Citrus Sinensis ID: 018077

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-
MAPTTVLLSDFSDVTDFVVNQGNGVKGLSEMGLKALPKQYIQPLEERFSEKKIVPHESIPIIDMSKWDDPEVAKSICDAAEMWGFFQVVNHRVPLQVLDRVKAATHRFFGLSAAEKNKYSKELSPSNNVRFGTSFNTQAEKALEWKDYLSLFYVSDDEASALWPPACKDEVLEYTKSSEVLIKQLLKVLMKGLKVEGTDEAKEALLMGSVRTNLNYYPICPNPELTVGVGRHSDVSTLTILLQDDIGGLYVRGNDGESWIHVPPISGSLVINIGDALQIMSNGKYRSVEHCVIANGSSNRISVPIFINPRPQDTIGPFPEVLASGEKPVYKQVLYKDYVKHFFRKAHDGKKTVDFAKLSIF
ccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccccccEEEccccccHHHHHHHHHHHHHccEEEEEcccccHHHHHHHHHHHHHHHcccHHHHHHHccccccccEEEEccccccccccccccEEEEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHccccEEEEEEcccccccccccccccccccccccEEEEccccccEEEEEcccccEEEcccccccEEEEEccEEEEECccccccccccEEEcccccEEEEEEEEcccccccCCccccccccccccccccccHHHHHHHHHHccccccccccccccccc
***********SDVTDFVVNQGNGVKGLSEMGLKALPKQYIQPLEERFSEKKIVPHESIPIIDMSKWDDPEVAKSICDAAEMWGFFQVVNHRVPLQVLDRVKAATHRFFGLSAAEKNKYSKELSPSNNVRFGTSFNTQAEKALEWKDYLSLFYVSDDEASALWPPACKDEVLEYTKSSEVLIKQLLKVLMKGLKVEGTDEAKEALLMGSVRTNLNYYPICPNPELTVGVGRHSDVSTLTILLQDDIGGLYVRGNDGESWIHVPPISGSLVINIGDALQIMSNGKYRSVEHCVIANGSSNRISVPIFINPRPQDTIGPFPEVLASGEKPVYKQVLYKDYVKHFFRKAHDGKKTVDFAKLSIF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAPTTVLLSDFSDVTDFVVNQGNGVKGLSEMGLKALPKQYIQPLEERFSEKKIVPHESIPIIDMSKWDDPEVAKSICDAAEMWGFFQVVNHRVPLQVLDRVKAATHRFFGLSAAEKNKYSKELSPSNNVRFGTSFNTQAEKALEWKDYLSLFYVSDDEASALWPPACKDEVLEYTKSSEVLIKQLLKVLMKGLKVEGTDEAKEALLMGSVRTNLNYYPICPNPELTVGVGRHSDVSTLTILLQDDIGGLYVRGNDGESWIHVPPISGSLVINIGDALQIMSNGKYRSVEHCVIANGSSNRISVPIFINPRPQDTIGPFPEVLASGEKPVYKQVLYKDYVKHFFRKAHDGKKTVDFAKLSIF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Feruloyl CoA ortho-hydroxylase 1 2-oxoglutarate (OG)- and Fe(II)-dependent dioxygenase (2OGD)involved in scopoletin biosynthesis. Converts feruloyl CoA into 6'-hydroxyferuloyl CoA but has no activity with ferulic acid, feruloylquinic acid, caffeic acid, caffeoyl CoA, p-coumaric acid, cinnamic acid, cinnamoyl CoA or benzoyl CoA.probableQ9LHN8

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1W9Y, chain A
Confidence level:very confident
Coverage over the Query: 57-355
View the alignment between query and template
View the model in PyMOL
Template: 1GP6, chain A
Confidence level:very confident
Coverage over the Query: 22-351
View the alignment between query and template
View the model in PyMOL