Citrus Sinensis ID: 018145

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360
MGSLSEYQKLAQKKHEEEEEEEESYSHAMQLAMGVVLPMATQAAIQLGVFEIIAKAGELSAPEIAAQLQAQNVKAPMMLDRMLRLLVSHRVLECSVSGGERLYALNPVSKYFVSNKDGASLGHFMALPLDKVFMESWLGLKDAVMEGGIPFNRVHGMHIFEYASGNPRFNETYHEAMFNHSTIAMERILEHYEGFQNVERLVDVGGGFGVTLSMITSKYPQIKAVNFDLPHVVQDAPSYAGVEHVGGNMFESVPEGDAILMKWILHCWDDDHCLRILKNCYKAVPGNGKVIVMNSIVPEIPEVSSAARETSLLDVLLMTRDGGGRERTKKEYTELAIAAGFKGINFASCVCNLYIMEFFK
cccccccHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHcccccHHHHHHHHcccccccccHHHHHHHHHHHcccEEEEEccccccccccHHHccccccccccccHHHHHccccHHHHHHHHHHHHHHHccccccHHcccccHHHHHHccccHHHHHHHHHHHcHHHHHHHHHHHccccccccEEEEEccccHHHHHHHHHcccccCEEEcccHHHHHccccccccEEEccccccccccHHHHHHHHHHccccHHHHHHHHHHHHHHcccccEEEEEEEEccccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHccccccEEEEcccccEEEEEEc
*************************SHAMQLAMGVVLPMATQAAIQLGVFEIIAKAGELSAPEIAAQLQAQNVKAPMMLDRMLRLLVSHRVLECSVSGGERLYALNPVSKYFVSNKDGASLGHFMALPLDKVFMESWLGLKDAVMEGGIPFNRVHGMHIFEYASGNPRFNETYHEAMFNHSTIAMERILEHYEGFQNVERLVDVGGGFGVTLSMITSKYPQIKAVNFDLPHVVQDAPSYAGVEHVGGNMFESVPEGDAILMKWILHCWDDDHCLRILKNCYKAVPGNGKVIVMNSIVPEIPEVSSAARETSLLDVLLMTRDGGGRERTKKEYTELAIAAGFKGINFASCVCNLYIMEFFK
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGSxxxxxxxxxxxxxxxxxxxxxYSHAMQLAMGVVLPMATQAAIQLGVFEIIAKAGELSAPEIAAQLQAQNVKAPMMLDRMLRLLVSHRVLECSVSGGERLYALNPVSKYFVSNKDGASLGHFMALPLDKVFMESWLGLKDAVMEGGIPFNRVHGMHIFEYASGNPRFNETYHEAMFNHSTIAMERILEHYEGFQNVERLVDVGGGFGVTLSMITSKYPQIKAVNFDLPHVVQDAPSYAGVEHVGGNMFESVPEGDAILMKWILHCWDDDHCLRILKNCYKAVPGNGKVIVMNSIVPEIPEVSSAARETSLLDVLLMTRDGGGRERTKKEYTELAIAAGFKGINFASCVCNLYIMEFFK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Anthranilate N-methyltransferase Involved in the biosynthesis of acridine alkaloids. N-methyltransferase with a strict substrate specificity for anthranilate. No activity with anthranilic acid methyl ester, anthraniloyl CoA, 3- or 4-amino-benzoic acid, salicylic acid, catechol, eugenol, caffeic acid, quercetin, theobromin, theophyllin, putrescine and nicotinic acid among others.probableA9X7L0
Caffeic acid 3-O-methyltransferase Catalyzes the conversion of caffeic acid to ferulic acid and of 5-hydroxyferulic acid to sinapic acid. The resulting products may subsequently be converted to the corresponding alcohols that are incorporated into lignins.probableQ8W013
Quercetin 3-O-methyltransferase 2 Methylates OH residues of flavonoid and phenylpropanoid compounds and shows a higher affinity for flavonoid than phenylpropanoid substrates. Substrate preference is quercetin (flavonoid) = luteolin (flavonoid) = 5-hydroxyferulic acid (phenylpropanoid) > caffeic acid (phenylpropanoid) >> apigenin (flavonoid) = kempferol (flavonoid). 3,4-dimethylquercetin is not a substrate.probableQ42653

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.1.-.-Transferring one-carbon groups.probable
2.1.1.-15-hydroxyprostaglandin-I dehydrogenase (NADP(+)).probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3REO, chain A
Confidence level:very confident
Coverage over the Query: 20-360
View the alignment between query and template
View the model in PyMOL