Citrus Sinensis ID: 018138


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360
MLRTLPIASPSSLTVSTYNKTSLPSQSSLKLSPFCVNNDGGNNISYCYSTSRRLALFQLGAAIPQSHFFGAKALKLLRAEGSTIEASTSGNMAPTSNTVTEQNVLDWVKSDKRRMLHVVYRVGDLDKTIKFYTECLGMKLLRKRDIPEDRYTNAFLGYGPEDSHFVVELTYNYGVDKYDIGTGFGHFGIAVEDVAKTVDLVKAKGGKVTREPGPVKGGNTVIAFIEDPDGYKFELLERGPTPEPLCQVMLRVGDLDRAINFYKKYTIAVMGYGPEDKNAVLELTYNHGVTEYDKGNGYAQIAIGTDDVYKTAEAIKLSGGKITREPGPLPGINTKITACLDPDGWKSVFVDNLDFLKELE
cccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccccccccccccccccccCEEEcccccccccccccccccccccccccccEEEEEEEEEccHHHHHHHHHHHcccCEEEEECcccccEEEEEEEccccccccEEEEEEcccccccccccccEEEEEEEccHHHHHHHHHHcccEEEEccccccccccEEEEEEcccccEEEEEEccccccccccEEEEEccHHHHHHHHHHccEEEEEccccccccEEEEEEcccccccccccccEEEEEEcccHHHHHHHHHHcccCEEccccccccccEEEEEEEcccccEEEEEcccccccccc
*******************************SPFCVNNDGGNNISYCYSTSRRLALFQLGAAIPQSHFFGAKALKLLRA*********************EQNVLDWVKSDKRRMLHVVYRVGDLDKTIKFYTECLGMKLLRKRDIPEDRYTNAFLGYGPEDSHFVVELTYNYGVDKYDIGTGFGHFGIAVEDVAKTVDLVKAKGGKVTREPGPVKGGNTVIAFIEDPDGYKFELLERGPTPEPLCQVMLRVGDLDRAINFYKKYTIAVMGYGPEDKNAVLELTYNHGVTEYDKGNGYAQIAIGTDDVYKTAEAIKLSGGKITREPGPLPGINTKITACLDPDGWKSVFVDNLDFL****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLRTLPIASPSSLTVSTYNKTSLPSQSSLKLSPFCVNNDGGNNISYCYSTSRRLALFQLGAAIPQSHFFGAKALKLLRAEGSTIEASTSGNMAPTSNTVTEQNVLDWVKSDKRRMLHVVYRVGDLDKTIKFYTECLGMKLLRKRDIPEDRYTNAFLGYGPEDSHFVVELTYNYGVDKYDIGTGFGHFGIAVEDVAKTVDLVKAKGGKVTREPGPVKGGNTVIAFIEDPDGYKFELLERGPTPEPLCQVMLRVGDLDRAINFYKKYTIAVMGYGPEDKNAVLELTYNHGVTEYDKGNGYAQIAIGTDDVYKTAEAIKLSGGKITREPGPLPGINTKITACLDPDGWKSVFVDNLDFLKELE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable lactoylglutathione lyase, chloroplast Catalyzes the conversion of hemimercaptal, formed from methylglyoxal and glutathione, to S-lactoylglutathione.confidentQ8W593

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
4.-.-.-Lyases.probable
4.4.-.-Carbon-sulfur lyases.probable
4.4.1.-Carbon-sulfur lyases.probable
4.4.1.5Lactoylglutathione lyase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1F9Z, chain A
Confidence level:very confident
Coverage over the Query: 113-238
View the alignment between query and template
View the model in PyMOL
Template: 1F9Z, chain A
Confidence level:very confident
Coverage over the Query: 244-352
View the alignment between query and template
View the model in PyMOL
Template: 3OXH, chain A
Confidence level:very confident
Coverage over the Query: 70-95,107-239
View the alignment between query and template
View the model in PyMOL