in the protection against aldehyde-stress.probableC0SPA5

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.1.-.-Acting on the CH-OH group of donors.probable
1.1.1.-15-hydroxyprostaglandin dehydrogenase (NAD(+)).probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1YQD, chain A
Confidence level:very confident
Coverage over the Query: 4-356
View the alignment between query and template
View the model in PyMOL