Citrus Sinensis ID: 018068

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-

MAAKAFVVHFSAAKPSKEPFYRYPDCLSTSQSLPLKSLSVNKPAGKLNNVLFISHYTLATLHRRLSPVSAGDSDVPHPFHQESANFRSNKAFEEWNSLTAKFSGAANIPFMLLQLPQIILNARNLLAGNKAALLAVPWLGMLTGLLGNLSLLSYFIKKREKEAIVVQTLGVVSTYVVISQLAVGEAMPMPHFIAISVVVATGLVLNFLNYFNMLNAGLWRFWEDVITVGGLTALPQVIWSTFVPTIPNSILPGTIAFVVGVATVVMARMGKLSKQGVKFVRAISGWTATLLFMWMPVSQMWTNFLNPDNIKGLSASSMLLAMIGNGLLIPRALFIRDFMWFTGSSWATLFYGYGNLVCLYW

ccccEEEEccccccccccccccccccccccccccccccccccccccccccccccccccHHccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccccHHcccHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEcHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHccHHHHHHHHHHHcHHHHHHccccccccccHHHHHHHHHHHHcccHHHHHHHHHHHEEEcccHHHHHHHcHHHEEEEcc

****AFVVHFSAAKPSKEPFYRYPDCLSTSQSLPLKSLSVNKPAGKLNNVLFISHYTLATLHRRLS************************AFEEWNSLTAKFSGAANIPFMLLQLPQIILNARNLLAGNKAALLAVPWLGMLTGLLGNLSLLSYFIKKREKEAIVVQTLGVVSTYVVISQLAVGEAMPMPHFIAISVVVATGLVLNFLNYFNMLNAGLWRFWEDVITVGGLTALPQVIWSTFVPTIPNSILPGTIAFVVGVATVVMARMGKLSKQGVKFVRAISGWTATLLFMWMPVSQMWTNFLNPDNIKGLSASSMLLAMIGNGLLIPRALFIRDFMWFTGSSWATLFYGYGNLVCLYW

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxHHxxHHHHHHHHHHHHHHHHHHHHxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Maltose excess protein 1-like, chloroplastic	Probable maltose transporter. Essential for the conversion of starch to sucrose in leaves at night, probably via the export of maltose from the chloroplast.	probable	Q7XTQ5
Maltose excess protein 1, chloroplastic	Probable maltose transporter. Essential for the conversion of starch to sucrose in leaves at night, probably via the export of maltose from the chloroplast. Required for root cap cells formation.	probable	Q9LF50

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted