Citrus Sinensis ID: 018164
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 360 | ||||||
| 255549966 | 537 | protein disulfide isomerase, putative [R | 0.958 | 0.642 | 0.716 | 1e-143 | |
| 224059090 | 538 | predicted protein [Populus trichocarpa] | 0.963 | 0.644 | 0.680 | 1e-137 | |
| 255291798 | 523 | protein disulfide isomerase L-3b [Glycin | 0.955 | 0.657 | 0.682 | 1e-137 | |
| 351728045 | 523 | protein disulfide isomerase like protein | 0.955 | 0.657 | 0.682 | 1e-137 | |
| 351722113 | 520 | protein disulfide isomerase like protein | 0.963 | 0.667 | 0.682 | 1e-136 | |
| 225442595 | 537 | PREDICTED: protein disulfide isomerase-l | 0.963 | 0.646 | 0.671 | 1e-134 | |
| 357454941 | 520 | Protein disulfide isomerase L-3b [Medica | 0.963 | 0.667 | 0.662 | 1e-130 | |
| 388493116 | 520 | unknown [Medicago truncatula] | 0.963 | 0.667 | 0.657 | 1e-128 | |
| 449465264 | 537 | PREDICTED: protein disulfide isomerase-l | 0.963 | 0.646 | 0.612 | 1e-123 | |
| 449516165 | 537 | PREDICTED: protein disulfide isomerase-l | 0.963 | 0.646 | 0.609 | 1e-123 |
| >gi|255549966|ref|XP_002516034.1| protein disulfide isomerase, putative [Ricinus communis] gi|223544939|gb|EEF46454.1| protein disulfide isomerase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 515 bits (1327), Expect = e-143, Method: Compositional matrix adjust.
Identities = 248/346 (71%), Positives = 298/346 (86%), Gaps = 1/346 (0%)
Query: 2 RTNTVNEAEEFLKKYQTFVLGMFKKFEGSDYEEFVKTAAADNEIQFVETSNFEVAKVLYP 61
R NTV+EAE+FLK+Y FVLG+F+KFEG DYEEFVK A ++NEIQFVETS+ VAK+L+P
Sbjct: 192 RLNTVSEAEKFLKEYHIFVLGLFEKFEGHDYEEFVKAAVSNNEIQFVETSDLMVAKILFP 251
Query: 62 DIKSTDHFLGIVKSEPDRYTGYEETFIMDKILQFLNYNKFPLVTKLTDINSASVHSSPIK 121
DI ST+ F+GIVKSEP+RYT YE TF M+KI QFL +NKFPLVT+L ++NS V+SSPIK
Sbjct: 252 DIISTN-FIGIVKSEPERYTAYEGTFDMEKISQFLVHNKFPLVTRLNELNSVRVYSSPIK 310
Query: 122 LQVYVFAKADDLKSLLEPLEDIARNFKGKIMFTAVDIADEDLAKPFLTLFGLEESKNTVV 181
LQV VFAKADD K+L+EPL+++AR FK KIMF +DIADE+ AKP LTLFGLE+S+NT+V
Sbjct: 311 LQVIVFAKADDFKNLIEPLQEVARKFKSKIMFIYIDIADENQAKPLLTLFGLEDSQNTLV 370
Query: 182 TAFDNKAISKFLLESDLTPSNIEEFCSRLLHGTLTPYLKSQPIPDNTNANVQIVVGKTFD 241
AFDN SK+LLE D PSNIE+FCSRLLHG+L+ Y KSQP+PDN A++Q++VGKTFD
Sbjct: 371 IAFDNNMNSKYLLELDPAPSNIEDFCSRLLHGSLSTYYKSQPVPDNKEASIQVIVGKTFD 430
Query: 242 DLVLNSHKDVLLEVYTPWCVTCETTSKQIEKLAKHFKGLDNLVIAKIDASANEHPKLQVE 301
DLVL+S K+VLLEV+TPWC+ CETTSKQIEKLAKHFKGLD+LV AKIDASANEHPK+QVE
Sbjct: 431 DLVLSSPKNVLLEVFTPWCINCETTSKQIEKLAKHFKGLDSLVFAKIDASANEHPKMQVE 490
Query: 302 EYPTLLFYPAGDKANPIKVSARSSSKNIAAFIKEQLKEKDQSPKDE 347
EYPTLLFYPA DKANPIK+S +SSSK +AA I + LK K+Q+ KDE
Sbjct: 491 EYPTLLFYPASDKANPIKLSTKSSSKELAAAINKHLKGKEQAAKDE 536
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224059090|ref|XP_002299710.1| predicted protein [Populus trichocarpa] gi|222846968|gb|EEE84515.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255291798|dbj|BAH89252.1| protein disulfide isomerase L-3b [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|351728045|ref|NP_001238717.1| protein disulfide isomerase like protein precursor [Glycine max] gi|51848587|dbj|BAD42324.1| protein disulfide isomerase like protein [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|351722113|ref|NP_001235697.1| protein disulfide isomerase like protein precursor [Glycine max] gi|51848585|dbj|BAD42323.1| protein disulfide isomerase like protein [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|225442595|ref|XP_002279221.1| PREDICTED: protein disulfide isomerase-like 1-6 [Vitis vinifera] gi|297743253|emb|CBI36120.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|357454941|ref|XP_003597751.1| Protein disulfide isomerase L-3b [Medicago truncatula] gi|355486799|gb|AES68002.1| Protein disulfide isomerase L-3b [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|388493116|gb|AFK34624.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|449465264|ref|XP_004150348.1| PREDICTED: protein disulfide isomerase-like 1-6-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449516165|ref|XP_004165118.1| PREDICTED: protein disulfide isomerase-like 1-6-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 360 | ||||||
| TAIR|locus:2093447 | 534 | PDIL1-6 "PDI-like 1-6" [Arabid | 0.963 | 0.649 | 0.603 | 1.7e-114 | |
| TAIR|locus:2018134 | 537 | PDIL1-5 "PDI-like 1-5" [Arabid | 0.955 | 0.640 | 0.615 | 2.5e-113 | |
| TAIR|locus:2175811 | 597 | PDIL1-4 "PDI-like 1-4" [Arabid | 0.977 | 0.589 | 0.331 | 2.9e-55 | |
| TAIR|locus:2082712 | 579 | PDIL1-3 "PDI-like 1-3" [Arabid | 0.986 | 0.613 | 0.322 | 7.8e-55 | |
| ZFIN|ZDB-GENE-080610-1 | 509 | p4hb "procollagen-proline, 2-o | 0.972 | 0.687 | 0.312 | 2.4e-44 | |
| UNIPROTKB|A6H7J6 | 510 | P4HB "Prolyl 4-hydroxylase, be | 0.958 | 0.676 | 0.294 | 1.6e-40 | |
| UNIPROTKB|F1PL97 | 510 | P4HB "Uncharacterized protein" | 0.958 | 0.676 | 0.296 | 5.3e-40 | |
| UNIPROTKB|P05307 | 510 | P4HB "Protein disulfide-isomer | 0.958 | 0.676 | 0.291 | 6.8e-40 | |
| UNIPROTKB|P07237 | 508 | P4HB "Protein disulfide-isomer | 0.963 | 0.683 | 0.290 | 8.7e-40 | |
| UNIPROTKB|P09102 | 515 | P4HB "Protein disulfide-isomer | 0.947 | 0.662 | 0.287 | 3.7e-39 |
| TAIR|locus:2093447 PDIL1-6 "PDI-like 1-6" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1129 (402.5 bits), Expect = 1.7e-114, P = 1.7e-114
Identities = 210/348 (60%), Positives = 282/348 (81%)
Query: 1 MRTNTVNEAEEFLKKYQTFVLGMFKKFEGSD-YEEFVKTAAADNEIQFVETSNFEVAKVL 59
++ +TV+EA FLKK+ TF+LG+F+K E S ++EFVK A+ DNEIQFVETS+ +VAK+L
Sbjct: 186 IKLDTVDEASGFLKKHHTFILGLFEKSEDSSGHDEFVKAASLDNEIQFVETSSIDVAKLL 245
Query: 60 YPDIKSTDHFLGIVKSEPDRYTGYEETFIMDKILQFLNYNKFPLVTKLTDINSASVHSSP 119
+P++K+ + F+G+VK+E ++YT Y+ +KI++FLN NKFPLVTKLT+ N+ V+SSP
Sbjct: 246 FPNLKTNNVFVGLVKTEAEKYTSYDGPCQAEKIVEFLNSNKFPLVTKLTESNTVRVYSSP 305
Query: 120 IKLQVYVFAKADDLKSLLEPLEDIARNFKGKIMFTAVDIADEDLAKPFLTLFGLEESKNT 179
+KLQV VF+K DD +SL +PLEDIAR FK K+M +DI++E+LA PFLTLFG+E++K T
Sbjct: 306 VKLQVMVFSKTDDFESLAQPLEDIARKFKSKLMLIYIDISNENLAMPFLTLFGIEDAKKT 365
Query: 180 VVTAFDNKAISKFLLESDLTPSNIEEFCSRLLHGTLTPYLKSQPIPDNTNANVQIVVGKT 239
VV AFDN SK+LLESD +PSNIEEFC L HGT++ Y KSQPIPDN NA+V VVG+T
Sbjct: 366 VVAAFDNNLNSKYLLESDPSPSNIEEFCFGLAHGTVSAYYKSQPIPDNQNASVVAVVGRT 425
Query: 240 FDDLVLNSHKDVLLEVYTPWCVTCETTSKQIEKLAKHFKGLDNLVIAKIDASANEHPKLQ 299
FD++VL S ++VLLEV+TPWC+ CE SKQ+EKL++HFKG +NLV A+IDASANEHPKL
Sbjct: 426 FDEVVLRSSENVLLEVHTPWCINCEALSKQVEKLSQHFKGFENLVFARIDASANEHPKLT 485
Query: 300 VEEYPTLLFYPAGDKANPIKVSARSSSKNIAAFIKEQLKEKDQSPKDE 347
V++YPT+L Y G+K NP+K+S +SS+K++A I ++LK KDQS KDE
Sbjct: 486 VDDYPTILLYKTGEKENPLKLSTKSSAKDMAVLINKELKWKDQSGKDE 533
|
|
| TAIR|locus:2018134 PDIL1-5 "PDI-like 1-5" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2175811 PDIL1-4 "PDI-like 1-4" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2082712 PDIL1-3 "PDI-like 1-3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-080610-1 p4hb "procollagen-proline, 2-oxoglutarate 4-dioxygenase (proline 4-hydroxylase), beta polypeptide" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A6H7J6 P4HB "Prolyl 4-hydroxylase, beta subunit" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PL97 P4HB "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P05307 P4HB "Protein disulfide-isomerase" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P07237 P4HB "Protein disulfide-isomerase" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P09102 P4HB "Protein disulfide-isomerase" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00034375001 | SubName- Full=Chromosome chr9 scaffold_7, whole genome shotgun sequence; (537 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 360 | |||
| TIGR01130 | 462 | TIGR01130, ER_PDI_fam, protein disulfide isomerase | 8e-62 | |
| cd02995 | 104 | cd02995, PDI_a_PDI_a'_C, PDIa family, C-terminal T | 2e-38 | |
| PTZ00102 | 477 | PTZ00102, PTZ00102, disulphide isomerase; Provisio | 3e-23 | |
| TIGR01126 | 102 | TIGR01126, pdi_dom, protein disulfide-isomerase do | 4e-19 | |
| cd02998 | 105 | cd02998, PDI_a_ERp38, PDIa family, endoplasmic ret | 5e-19 | |
| cd02961 | 101 | cd02961, PDI_a_family, Protein Disulfide Isomerase | 5e-19 | |
| pfam00085 | 104 | pfam00085, Thioredoxin, Thioredoxin | 1e-17 | |
| cd02982 | 103 | cd02982, PDI_b'_family, Protein Disulfide Isomeras | 2e-09 | |
| cd03001 | 103 | cd03001, PDI_a_P5, PDIa family, P5 subfamily; comp | 6e-09 | |
| cd03002 | 109 | cd03002, PDI_a_MPD1_like, PDI family, MPD1-like su | 1e-08 | |
| cd03004 | 104 | cd03004, PDI_a_ERdj5_C, PDIa family, C-terminal ER | 5e-08 | |
| cd02993 | 109 | cd02993, PDI_a_APS_reductase, PDIa family, 5'-Aden | 8e-08 | |
| TIGR01068 | 101 | TIGR01068, thioredoxin, thioredoxin | 1e-07 | |
| cd02947 | 93 | cd02947, TRX_family, TRX family; composed of two g | 1e-07 | |
| cd02981 | 97 | cd02981, PDI_b_family, Protein Disulfide Isomerase | 2e-07 | |
| TIGR01130 | 462 | TIGR01130, ER_PDI_fam, protein disulfide isomerase | 4e-07 | |
| pfam13848 | 183 | pfam13848, Thioredoxin_6, Thioredoxin-like domain | 6e-07 | |
| cd02992 | 114 | cd02992, PDI_a_QSOX, PDIa family, Quiescin-sulfhyd | 9e-07 | |
| cd03005 | 102 | cd03005, PDI_a_ERp46, PDIa family, endoplasmic ret | 9e-07 | |
| PRK09381 | 109 | PRK09381, trxA, thioredoxin; Provisional | 2e-05 | |
| PTZ00443 | 224 | PTZ00443, PTZ00443, Thioredoxin domain-containing | 2e-05 | |
| PTZ00102 | 477 | PTZ00102, PTZ00102, disulphide isomerase; Provisio | 3e-05 | |
| cd02997 | 104 | cd02997, PDI_a_PDIR, PDIa family, PDIR subfamily; | 4e-05 | |
| PLN02309 | 457 | PLN02309, PLN02309, 5'-adenylylsulfate reductase | 5e-05 | |
| COG4232 | 569 | COG4232, COG4232, Thiol:disulfide interchange prot | 7e-05 | |
| cd01659 | 69 | cd01659, TRX_superfamily, Thioredoxin (TRX) superf | 0.003 | |
| cd02956 | 96 | cd02956, ybbN, ybbN protein family; ybbN is a hypo | 0.004 |
| >gnl|CDD|233282 TIGR01130, ER_PDI_fam, protein disulfide isomerase, eukaryotic | Back alignment and domain information |
|---|
Score = 204 bits (521), Expect = 8e-62
Identities = 99/337 (29%), Positives = 162/337 (48%), Gaps = 8/337 (2%)
Query: 5 TVNEAEEFLKKYQTFVLGMFKKFEGSDYEEFVKTAAADNEIQFVETSNFEVAKVLYPDIK 64
TV + E FL V+G FK + + F+ A ++ F + +VA
Sbjct: 118 TVADLEAFLADDDVVVIGFFKDLDSELNDTFLSVAEKLRDVYFFFAHSSDVAAFAKLGAF 177
Query: 65 STDH--FLGIVKSEPDRYTGYEETFIMDKILQFLNYNKFPLVTKLTDINSASVHSSPIKL 122
F + E E + + +F+ PLV + T +A S +
Sbjct: 178 PDSVVLFKPKDEDEKFSKVDGEMDTDVSDLEKFIRAESLPLVGEFTQETAAKYFESGPLV 237
Query: 123 QVYVFAKADDL--KSLLEPLEDIARNFKGKIMFTAVDIADEDLAKPFLTLFGLEESKNTV 180
+Y + L + A+ F+GK F +ADE+ L FGL+ K
Sbjct: 238 VLYYNVDESLDPFEELRNRFLEAAKKFRGK--FVNFAVADEEDFGRELEYFGLKAEKFPA 295
Query: 181 VTAFDNKAISKFLLESD-LTPSNIEEFCSRLLHGTLTPYLKSQPIPDNTNANVQIVVGKT 239
V D + K+ ++ + + N+E F L G L PYLKS+PIP++ V+++VGK
Sbjct: 296 VAIQDLEGNKKYPMDQEEFSSENLEAFVKDFLDGKLKPYLKSEPIPEDDEGPVKVLVGKN 355
Query: 240 FDDLVLNSHKDVLLEVYTPWCVTCETTSKQIEKLAKHFKGLD-NLVIAKIDASANEHPKL 298
FD++VL+ KDVL+E Y PWC C+ + E+LA+ +K + ++VIAK+DA+AN+ P
Sbjct: 356 FDEIVLDETKDVLVEFYAPWCGHCKNLAPIYEELAEKYKDAESDVVIAKMDATANDVPPF 415
Query: 299 QVEEYPTLLFYPAGDKANPIKVSARSSSKNIAAFIKE 335
+VE +PT+ F PAG K+ P+ + ++ + FI +
Sbjct: 416 EVEGFPTIKFVPAGKKSEPVPYDGDRTLEDFSKFIAK 452
|
This model represents eukaryotic protein disulfide isomerases retained in the endoplasmic reticulum (ER) and closely related forms. Some members have been assigned alternative or additional functions such as prolyl 4-hydroxylase and dolichyl-diphosphooligosaccharide-protein glycotransferase. Members of this family have at least two protein-disulfide domains, each similar to thioredoxin but with the redox-active disulfide in the motif PWCGHCK, and an ER retention signal at the extreme C-terminus (KDEL, HDEL, and similar motifs). Length = 462 |
| >gnl|CDD|239293 cd02995, PDI_a_PDI_a'_C, PDIa family, C-terminal TRX domain (a') subfamily; composed of the C-terminal redox active a' domains of PDI, ERp72, ERp57 (or ERp60) and EFP1 | Back alignment and domain information |
|---|
| >gnl|CDD|240266 PTZ00102, PTZ00102, disulphide isomerase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|200074 TIGR01126, pdi_dom, protein disulfide-isomerase domain | Back alignment and domain information |
|---|
| >gnl|CDD|239296 cd02998, PDI_a_ERp38, PDIa family, endoplasmic reticulum protein 38 (ERp38) subfamily; composed of proteins similar to the P5-like protein first isolated from alfalfa, which contains two redox active TRX (a) domains at the N-terminus, like human P5, and a C-terminal domain with homology to the C-terminal domain of ERp29, unlike human P5 | Back alignment and domain information |
|---|
| >gnl|CDD|239259 cd02961, PDI_a_family, Protein Disulfide Isomerase (PDIa) family, redox active TRX domains; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants | Back alignment and domain information |
|---|
| >gnl|CDD|215704 pfam00085, Thioredoxin, Thioredoxin | Back alignment and domain information |
|---|
| >gnl|CDD|239280 cd02982, PDI_b'_family, Protein Disulfide Isomerase (PDIb') family, redox inactive TRX-like domain b'; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants | Back alignment and domain information |
|---|
| >gnl|CDD|239299 cd03001, PDI_a_P5, PDIa family, P5 subfamily; composed of eukaryotic proteins similar to human P5, a PDI-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain) | Back alignment and domain information |
|---|
| >gnl|CDD|239300 cd03002, PDI_a_MPD1_like, PDI family, MPD1-like subfamily; composed of eukaryotic proteins similar to Saccharomyces cerevisiae MPD1 protein, which contains a single redox active TRX domain located at the N-terminus, and an ER retention signal at the C-terminus indicative of an ER-resident protein | Back alignment and domain information |
|---|
| >gnl|CDD|239302 cd03004, PDI_a_ERdj5_C, PDIa family, C-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains | Back alignment and domain information |
|---|
| >gnl|CDD|239291 cd02993, PDI_a_APS_reductase, PDIa family, 5'-Adenylylsulfate (APS) reductase subfamily; composed of plant-type APS reductases containing a C-terminal redox active TRX domain and an N-terminal reductase domain which is part of a superfamily that includes N type ATP PPases | Back alignment and domain information |
|---|
| >gnl|CDD|200072 TIGR01068, thioredoxin, thioredoxin | Back alignment and domain information |
|---|
| >gnl|CDD|239245 cd02947, TRX_family, TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains | Back alignment and domain information |
|---|
| >gnl|CDD|239279 cd02981, PDI_b_family, Protein Disulfide Isomerase (PDIb) family, redox inactive TRX-like domain b; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants | Back alignment and domain information |
|---|
| >gnl|CDD|233282 TIGR01130, ER_PDI_fam, protein disulfide isomerase, eukaryotic | Back alignment and domain information |
|---|
| >gnl|CDD|222416 pfam13848, Thioredoxin_6, Thioredoxin-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|239290 cd02992, PDI_a_QSOX, PDIa family, Quiescin-sulfhydryl oxidase (QSOX) subfamily; QSOX is a eukaryotic protein containing an N-terminal redox active TRX domain, similar to that of PDI, and a small C-terminal flavin adenine dinucleotide (FAD)-binding domain homologous to the yeast ERV1p protein | Back alignment and domain information |
|---|
| >gnl|CDD|239303 cd03005, PDI_a_ERp46, PDIa family, endoplasmic reticulum protein 46 (ERp46) subfamily; ERp46 is an ER-resident protein containing three redox active TRX domains | Back alignment and domain information |
|---|
| >gnl|CDD|181812 PRK09381, trxA, thioredoxin; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185622 PTZ00443, PTZ00443, Thioredoxin domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240266 PTZ00102, PTZ00102, disulphide isomerase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239295 cd02997, PDI_a_PDIR, PDIa family, PDIR subfamily; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related) | Back alignment and domain information |
|---|
| >gnl|CDD|215175 PLN02309, PLN02309, 5'-adenylylsulfate reductase | Back alignment and domain information |
|---|
| >gnl|CDD|226685 COG4232, COG4232, Thiol:disulfide interchange protein [Posttranslational modification, protein turnover, chaperones / Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|238829 cd01659, TRX_superfamily, Thioredoxin (TRX) superfamily; a large, diverse group of proteins containing a TRX-fold | Back alignment and domain information |
|---|
| >gnl|CDD|239254 cd02956, ybbN, ybbN protein family; ybbN is a hypothetical protein containing a redox-inactive TRX-like domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 360 | |||
| KOG0190 | 493 | consensus Protein disulfide isomerase (prolyl 4-hy | 100.0 | |
| TIGR01130 | 462 | ER_PDI_fam protein disulfide isomerases, eukaryoti | 100.0 | |
| PTZ00102 | 477 | disulphide isomerase; Provisional | 100.0 | |
| KOG0191 | 383 | consensus Thioredoxin/protein disulfide isomerase | 99.93 | |
| PF13848 | 184 | Thioredoxin_6: Thioredoxin-like domain; PDB: 3EC3_ | 99.93 | |
| KOG0191 | 383 | consensus Thioredoxin/protein disulfide isomerase | 99.86 | |
| cd03006 | 113 | PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamil | 99.86 | |
| TIGR02187 | 215 | GlrX_arch Glutaredoxin-like domain protein. This f | 99.83 | |
| KOG0910 | 150 | consensus Thioredoxin-like protein [Posttranslatio | 99.82 | |
| cd02995 | 104 | PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain | 99.82 | |
| cd03004 | 104 | PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfam | 99.81 | |
| cd03003 | 101 | PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfam | 99.8 | |
| PF01216 | 383 | Calsequestrin: Calsequestrin; InterPro: IPR001393 | 99.8 | |
| PF00085 | 103 | Thioredoxin: Thioredoxin; InterPro: IPR013766 Thio | 99.8 | |
| cd02996 | 108 | PDI_a_ERp44 PDIa family, endoplasmic reticulum pro | 99.79 | |
| TIGR01130 | 462 | ER_PDI_fam protein disulfide isomerases, eukaryoti | 99.79 | |
| cd03065 | 120 | PDI_b_Calsequestrin_N PDIb family, Calsequestrin s | 99.79 | |
| cd03002 | 109 | PDI_a_MPD1_like PDI family, MPD1-like subfamily; c | 99.78 | |
| KOG0190 | 493 | consensus Protein disulfide isomerase (prolyl 4-hy | 99.77 | |
| cd03007 | 116 | PDI_a_ERp29_N PDIa family, endoplasmic reticulum p | 99.76 | |
| cd02994 | 101 | PDI_a_TMX PDIa family, TMX subfamily; composed of | 99.75 | |
| PTZ00102 | 477 | disulphide isomerase; Provisional | 99.75 | |
| cd02993 | 109 | PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfat | 99.75 | |
| cd03001 | 103 | PDI_a_P5 PDIa family, P5 subfamily; composed of eu | 99.74 | |
| PRK09381 | 109 | trxA thioredoxin; Provisional | 99.73 | |
| cd03005 | 102 | PDI_a_ERp46 PDIa family, endoplasmic reticulum pro | 99.73 | |
| COG3118 | 304 | Thioredoxin domain-containing protein [Posttransla | 99.72 | |
| PTZ00443 | 224 | Thioredoxin domain-containing protein; Provisional | 99.72 | |
| cd02998 | 105 | PDI_a_ERp38 PDIa family, endoplasmic reticulum pro | 99.72 | |
| cd02956 | 96 | ybbN ybbN protein family; ybbN is a hypothetical p | 99.72 | |
| cd02963 | 111 | TRX_DnaJ TRX domain, DnaJ domain containing protei | 99.71 | |
| TIGR01126 | 102 | pdi_dom protein disulfide-isomerase domain. This m | 99.71 | |
| cd02999 | 100 | PDI_a_ERp44_like PDIa family, endoplasmic reticulu | 99.7 | |
| PHA02278 | 103 | thioredoxin-like protein | 99.68 | |
| cd02954 | 114 | DIM1 Dim1 family; Dim1 is also referred to as U5 s | 99.67 | |
| cd02992 | 114 | PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidas | 99.67 | |
| cd02997 | 104 | PDI_a_PDIR PDIa family, PDIR subfamily; composed o | 99.67 | |
| PRK10996 | 139 | thioredoxin 2; Provisional | 99.66 | |
| PLN02309 | 457 | 5'-adenylylsulfate reductase | 99.66 | |
| TIGR00424 | 463 | APS_reduc 5'-adenylylsulfate reductase, thioredoxi | 99.66 | |
| cd02948 | 102 | TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fus | 99.63 | |
| TIGR01068 | 101 | thioredoxin thioredoxin. Several proteins, such as | 99.63 | |
| cd02985 | 103 | TRX_CDSP32 TRX family, chloroplastic drought-induc | 99.63 | |
| KOG0912 | 375 | consensus Thiol-disulfide isomerase and thioredoxi | 99.62 | |
| cd02962 | 152 | TMX2 TMX2 family; composed of proteins similar to | 99.62 | |
| cd03000 | 104 | PDI_a_TMX3 PDIa family, TMX3 subfamily; composed o | 99.61 | |
| cd02957 | 113 | Phd_like Phosducin (Phd)-like family; composed of | 99.61 | |
| cd03066 | 102 | PDI_b_Calsequestrin_middle PDIb family, Calsequest | 99.6 | |
| cd02981 | 97 | PDI_b_family Protein Disulfide Isomerase (PDIb) fa | 99.6 | |
| cd02965 | 111 | HyaE HyaE family; HyaE is also called HupG and Hox | 99.6 | |
| PF01216 | 383 | Calsequestrin: Calsequestrin; InterPro: IPR001393 | 99.6 | |
| KOG4277 | 468 | consensus Uncharacterized conserved protein, conta | 99.59 | |
| cd02961 | 101 | PDI_a_family Protein Disulfide Isomerase (PDIa) fa | 99.59 | |
| cd03069 | 104 | PDI_b_ERp57 PDIb family, ERp57 subfamily, first re | 99.59 | |
| cd02989 | 113 | Phd_like_TxnDC9 Phosducin (Phd)-like family, Thior | 99.58 | |
| cd02949 | 97 | TRX_NTR TRX domain, novel NADPH thioredoxin reduct | 99.55 | |
| cd03072 | 111 | PDI_b'_ERp44 PDIb' family, ERp44 subfamily, second | 99.53 | |
| PLN00410 | 142 | U5 snRNP protein, DIM1 family; Provisional | 99.53 | |
| cd02953 | 104 | DsbDgamma DsbD gamma family; DsbD gamma is the C-t | 99.53 | |
| cd02950 | 142 | TxlA TRX-like protein A (TxlA) family; TxlA was or | 99.53 | |
| cd02987 | 175 | Phd_like_Phd Phosducin (Phd)-like family, Phd subf | 99.52 | |
| cd02975 | 113 | PfPDO_like_N Pyrococcus furiosus protein disulfide | 99.52 | |
| cd03003 | 101 | PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfam | 99.51 | |
| cd02984 | 97 | TRX_PICOT TRX domain, PICOT (for PKC-interacting c | 99.5 | |
| KOG0907 | 106 | consensus Thioredoxin [Posttranslational modificat | 99.5 | |
| KOG0912 | 375 | consensus Thiol-disulfide isomerase and thioredoxi | 99.5 | |
| cd03068 | 107 | PDI_b_ERp72 PDIb family, ERp72 subfamily, first re | 99.49 | |
| cd02988 | 192 | Phd_like_VIAF Phosducin (Phd)-like family, Viral i | 99.49 | |
| cd03006 | 113 | PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamil | 99.49 | |
| TIGR02187 | 215 | GlrX_arch Glutaredoxin-like domain protein. This f | 99.48 | |
| cd02986 | 114 | DLP Dim1 family, Dim1-like protein (DLP) subfamily | 99.43 | |
| cd03004 | 104 | PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfam | 99.43 | |
| PTZ00051 | 98 | thioredoxin; Provisional | 99.43 | |
| PF00085 | 103 | Thioredoxin: Thioredoxin; InterPro: IPR013766 Thio | 99.42 | |
| TIGR01295 | 122 | PedC_BrcD bacteriocin transport accessory protein, | 99.42 | |
| cd02947 | 93 | TRX_family TRX family; composed of two groups: Gro | 99.41 | |
| PF13848 | 184 | Thioredoxin_6: Thioredoxin-like domain; PDB: 3EC3_ | 99.4 | |
| cd02996 | 108 | PDI_a_ERp44 PDIa family, endoplasmic reticulum pro | 99.39 | |
| cd02982 | 103 | PDI_b'_family Protein Disulfide Isomerase (PDIb') | 99.36 | |
| KOG0908 | 288 | consensus Thioredoxin-like protein [Posttranslatio | 99.35 | |
| cd02951 | 125 | SoxW SoxW family; SoxW is a bacterial periplasmic | 99.35 | |
| cd02982 | 103 | PDI_b'_family Protein Disulfide Isomerase (PDIb') | 99.34 | |
| cd03007 | 116 | PDI_a_ERp29_N PDIa family, endoplasmic reticulum p | 99.33 | |
| cd03001 | 103 | PDI_a_P5 PDIa family, P5 subfamily; composed of eu | 99.32 | |
| cd03002 | 109 | PDI_a_MPD1_like PDI family, MPD1-like subfamily; c | 99.32 | |
| PTZ00062 | 204 | glutaredoxin; Provisional | 99.28 | |
| TIGR00411 | 82 | redox_disulf_1 small redox-active disulfide protei | 99.28 | |
| cd03065 | 120 | PDI_b_Calsequestrin_N PDIb family, Calsequestrin s | 99.27 | |
| KOG0910 | 150 | consensus Thioredoxin-like protein [Posttranslatio | 99.26 | |
| cd02993 | 109 | PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfat | 99.25 | |
| cd02952 | 119 | TRP14_like Human TRX-related protein 14 (TRP14)-li | 99.25 | |
| TIGR01126 | 102 | pdi_dom protein disulfide-isomerase domain. This m | 99.25 | |
| cd03073 | 111 | PDI_b'_ERp72_ERp57 PDIb' family, ERp72 and ERp57 s | 99.24 | |
| cd02994 | 101 | PDI_a_TMX PDIa family, TMX subfamily; composed of | 99.24 | |
| KOG4277 | 468 | consensus Uncharacterized conserved protein, conta | 99.24 | |
| cd03005 | 102 | PDI_a_ERp46 PDIa family, endoplasmic reticulum pro | 99.24 | |
| cd02995 | 104 | PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain | 99.22 | |
| cd02959 | 117 | ERp19 Endoplasmic reticulum protein 19 (ERp19) fam | 99.21 | |
| cd02998 | 105 | PDI_a_ERp38 PDIa family, endoplasmic reticulum pro | 99.19 | |
| PTZ00443 | 224 | Thioredoxin domain-containing protein; Provisional | 99.19 | |
| PTZ00062 | 204 | glutaredoxin; Provisional | 99.18 | |
| KOG1731 | 606 | consensus FAD-dependent sulfhydryl oxidase/quiesci | 99.18 | |
| PRK09381 | 109 | trxA thioredoxin; Provisional | 99.17 | |
| cd02983 | 130 | P5_C P5 family, C-terminal redox inactive TRX-like | 99.17 | |
| COG3118 | 304 | Thioredoxin domain-containing protein [Posttransla | 99.16 | |
| cd02997 | 104 | PDI_a_PDIR PDIa family, PDIR subfamily; composed o | 99.13 | |
| PRK10996 | 139 | thioredoxin 2; Provisional | 99.11 | |
| cd02956 | 96 | ybbN ybbN protein family; ybbN is a hypothetical p | 99.11 | |
| TIGR00412 | 76 | redox_disulf_2 small redox-active disulfide protei | 99.09 | |
| cd02961 | 101 | PDI_a_family Protein Disulfide Isomerase (PDIa) fa | 99.08 | |
| cd02999 | 100 | PDI_a_ERp44_like PDIa family, endoplasmic reticulu | 99.08 | |
| cd02963 | 111 | TRX_DnaJ TRX domain, DnaJ domain containing protei | 99.07 | |
| TIGR01068 | 101 | thioredoxin thioredoxin. Several proteins, such as | 99.02 | |
| TIGR00424 | 463 | APS_reduc 5'-adenylylsulfate reductase, thioredoxi | 99.02 | |
| PRK00293 | 571 | dipZ thiol:disulfide interchange protein precursor | 99.0 | |
| cd03000 | 104 | PDI_a_TMX3 PDIa family, TMX3 subfamily; composed o | 98.99 | |
| cd02965 | 111 | HyaE HyaE family; HyaE is also called HupG and Hox | 98.99 | |
| PLN02309 | 457 | 5'-adenylylsulfate reductase | 98.95 | |
| PHA02125 | 75 | thioredoxin-like protein | 98.94 | |
| cd02950 | 142 | TxlA TRX-like protein A (TxlA) family; TxlA was or | 98.93 | |
| TIGR02738 | 153 | TrbB type-F conjugative transfer system pilin asse | 98.93 | |
| PF13098 | 112 | Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_ | 98.93 | |
| TIGR02740 | 271 | TraF-like TraF-like protein. This protein is relat | 98.92 | |
| cd02955 | 124 | SSP411 TRX domain, SSP411 protein family; members | 98.9 | |
| KOG0913 | 248 | consensus Thiol-disulfide isomerase and thioredoxi | 98.9 | |
| PHA02278 | 103 | thioredoxin-like protein | 98.89 | |
| KOG1731 | 606 | consensus FAD-dependent sulfhydryl oxidase/quiesci | 98.89 | |
| cd02954 | 114 | DIM1 Dim1 family; Dim1 is also referred to as U5 s | 98.89 | |
| cd02948 | 102 | TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fus | 98.89 | |
| cd02989 | 113 | Phd_like_TxnDC9 Phosducin (Phd)-like family, Thior | 98.88 | |
| PRK14018 | 521 | trifunctional thioredoxin/methionine sulfoxide red | 98.88 | |
| PRK11509 | 132 | hydrogenase-1 operon protein HyaE; Provisional | 98.85 | |
| cd02953 | 104 | DsbDgamma DsbD gamma family; DsbD gamma is the C-t | 98.84 | |
| cd02985 | 103 | TRX_CDSP32 TRX family, chloroplastic drought-induc | 98.82 | |
| cd02992 | 114 | PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidas | 98.82 | |
| TIGR03143 | 555 | AhpF_homolog putative alkyl hydroperoxide reductas | 98.81 | |
| PRK03147 | 173 | thiol-disulfide oxidoreductase; Provisional | 98.8 | |
| cd02962 | 152 | TMX2 TMX2 family; composed of proteins similar to | 98.8 | |
| PLN00410 | 142 | U5 snRNP protein, DIM1 family; Provisional | 98.78 | |
| cd02957 | 113 | Phd_like Phosducin (Phd)-like family; composed of | 98.77 | |
| cd02984 | 97 | TRX_PICOT TRX domain, PICOT (for PKC-interacting c | 98.76 | |
| cd02975 | 113 | PfPDO_like_N Pyrococcus furiosus protein disulfide | 98.76 | |
| PRK15412 | 185 | thiol:disulfide interchange protein DsbE; Provisio | 98.73 | |
| cd02973 | 67 | TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)- | 98.73 | |
| cd02949 | 97 | TRX_NTR TRX domain, novel NADPH thioredoxin reduct | 98.71 | |
| TIGR00385 | 173 | dsbE periplasmic protein thiol:disulfide oxidoredu | 98.7 | |
| cd02964 | 132 | TryX_like_family Tryparedoxin (TryX)-like family; | 98.69 | |
| PTZ00051 | 98 | thioredoxin; Provisional | 98.66 | |
| cd03009 | 131 | TryX_like_TryX_NRX Tryparedoxin (TryX)-like family | 98.66 | |
| cd02958 | 114 | UAS UAS family; UAS is a domain of unknown functio | 98.66 | |
| cd02960 | 130 | AGR Anterior Gradient (AGR) family; members of thi | 98.65 | |
| PF13905 | 95 | Thioredoxin_8: Thioredoxin-like; PDB: 1FG4_A 1I5G_ | 98.64 | |
| cd03011 | 123 | TlpA_like_ScsD_MtbDsbE TlpA-like family, suppresso | 98.64 | |
| cd02947 | 93 | TRX_family TRX family; composed of two groups: Gro | 98.64 | |
| cd03010 | 127 | TlpA_like_DsbE TlpA-like family, DsbE (also known | 98.61 | |
| cd02987 | 175 | Phd_like_Phd Phosducin (Phd)-like family, Phd subf | 98.61 | |
| cd03026 | 89 | AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxid | 98.59 | |
| cd02966 | 116 | TlpA_like_family TlpA-like family; composed of Tlp | 98.58 | |
| cd03008 | 146 | TryX_like_RdCVF Tryparedoxin (TryX)-like family, R | 98.56 | |
| KOG0907 | 106 | consensus Thioredoxin [Posttranslational modificat | 98.53 | |
| PF13899 | 82 | Thioredoxin_7: Thioredoxin-like; PDB: 2LST_A 3PH9_ | 98.53 | |
| PRK13728 | 181 | conjugal transfer protein TrbB; Provisional | 98.52 | |
| COG4232 | 569 | Thiol:disulfide interchange protein [Posttranslati | 98.52 | |
| PLN02919 | 1057 | haloacid dehalogenase-like hydrolase family protei | 98.49 | |
| cd03070 | 91 | PDI_b_ERp44 PDIb family, ERp44 subfamily, first re | 98.47 | |
| cd02986 | 114 | DLP Dim1 family, Dim1-like protein (DLP) subfamily | 98.46 | |
| KOG0914 | 265 | consensus Thioredoxin-like protein [Posttranslatio | 98.45 | |
| cd02967 | 114 | mauD Methylamine utilization (mau) D family; mauD | 98.44 | |
| smart00594 | 122 | UAS UAS domain. | 98.43 | |
| TIGR00411 | 82 | redox_disulf_1 small redox-active disulfide protei | 98.41 | |
| cd02988 | 192 | Phd_like_VIAF Phosducin (Phd)-like family, Viral i | 98.38 | |
| cd02951 | 125 | SoxW SoxW family; SoxW is a bacterial periplasmic | 98.38 | |
| PF07912 | 126 | ERp29_N: ERp29, N-terminal domain; InterPro: IPR01 | 98.36 | |
| TIGR01295 | 122 | PedC_BrcD bacteriocin transport accessory protein, | 98.32 | |
| PF02114 | 265 | Phosducin: Phosducin; InterPro: IPR024253 The oute | 98.26 | |
| TIGR03143 | 555 | AhpF_homolog putative alkyl hydroperoxide reductas | 98.25 | |
| PRK11509 | 132 | hydrogenase-1 operon protein HyaE; Provisional | 98.24 | |
| PLN02399 | 236 | phospholipid hydroperoxide glutathione peroxidase | 98.22 | |
| cd03012 | 126 | TlpA_like_DipZ_like TlpA-like family, DipZ-like su | 98.22 | |
| cd02983 | 130 | P5_C P5 family, C-terminal redox inactive TRX-like | 98.18 | |
| TIGR02661 | 189 | MauD methylamine dehydrogenase accessory protein M | 98.15 | |
| PTZ00056 | 199 | glutathione peroxidase; Provisional | 98.14 | |
| cd02952 | 119 | TRP14_like Human TRX-related protein 14 (TRP14)-li | 98.09 | |
| KOG0908 | 288 | consensus Thioredoxin-like protein [Posttranslatio | 98.09 | |
| PLN02412 | 167 | probable glutathione peroxidase | 98.08 | |
| PRK15317 | 517 | alkyl hydroperoxide reductase subunit F; Provision | 98.07 | |
| cd01659 | 69 | TRX_superfamily Thioredoxin (TRX) superfamily; a l | 98.06 | |
| PF08534 | 146 | Redoxin: Redoxin; InterPro: IPR013740 This redoxin | 98.05 | |
| cd02969 | 171 | PRX_like1 Peroxiredoxin (PRX)-like 1 family; hypot | 98.03 | |
| TIGR02196 | 74 | GlrX_YruB Glutaredoxin-like protein, YruB-family. | 98.01 | |
| TIGR02200 | 77 | GlrX_actino Glutaredoxin-like protein. This family | 98.0 | |
| PF13192 | 76 | Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZY | 97.99 | |
| cd03067 | 112 | PDI_b_PDIR_N PDIb family, PDIR subfamily, N-termin | 97.98 | |
| COG0526 | 127 | TrxA Thiol-disulfide isomerase and thioredoxins [P | 97.98 | |
| PF13728 | 215 | TraF: F plasmid transfer operon protein | 97.93 | |
| PTZ00256 | 183 | glutathione peroxidase; Provisional | 97.88 | |
| TIGR02540 | 153 | gpx7 putative glutathione peroxidase Gpx7. This mo | 97.88 | |
| TIGR03140 | 515 | AhpF alkyl hydroperoxide reductase, F subunit. Thi | 97.86 | |
| cd03072 | 111 | PDI_b'_ERp44 PDIb' family, ERp44 subfamily, second | 97.8 | |
| PF07912 | 126 | ERp29_N: ERp29, N-terminal domain; InterPro: IPR01 | 97.79 | |
| COG2143 | 182 | Thioredoxin-related protein [Posttranslational mod | 97.79 | |
| TIGR02739 | 256 | TraF type-F conjugative transfer system pilin asse | 97.76 | |
| PF13098 | 112 | Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_ | 97.7 | |
| KOG2603 | 331 | consensus Oligosaccharyltransferase, gamma subunit | 97.7 | |
| PRK13703 | 248 | conjugal pilus assembly protein TraF; Provisional | 97.69 | |
| cd02981 | 97 | PDI_b_family Protein Disulfide Isomerase (PDIb) fa | 97.68 | |
| PRK14018 | 521 | trifunctional thioredoxin/methionine sulfoxide red | 97.68 | |
| TIGR01626 | 184 | ytfJ_HI0045 conserved hypothetical protein YtfJ-fa | 97.65 | |
| TIGR02740 | 271 | TraF-like TraF-like protein. This protein is relat | 97.62 | |
| PRK11200 | 85 | grxA glutaredoxin 1; Provisional | 97.61 | |
| KOG0911 | 227 | consensus Glutaredoxin-related protein [Posttransl | 97.59 | |
| cd00340 | 152 | GSH_Peroxidase Glutathione (GSH) peroxidase family | 97.56 | |
| cd02991 | 116 | UAS_ETEA UAS family, ETEA subfamily; composed of p | 97.56 | |
| PRK03147 | 173 | thiol-disulfide oxidoreductase; Provisional | 97.54 | |
| cd03067 | 112 | PDI_b_PDIR_N PDIb family, PDIR subfamily, N-termin | 97.54 | |
| cd02973 | 67 | TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)- | 97.53 | |
| TIGR02180 | 84 | GRX_euk Glutaredoxin. This model represents eukary | 97.52 | |
| TIGR02738 | 153 | TrbB type-F conjugative transfer system pilin asse | 97.51 | |
| cd03074 | 120 | PDI_b'_Calsequestrin_C Protein Disulfide Isomerase | 97.49 | |
| PRK15317 | 517 | alkyl hydroperoxide reductase subunit F; Provision | 97.47 | |
| cd03073 | 111 | PDI_b'_ERp72_ERp57 PDIb' family, ERp72 and ERp57 s | 97.45 | |
| PF06110 | 119 | DUF953: Eukaryotic protein of unknown function (DU | 97.45 | |
| cd02959 | 117 | ERp19 Endoplasmic reticulum protein 19 (ERp19) fam | 97.41 | |
| cd02958 | 114 | UAS UAS family; UAS is a domain of unknown functio | 97.4 | |
| KOG3170 | 240 | consensus Conserved phosducin-like protein [Signal | 97.4 | |
| TIGR00412 | 76 | redox_disulf_2 small redox-active disulfide protei | 97.39 | |
| PF14595 | 129 | Thioredoxin_9: Thioredoxin; PDB: 1Z6N_A. | 97.33 | |
| PRK00293 | 571 | dipZ thiol:disulfide interchange protein precursor | 97.32 | |
| TIGR03140 | 515 | AhpF alkyl hydroperoxide reductase, F subunit. Thi | 97.3 | |
| cd03017 | 140 | PRX_BCP Peroxiredoxin (PRX) family, Bacterioferrit | 97.24 | |
| cd02966 | 116 | TlpA_like_family TlpA-like family; composed of Tlp | 97.18 | |
| smart00594 | 122 | UAS UAS domain. | 97.14 | |
| PF13905 | 95 | Thioredoxin_8: Thioredoxin-like; PDB: 1FG4_A 1I5G_ | 97.13 | |
| cd02955 | 124 | SSP411 TRX domain, SSP411 protein family; members | 97.13 | |
| KOG1672 | 211 | consensus ATP binding protein [Posttranslational m | 97.12 | |
| PHA02125 | 75 | thioredoxin-like protein | 97.1 | |
| cd03015 | 173 | PRX_Typ2cys Peroxiredoxin (PRX) family, Typical 2- | 97.1 | |
| TIGR00385 | 173 | dsbE periplasmic protein thiol:disulfide oxidoredu | 97.08 | |
| PF02114 | 265 | Phosducin: Phosducin; InterPro: IPR024253 The oute | 97.05 | |
| KOG0914 | 265 | consensus Thioredoxin-like protein [Posttranslatio | 97.02 | |
| PF03190 | 163 | Thioredox_DsbH: Protein of unknown function, DUF25 | 97.02 | |
| PF00578 | 124 | AhpC-TSA: AhpC/TSA family; InterPro: IPR000866 Per | 97.01 | |
| cd03010 | 127 | TlpA_like_DsbE TlpA-like family, DsbE (also known | 97.01 | |
| KOG3425 | 128 | consensus Uncharacterized conserved protein [Funct | 96.99 | |
| cd02968 | 142 | SCO SCO (an acronym for Synthesis of Cytochrome c | 96.98 | |
| cd02976 | 73 | NrdH NrdH-redoxin (NrdH) family; NrdH is a small m | 96.95 | |
| cd03011 | 123 | TlpA_like_ScsD_MtbDsbE TlpA-like family, suppresso | 96.94 | |
| cd03026 | 89 | AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxid | 96.91 | |
| KOG2501 | 157 | consensus Thioredoxin, nucleoredoxin and related p | 96.9 | |
| PF11009 | 105 | DUF2847: Protein of unknown function (DUF2847); In | 96.84 | |
| cd02970 | 149 | PRX_like2 Peroxiredoxin (PRX)-like 2 family; hypot | 96.77 | |
| PF00462 | 60 | Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Gl | 96.72 | |
| KOG0911 | 227 | consensus Glutaredoxin-related protein [Posttransl | 96.71 | |
| PRK10606 | 183 | btuE putative glutathione peroxidase; Provisional | 96.71 | |
| cd03018 | 149 | PRX_AhpE_like Peroxiredoxin (PRX) family, AhpE-lik | 96.65 | |
| cd03071 | 116 | PDI_b'_NRX PDIb' family, NRX subgroup, redox inact | 96.63 | |
| TIGR02183 | 86 | GRXA Glutaredoxin, GrxA family. This model include | 96.62 | |
| PRK15412 | 185 | thiol:disulfide interchange protein DsbE; Provisio | 96.6 | |
| cd02967 | 114 | mauD Methylamine utilization (mau) D family; mauD | 96.59 | |
| cd03009 | 131 | TryX_like_TryX_NRX Tryparedoxin (TryX)-like family | 96.53 | |
| TIGR02190 | 79 | GlrX-dom Glutaredoxin-family domain. This C-termin | 96.48 | |
| PRK10329 | 81 | glutaredoxin-like protein; Provisional | 96.48 | |
| cd03419 | 82 | GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX h | 96.42 | |
| PRK13728 | 181 | conjugal transfer protein TrbB; Provisional | 96.36 | |
| cd02066 | 72 | GRX_family Glutaredoxin (GRX) family; composed of | 96.34 | |
| PLN02919 | 1057 | haloacid dehalogenase-like hydrolase family protei | 96.28 | |
| cd03014 | 143 | PRX_Atyp2cys Peroxiredoxin (PRX) family, Atypical | 96.26 | |
| cd02964 | 132 | TryX_like_family Tryparedoxin (TryX)-like family; | 96.26 | |
| cd03069 | 104 | PDI_b_ERp57 PDIb family, ERp57 subfamily, first re | 96.24 | |
| PF13728 | 215 | TraF: F plasmid transfer operon protein | 96.21 | |
| PRK09437 | 154 | bcp thioredoxin-dependent thiol peroxidase; Review | 96.21 | |
| cd02971 | 140 | PRX_family Peroxiredoxin (PRX) family; composed of | 96.21 | |
| KOG1672 | 211 | consensus ATP binding protein [Posttranslational m | 96.2 | |
| TIGR03137 | 187 | AhpC peroxiredoxin. This gene contains two invaria | 96.18 | |
| PRK10877 | 232 | protein disulfide isomerase II DsbC; Provisional | 96.12 | |
| KOG3414 | 142 | consensus Component of the U4/U6.U5 snRNP/mitosis | 96.1 | |
| PRK00522 | 167 | tpx lipid hydroperoxide peroxidase; Provisional | 96.08 | |
| cd03066 | 102 | PDI_b_Calsequestrin_middle PDIb family, Calsequest | 96.03 | |
| TIGR02189 | 99 | GlrX-like_plant Glutaredoxin-like family. This fam | 96.0 | |
| PHA03050 | 108 | glutaredoxin; Provisional | 96.0 | |
| cd03027 | 73 | GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Eg | 95.97 | |
| cd03029 | 72 | GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hyb | 95.95 | |
| TIGR00365 | 97 | monothiol glutaredoxin, Grx4 family. The gene for | 95.94 | |
| PF05768 | 81 | DUF836: Glutaredoxin-like domain (DUF836); InterPr | 95.89 | |
| KOG0913 | 248 | consensus Thiol-disulfide isomerase and thioredoxi | 95.88 | |
| TIGR02181 | 79 | GRX_bact Glutaredoxin, GrxC family. This family of | 95.86 | |
| TIGR02194 | 72 | GlrX_NrdH Glutaredoxin-like protein NrdH. NrdH-red | 95.86 | |
| KOG2603 | 331 | consensus Oligosaccharyltransferase, gamma subunit | 95.82 | |
| cd03028 | 90 | GRX_PICOT_like Glutaredoxin (GRX) family, PKC-inte | 95.8 | |
| TIGR02739 | 256 | TraF type-F conjugative transfer system pilin asse | 95.76 | |
| cd03418 | 75 | GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX b | 95.75 | |
| cd02991 | 116 | UAS_ETEA UAS family, ETEA subfamily; composed of p | 95.74 | |
| cd02969 | 171 | PRX_like1 Peroxiredoxin (PRX)-like 1 family; hypot | 95.73 | |
| cd03008 | 146 | TryX_like_RdCVF Tryparedoxin (TryX)-like family, R | 95.63 | |
| PTZ00056 | 199 | glutathione peroxidase; Provisional | 95.52 | |
| PRK13703 | 248 | conjugal pilus assembly protein TraF; Provisional | 95.45 | |
| PRK13190 | 202 | putative peroxiredoxin; Provisional | 95.44 | |
| PRK10824 | 115 | glutaredoxin-4; Provisional | 95.39 | |
| PF07449 | 107 | HyaE: Hydrogenase-1 expression protein HyaE; Inter | 95.38 | |
| cd03012 | 126 | TlpA_like_DipZ_like TlpA-like family, DipZ-like su | 95.33 | |
| KOG3171 | 273 | consensus Conserved phosducin-like protein [Signal | 95.18 | |
| TIGR02661 | 189 | MauD methylamine dehydrogenase accessory protein M | 95.13 | |
| PLN02399 | 236 | phospholipid hydroperoxide glutathione peroxidase | 95.01 | |
| COG0695 | 80 | GrxC Glutaredoxin and related proteins [Posttransl | 94.91 | |
| PRK10638 | 83 | glutaredoxin 3; Provisional | 94.86 | |
| PRK10382 | 187 | alkyl hydroperoxide reductase subunit C; Provision | 94.81 | |
| PF13192 | 76 | Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZY | 94.74 | |
| cd03023 | 154 | DsbA_Com1_like DsbA family, Com1-like subfamily; c | 94.43 | |
| cd03068 | 107 | PDI_b_ERp72 PDIb family, ERp72 subfamily, first re | 94.2 | |
| cd01659 | 69 | TRX_superfamily Thioredoxin (TRX) superfamily; a l | 94.17 | |
| PF13899 | 82 | Thioredoxin_7: Thioredoxin-like; PDB: 2LST_A 3PH9_ | 94.04 | |
| PF11009 | 105 | DUF2847: Protein of unknown function (DUF2847); In | 93.9 | |
| PRK15000 | 200 | peroxidase; Provisional | 93.88 | |
| PRK11657 | 251 | dsbG disulfide isomerase/thiol-disulfide oxidase; | 93.8 | |
| cd02960 | 130 | AGR Anterior Gradient (AGR) family; members of thi | 93.79 | |
| COG0526 | 127 | TrxA Thiol-disulfide isomerase and thioredoxins [P | 93.68 | |
| PF13462 | 162 | Thioredoxin_4: Thioredoxin; PDB: 3FEU_A 3HZ8_A 3DV | 93.6 | |
| PF02966 | 133 | DIM1: Mitosis protein DIM1; InterPro: IPR004123 Th | 93.51 | |
| PLN02412 | 167 | probable glutathione peroxidase | 93.37 | |
| TIGR02540 | 153 | gpx7 putative glutathione peroxidase Gpx7. This mo | 93.33 | |
| PF08534 | 146 | Redoxin: Redoxin; InterPro: IPR013740 This redoxin | 93.32 | |
| COG4232 | 569 | Thiol:disulfide interchange protein [Posttranslati | 93.05 | |
| KOG1752 | 104 | consensus Glutaredoxin and related proteins [Postt | 93.03 | |
| COG2143 | 182 | Thioredoxin-related protein [Posttranslational mod | 92.96 | |
| cd03016 | 203 | PRX_1cys Peroxiredoxin (PRX) family, 1-cys PRX sub | 92.85 | |
| cd03019 | 178 | DsbA_DsbA DsbA family, DsbA subfamily; DsbA is a m | 92.67 | |
| cd03074 | 120 | PDI_b'_Calsequestrin_C Protein Disulfide Isomerase | 92.59 | |
| cd02974 | 94 | AhpF_NTD_N Alkyl hydroperoxide reductase F subunit | 92.56 | |
| PTZ00137 | 261 | 2-Cys peroxiredoxin; Provisional | 92.48 | |
| PTZ00253 | 199 | tryparedoxin peroxidase; Provisional | 92.23 | |
| PRK13599 | 215 | putative peroxiredoxin; Provisional | 92.14 | |
| TIGR02196 | 74 | GlrX_YruB Glutaredoxin-like protein, YruB-family. | 92.13 | |
| cd02972 | 98 | DsbA_family DsbA family; consists of DsbA and DsbA | 91.86 | |
| KOG3414 | 142 | consensus Component of the U4/U6.U5 snRNP/mitosis | 91.81 | |
| PRK12759 | 410 | bifunctional gluaredoxin/ribonucleoside-diphosphat | 91.71 | |
| PRK13191 | 215 | putative peroxiredoxin; Provisional | 91.67 | |
| KOG3170 | 240 | consensus Conserved phosducin-like protein [Signal | 91.29 | |
| PRK13189 | 222 | peroxiredoxin; Provisional | 90.77 | |
| KOG3171 | 273 | consensus Conserved phosducin-like protein [Signal | 89.59 | |
| TIGR02180 | 84 | GRX_euk Glutaredoxin. This model represents eukary | 89.25 | |
| cd03014 | 143 | PRX_Atyp2cys Peroxiredoxin (PRX) family, Atypical | 88.98 | |
| KOG2640 | 319 | consensus Thioredoxin [Function unknown] | 88.94 | |
| PF00578 | 124 | AhpC-TSA: AhpC/TSA family; InterPro: IPR000866 Per | 88.65 | |
| PTZ00256 | 183 | glutathione peroxidase; Provisional | 88.49 | |
| PF07449 | 107 | HyaE: Hydrogenase-1 expression protein HyaE; Inter | 88.28 | |
| cd03020 | 197 | DsbA_DsbC_DsbG DsbA family, DsbC and DsbG subfamil | 88.23 | |
| PRK10954 | 207 | periplasmic protein disulfide isomerase I; Provisi | 88.15 | |
| cd03017 | 140 | PRX_BCP Peroxiredoxin (PRX) family, Bacterioferrit | 88.12 | |
| TIGR01626 | 184 | ytfJ_HI0045 conserved hypothetical protein YtfJ-fa | 87.81 | |
| PRK00522 | 167 | tpx lipid hydroperoxide peroxidase; Provisional | 87.55 | |
| KOG2501 | 157 | consensus Thioredoxin, nucleoredoxin and related p | 86.48 | |
| PF02966 | 133 | DIM1: Mitosis protein DIM1; InterPro: IPR004123 Th | 86.07 | |
| cd03015 | 173 | PRX_Typ2cys Peroxiredoxin (PRX) family, Typical 2- | 85.72 | |
| cd02977 | 105 | ArsC_family Arsenate Reductase (ArsC) family; comp | 85.61 | |
| cd00340 | 152 | GSH_Peroxidase Glutathione (GSH) peroxidase family | 85.38 | |
| PF03190 | 163 | Thioredox_DsbH: Protein of unknown function, DUF25 | 85.2 | |
| PF05768 | 81 | DUF836: Glutaredoxin-like domain (DUF836); InterPr | 83.08 | |
| cd03031 | 147 | GRX_GRX_like Glutaredoxin (GRX) family, GRX-like d | 82.42 | |
| KOG3425 | 128 | consensus Uncharacterized conserved protein [Funct | 81.72 | |
| COG0278 | 105 | Glutaredoxin-related protein [Posttranslational mo | 81.33 | |
| cd03035 | 105 | ArsC_Yffb Arsenate Reductase (ArsC) family, Yffb s | 81.21 | |
| TIGR02200 | 77 | GlrX_actino Glutaredoxin-like protein. This family | 81.1 | |
| PRK01655 | 131 | spxA transcriptional regulator Spx; Reviewed | 80.97 | |
| PRK10382 | 187 | alkyl hydroperoxide reductase subunit C; Provision | 80.47 | |
| cd02970 | 149 | PRX_like2 Peroxiredoxin (PRX)-like 2 family; hypot | 80.17 | |
| cd03036 | 111 | ArsC_like Arsenate Reductase (ArsC) family, unknow | 80.14 |
| >KOG0190 consensus Protein disulfide isomerase (prolyl 4-hydroxylase beta subunit) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.4e-60 Score=429.78 Aligned_cols=351 Identities=38% Similarity=0.632 Sum_probs=315.7
Q ss_pred ccCCHHHHHHHhhhCCeEEEEEecCCCCccHHHHHHHH-hcCCCceEEEeccHHHHHHcCCCCCCCCCEEEEEecCCCCc
Q 018164 2 RTNTVNEAEEFLKKYQTFVLGMFKKFEGSDYEEFVKTA-AADNEIQFVETSNFEVAKVLYPDIKSTDHFLGIVKSEPDRY 80 (360)
Q Consensus 2 ~i~s~~~~~~~~~~~~~~vv~ff~~~~~~~~~~f~~~a-~~~~~~~F~~~~~~~~~~~~~~~~~~~~p~i~~~~~~~~~~ 80 (360)
.+.++++++.|+.+++++|||||.+..+.. ..|..+| ++++++.|+++.++++++++++..+. .+.+++++++++..
T Consensus 138 ~l~~~~~a~~~l~~~~~~vig~F~d~~~~~-~~~~~~a~~l~~d~~F~~ts~~~~~~~~~~~~~~-~~~i~l~kk~d~~~ 215 (493)
T KOG0190|consen 138 TLKTVDEAEEFLSKKDVVVIGFFKDLESLA-ESFFDAASKLRDDYKFAHTSDSDVAKKLELNTEG-TFPIVLFKKFDELL 215 (493)
T ss_pred ecccHHHHHhhccCCceEEEEEecccccch-HHHHHHHHhccccceeeccCcHhHHhhccCCCCC-cceEEeccccccch
Confidence 588999999999999999999999988877 7777777 99999999999999999999986332 45599999999988
Q ss_pred cccCCCCChHHHHHHHhhccCCceeecCcccccccccCCCceEEEEEEec--cchHHHHHHHHHHHHhhcCceEEEEEeC
Q 018164 81 TGYEETFIMDKILQFLNYNKFPLVTKLTDINSASVHSSPIKLQVYVFAKA--DDLKSLLEPLEDIARNFKGKIMFTAVDI 158 (360)
Q Consensus 81 ~~y~g~~~~~~l~~fi~~~~~p~v~~l~~~~~~~~~~~~~~~~v~f~~~~--~~~~~~~~~~~~la~~~~~~i~f~~vd~ 158 (360)
..|+|+++.+.|.+||+.+++|+|.++|..+...+++...+..++||... ...+.+.+.+.++|++|+++++|+.+|.
T Consensus 216 ~~~~~~~~~~~l~~Fi~~~~~plv~~ft~~~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~~~~~vAk~f~~~l~Fi~~d~ 295 (493)
T KOG0190|consen 216 VKYDGSFTPELLKKFIQENSLPLVTEFTVANNAKIYSSFVKLGLDFFVFFKCNRFEELRKKFEEVAKKFKGKLRFILIDP 295 (493)
T ss_pred hhcccccCHHHHHHHHHHhcccccceecccccceeeccccccceeEEeccccccHHHHHHHHHHHHHhcccceEEEEECh
Confidence 89999999999999999999999999999999999988777777777765 5889999999999999999999999988
Q ss_pred CCcccchhHHhhcCCCCCCCceEEEEeCCCcccccCCCC-CCHHHHHHHHHHHhcCccCCccccCCCCCCCC-CceEEEc
Q 018164 159 ADEDLAKPFLTLFGLEESKNTVVTAFDNKAISKFLLESD-LTPSNIEEFCSRLLHGTLTPYLKSQPIPDNTN-ANVQIVV 236 (360)
Q Consensus 159 ~~~~~~~~l~~~~gi~~~~p~~~~~~~~~~~~~y~~~~~-~~~~~i~~fi~~~~~g~~~~~~~se~~p~~~~-~~v~~l~ 236 (360)
..+. +.++.||+....+++.++.....+.+|.++.. .+.++|..|+.+++.|+++|+++|+|+|++++ ++|+.++
T Consensus 296 e~~~---~~~~~~Gl~~~~~~~~~v~~~~~~~Ky~~~~e~~~~~~ie~f~~~~l~Gk~~p~~kSqpiPe~~~~~pVkvvV 372 (493)
T KOG0190|consen 296 ESFA---RVLEFFGLEEEQLPIRAVILNEDGSKYPLEEEELDQENIESFVKDFLDGKVKPHLKSQPIPEDNDRSPVKVVV 372 (493)
T ss_pred HHhh---HHHHhcCcccccCCeeEEeeccccccccCccccccHHHHHHHHHHHhcCccccccccCCCCcccccCCeEEEe
Confidence 8775 68999999955465556777777889998665 88899999999999999999999999999997 8899999
Q ss_pred CccccccccccCccEEEEEeCCCChhhHHHHHHHHHHHHHhcCCCCEEEEEEeCCCCCCCCCCCCCCcEEEEEeCCCccC
Q 018164 237 GKTFDDLVLNSHKDVLLEVYTPWCVTCETTSKQIEKLAKHFKGLDNLVIAKIDASANEHPKLQVEEYPTLLFYPAGDKAN 316 (360)
Q Consensus 237 ~~~~~~~~~~~~~~~~v~f~~~~c~~c~~~~~~~~~la~~~~~~~~~~~~~id~~~~~~~~~~i~~~Pti~~~~~g~~~~ 316 (360)
++||++++.+.+++|||.||||||+||+++.|+|++||+.+++.+++.+++||++.|+++...+++||||++|++|.+.+
T Consensus 373 gknfd~iv~de~KdVLvEfyAPWCgHCk~laP~~eeLAe~~~~~~~vviAKmDaTaNd~~~~~~~~fPTI~~~pag~k~~ 452 (493)
T KOG0190|consen 373 GKNFDDIVLDEGKDVLVEFYAPWCGHCKALAPIYEELAEKYKDDENVVIAKMDATANDVPSLKVDGFPTILFFPAGHKSN 452 (493)
T ss_pred ecCHHHHhhccccceEEEEcCcccchhhhhhhHHHHHHHHhcCCCCcEEEEeccccccCccccccccceEEEecCCCCCC
Confidence 99999999999999999999999999999999999999999998899999999999999999999999999999999988
Q ss_pred ceEecCCCCHHHHHHHHHHhcCCCCCCChhhhhhhhhcCCCCCC
Q 018164 317 PIKVSARSSSKNIAAFIKEQLKEKDQSPKDEQWKEKDQAPKDEL 360 (360)
Q Consensus 317 ~~~~~g~~~~~~l~~~i~~~~~~~~~~~~~e~~~~~~~~~~de~ 360 (360)
|+.|+|.|+.+++..||.++.+..+...+++...+ ..||||
T Consensus 453 pv~y~g~R~le~~~~fi~~~a~~~~~~~~ee~~~~---~~~dEL 493 (493)
T KOG0190|consen 453 PVIYNGDRTLEDLKKFIKKSATESATPKKEEKKDE---SVKDEL 493 (493)
T ss_pred CcccCCCcchHHHHhhhccCCCccccccchhcccc---cccccC
Confidence 99999999999999999999885444333333333 889997
|
|
| >TIGR01130 ER_PDI_fam protein disulfide isomerases, eukaryotic | Back alignment and domain information |
|---|
| >PTZ00102 disulphide isomerase; Provisional | Back alignment and domain information |
|---|
| >KOG0191 consensus Thioredoxin/protein disulfide isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13848 Thioredoxin_6: Thioredoxin-like domain; PDB: 3EC3_B 3BOA_A 2B5E_A 1BJX_A 2K18_A 3UEM_A 3BJ5_A 2BJX_A 2R2J_A 2L4C_A | Back alignment and domain information |
|---|
| >KOG0191 consensus Thioredoxin/protein disulfide isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03006 PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamily; EFP1 is a binding partner protein of thyroid oxidase (ThOX), also called Duox | Back alignment and domain information |
|---|
| >TIGR02187 GlrX_arch Glutaredoxin-like domain protein | Back alignment and domain information |
|---|
| >KOG0910 consensus Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd02995 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain (a') subfamily; composed of the C-terminal redox active a' domains of PDI, ERp72, ERp57 (or ERp60) and EFP1 | Back alignment and domain information |
|---|
| >cd03004 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains | Back alignment and domain information |
|---|
| >cd03003 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains | Back alignment and domain information |
|---|
| >PF01216 Calsequestrin: Calsequestrin; InterPro: IPR001393 Calsequestrin is the principal calcium-binding protein present in the sarcoplasmic reticulum of cardiac and skeletal muscle [] | Back alignment and domain information |
|---|
| >PF00085 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thioredoxins [, , , ] are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms | Back alignment and domain information |
|---|
| >cd02996 PDI_a_ERp44 PDIa family, endoplasmic reticulum protein 44 (ERp44) subfamily; ERp44 is an ER-resident protein, induced during stress, involved in thiol-mediated ER retention | Back alignment and domain information |
|---|
| >TIGR01130 ER_PDI_fam protein disulfide isomerases, eukaryotic | Back alignment and domain information |
|---|
| >cd03065 PDI_b_Calsequestrin_N PDIb family, Calsequestrin subfamily, N-terminal TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle | Back alignment and domain information |
|---|
| >cd03002 PDI_a_MPD1_like PDI family, MPD1-like subfamily; composed of eukaryotic proteins similar to Saccharomyces cerevisiae MPD1 protein, which contains a single redox active TRX domain located at the N-terminus, and an ER retention signal at the C-terminus indicative of an ER-resident protein | Back alignment and domain information |
|---|
| >KOG0190 consensus Protein disulfide isomerase (prolyl 4-hydroxylase beta subunit) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03007 PDI_a_ERp29_N PDIa family, endoplasmic reticulum protein 29 (ERp29) subfamily; ERp29 is a ubiquitous ER-resident protein expressed in high levels in secretory cells | Back alignment and domain information |
|---|
| >cd02994 PDI_a_TMX PDIa family, TMX subfamily; composed of proteins similar to the TRX-related human transmembrane protein, TMX | Back alignment and domain information |
|---|
| >PTZ00102 disulphide isomerase; Provisional | Back alignment and domain information |
|---|
| >cd02993 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfate (APS) reductase subfamily; composed of plant-type APS reductases containing a C-terminal redox active TRX domain and an N-terminal reductase domain which is part of a superfamily that includes N type ATP PPases | Back alignment and domain information |
|---|
| >cd03001 PDI_a_P5 PDIa family, P5 subfamily; composed of eukaryotic proteins similar to human P5, a PDI-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain) | Back alignment and domain information |
|---|
| >PRK09381 trxA thioredoxin; Provisional | Back alignment and domain information |
|---|
| >cd03005 PDI_a_ERp46 PDIa family, endoplasmic reticulum protein 46 (ERp46) subfamily; ERp46 is an ER-resident protein containing three redox active TRX domains | Back alignment and domain information |
|---|
| >COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PTZ00443 Thioredoxin domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >cd02998 PDI_a_ERp38 PDIa family, endoplasmic reticulum protein 38 (ERp38) subfamily; composed of proteins similar to the P5-like protein first isolated from alfalfa, which contains two redox active TRX (a) domains at the N-terminus, like human P5, and a C-terminal domain with homology to the C-terminal domain of ERp29, unlike human P5 | Back alignment and domain information |
|---|
| >cd02956 ybbN ybbN protein family; ybbN is a hypothetical protein containing a redox-inactive TRX-like domain | Back alignment and domain information |
|---|
| >cd02963 TRX_DnaJ TRX domain, DnaJ domain containing protein family; composed of uncharacterized proteins of about 500-800 amino acids, containing an N-terminal DnaJ domain followed by one redox active TRX domain | Back alignment and domain information |
|---|
| >TIGR01126 pdi_dom protein disulfide-isomerase domain | Back alignment and domain information |
|---|
| >cd02999 PDI_a_ERp44_like PDIa family, endoplasmic reticulum protein 44 (ERp44)-like subfamily; composed of uncharacterized PDI-like eukaryotic proteins containing only one redox active TRX (a) domain with a CXXS motif, similar to ERp44 | Back alignment and domain information |
|---|
| >PHA02278 thioredoxin-like protein | Back alignment and domain information |
|---|
| >cd02954 DIM1 Dim1 family; Dim1 is also referred to as U5 small nuclear ribonucleoprotein particle (snRNP)-specific 15kD protein | Back alignment and domain information |
|---|
| >cd02992 PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidase (QSOX) subfamily; QSOX is a eukaryotic protein containing an N-terminal redox active TRX domain, similar to that of PDI, and a small C-terminal flavin adenine dinucleotide (FAD)-binding domain homologous to the yeast ERV1p protein | Back alignment and domain information |
|---|
| >cd02997 PDI_a_PDIR PDIa family, PDIR subfamily; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related) | Back alignment and domain information |
|---|
| >PRK10996 thioredoxin 2; Provisional | Back alignment and domain information |
|---|
| >PLN02309 5'-adenylylsulfate reductase | Back alignment and domain information |
|---|
| >TIGR00424 APS_reduc 5'-adenylylsulfate reductase, thioredoxin-independent | Back alignment and domain information |
|---|
| >cd02948 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fusion protein family; most members of this group are fusion proteins which contain one redox active TRX domain containing a CXXC motif and three NDPK domains, and are characterized as intermediate chains (ICs) of axonemal outer arm dynein | Back alignment and domain information |
|---|
| >TIGR01068 thioredoxin thioredoxin | Back alignment and domain information |
|---|
| >cd02985 TRX_CDSP32 TRX family, chloroplastic drought-induced stress protein of 32 kD (CDSP32); CDSP32 is composed of two TRX domains, a C-terminal TRX domain which contains a redox active CXXC motif and an N-terminal TRX-like domain which contains an SXXS sequence instead of the redox active motif | Back alignment and domain information |
|---|
| >KOG0912 consensus Thiol-disulfide isomerase and thioredoxin [Posttranslational modification, protein turnover, chaperones; Energy production and conversion] | Back alignment and domain information |
|---|
| >cd02962 TMX2 TMX2 family; composed of proteins similar to human TMX2, a 372-amino acid TRX-related transmembrane protein, identified and characterized through the cloning of its cDNA from a human fetal library | Back alignment and domain information |
|---|
| >cd03000 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed of eukaryotic proteins similar to human TMX3, a TRX related transmembrane protein containing one redox active TRX domain at the N-terminus and a classical ER retrieval sequence for type I transmembrane proteins at the C-terminus | Back alignment and domain information |
|---|
| >cd02957 Phd_like Phosducin (Phd)-like family; composed of Phd and Phd-like proteins (PhLP), characterized as cytosolic regulators of G protein functions | Back alignment and domain information |
|---|
| >cd03066 PDI_b_Calsequestrin_middle PDIb family, Calsequestrin subfamily, Middle TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle | Back alignment and domain information |
|---|
| >cd02981 PDI_b_family Protein Disulfide Isomerase (PDIb) family, redox inactive TRX-like domain b; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants | Back alignment and domain information |
|---|
| >cd02965 HyaE HyaE family; HyaE is also called HupG and HoxO | Back alignment and domain information |
|---|
| >PF01216 Calsequestrin: Calsequestrin; InterPro: IPR001393 Calsequestrin is the principal calcium-binding protein present in the sarcoplasmic reticulum of cardiac and skeletal muscle [] | Back alignment and domain information |
|---|
| >KOG4277 consensus Uncharacterized conserved protein, contains thioredoxin domain [General function prediction only] | Back alignment and domain information |
|---|
| >cd02961 PDI_a_family Protein Disulfide Isomerase (PDIa) family, redox active TRX domains; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants | Back alignment and domain information |
|---|
| >cd03069 PDI_b_ERp57 PDIb family, ERp57 subfamily, first redox inactive TRX-like domain b; ERp57 (or ERp60) exhibits both disulfide oxidase and reductase functions like PDI, by catalyzing the formation of disulfide bonds of newly synthesized polypeptides in the ER and acting as isomerases to correct any non-native disulfide bonds | Back alignment and domain information |
|---|
| >cd02989 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thioredoxin (TRX) domain containing protein 9 (TxnDC9) subfamily; composed of predominantly uncharacterized eukaryotic proteins, containing a TRX-like domain without the redox active CXXC motif | Back alignment and domain information |
|---|
| >cd02949 TRX_NTR TRX domain, novel NADPH thioredoxin reductase (NTR) family; composed of fusion proteins found only in oxygenic photosynthetic organisms containing both TRX and NTR domains | Back alignment and domain information |
|---|
| >cd03072 PDI_b'_ERp44 PDIb' family, ERp44 subfamily, second redox inactive TRX-like domain b'; ERp44 is an endoplasmic reticulum (ER)-resident protein, induced during stress, involved in thiol-mediated ER retention | Back alignment and domain information |
|---|
| >PLN00410 U5 snRNP protein, DIM1 family; Provisional | Back alignment and domain information |
|---|
| >cd02953 DsbDgamma DsbD gamma family; DsbD gamma is the C-terminal periplasmic domain of the bacterial protein DsbD | Back alignment and domain information |
|---|
| >cd02950 TxlA TRX-like protein A (TxlA) family; TxlA was originally isolated from the cyanobacterium Synechococcus | Back alignment and domain information |
|---|
| >cd02987 Phd_like_Phd Phosducin (Phd)-like family, Phd subfamily; Phd is a cytosolic regulator of G protein functions | Back alignment and domain information |
|---|
| >cd02975 PfPDO_like_N Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO)-like family, N-terminal TRX-fold subdomain; composed of proteins with similarity to PfPDO, a redox active thermostable protein believed to be the archaeal counterpart of bacterial DsbA and eukaryotic protein disulfide isomerase (PDI), which are both involved in oxidative protein folding | Back alignment and domain information |
|---|
| >cd03003 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains | Back alignment and domain information |
|---|
| >cd02984 TRX_PICOT TRX domain, PICOT (for PKC-interacting cousin of TRX) subfamily; PICOT is a protein that interacts with protein kinase C (PKC) theta, a calcium independent PKC isoform selectively expressed in skeletal muscle and T lymphocytes | Back alignment and domain information |
|---|
| >KOG0907 consensus Thioredoxin [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0912 consensus Thiol-disulfide isomerase and thioredoxin [Posttranslational modification, protein turnover, chaperones; Energy production and conversion] | Back alignment and domain information |
|---|
| >cd03068 PDI_b_ERp72 PDIb family, ERp72 subfamily, first redox inactive TRX-like domain b; ERp72 exhibits both disulfide oxidase and reductase functions like PDI, by catalyzing the formation of disulfide bonds of newly synthesized polypeptides in the ER and acting as isomerases to correct any non-native disulfide bonds | Back alignment and domain information |
|---|
| >cd02988 Phd_like_VIAF Phosducin (Phd)-like family, Viral inhibitor of apoptosis (IAP)-associated factor (VIAF) subfamily; VIAF is a Phd-like protein that functions in caspase activation during apoptosis | Back alignment and domain information |
|---|
| >cd03006 PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamily; EFP1 is a binding partner protein of thyroid oxidase (ThOX), also called Duox | Back alignment and domain information |
|---|
| >TIGR02187 GlrX_arch Glutaredoxin-like domain protein | Back alignment and domain information |
|---|
| >cd02986 DLP Dim1 family, Dim1-like protein (DLP) subfamily; DLP is a novel protein which shares 38% sequence identity to Dim1 | Back alignment and domain information |
|---|
| >cd03004 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains | Back alignment and domain information |
|---|
| >PTZ00051 thioredoxin; Provisional | Back alignment and domain information |
|---|
| >PF00085 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thioredoxins [, , , ] are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms | Back alignment and domain information |
|---|
| >TIGR01295 PedC_BrcD bacteriocin transport accessory protein, putative | Back alignment and domain information |
|---|
| >cd02947 TRX_family TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains | Back alignment and domain information |
|---|
| >PF13848 Thioredoxin_6: Thioredoxin-like domain; PDB: 3EC3_B 3BOA_A 2B5E_A 1BJX_A 2K18_A 3UEM_A 3BJ5_A 2BJX_A 2R2J_A 2L4C_A | Back alignment and domain information |
|---|
| >cd02996 PDI_a_ERp44 PDIa family, endoplasmic reticulum protein 44 (ERp44) subfamily; ERp44 is an ER-resident protein, induced during stress, involved in thiol-mediated ER retention | Back alignment and domain information |
|---|
| >cd02982 PDI_b'_family Protein Disulfide Isomerase (PDIb') family, redox inactive TRX-like domain b'; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants | Back alignment and domain information |
|---|
| >KOG0908 consensus Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd02951 SoxW SoxW family; SoxW is a bacterial periplasmic TRX, containing a redox active CXXC motif, encoded by a genetic locus (sox operon) involved in thiosulfate oxidation | Back alignment and domain information |
|---|
| >cd02982 PDI_b'_family Protein Disulfide Isomerase (PDIb') family, redox inactive TRX-like domain b'; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants | Back alignment and domain information |
|---|
| >cd03007 PDI_a_ERp29_N PDIa family, endoplasmic reticulum protein 29 (ERp29) subfamily; ERp29 is a ubiquitous ER-resident protein expressed in high levels in secretory cells | Back alignment and domain information |
|---|
| >cd03001 PDI_a_P5 PDIa family, P5 subfamily; composed of eukaryotic proteins similar to human P5, a PDI-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain) | Back alignment and domain information |
|---|
| >cd03002 PDI_a_MPD1_like PDI family, MPD1-like subfamily; composed of eukaryotic proteins similar to Saccharomyces cerevisiae MPD1 protein, which contains a single redox active TRX domain located at the N-terminus, and an ER retention signal at the C-terminus indicative of an ER-resident protein | Back alignment and domain information |
|---|
| >PTZ00062 glutaredoxin; Provisional | Back alignment and domain information |
|---|
| >TIGR00411 redox_disulf_1 small redox-active disulfide protein 1 | Back alignment and domain information |
|---|
| >cd03065 PDI_b_Calsequestrin_N PDIb family, Calsequestrin subfamily, N-terminal TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle | Back alignment and domain information |
|---|
| >KOG0910 consensus Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd02993 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfate (APS) reductase subfamily; composed of plant-type APS reductases containing a C-terminal redox active TRX domain and an N-terminal reductase domain which is part of a superfamily that includes N type ATP PPases | Back alignment and domain information |
|---|
| >cd02952 TRP14_like Human TRX-related protein 14 (TRP14)-like family; composed of proteins similar to TRP14, a 14kD cytosolic protein that shows disulfide reductase activity in vitro with a different substrate specificity compared with another human cytosolic protein, TRX1 | Back alignment and domain information |
|---|
| >TIGR01126 pdi_dom protein disulfide-isomerase domain | Back alignment and domain information |
|---|
| >cd03073 PDI_b'_ERp72_ERp57 PDIb' family, ERp72 and ERp57 subfamily, second redox inactive TRX-like domain b'; ERp72 and ER57 are involved in oxidative protein folding in the ER, like PDI | Back alignment and domain information |
|---|
| >cd02994 PDI_a_TMX PDIa family, TMX subfamily; composed of proteins similar to the TRX-related human transmembrane protein, TMX | Back alignment and domain information |
|---|
| >KOG4277 consensus Uncharacterized conserved protein, contains thioredoxin domain [General function prediction only] | Back alignment and domain information |
|---|
| >cd03005 PDI_a_ERp46 PDIa family, endoplasmic reticulum protein 46 (ERp46) subfamily; ERp46 is an ER-resident protein containing three redox active TRX domains | Back alignment and domain information |
|---|
| >cd02995 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain (a') subfamily; composed of the C-terminal redox active a' domains of PDI, ERp72, ERp57 (or ERp60) and EFP1 | Back alignment and domain information |
|---|
| >cd02959 ERp19 Endoplasmic reticulum protein 19 (ERp19) family; ERp19 is also known as ERp18, a protein located in the ER containing one redox active TRX domain | Back alignment and domain information |
|---|
| >cd02998 PDI_a_ERp38 PDIa family, endoplasmic reticulum protein 38 (ERp38) subfamily; composed of proteins similar to the P5-like protein first isolated from alfalfa, which contains two redox active TRX (a) domains at the N-terminus, like human P5, and a C-terminal domain with homology to the C-terminal domain of ERp29, unlike human P5 | Back alignment and domain information |
|---|
| >PTZ00443 Thioredoxin domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >PTZ00062 glutaredoxin; Provisional | Back alignment and domain information |
|---|
| >KOG1731 consensus FAD-dependent sulfhydryl oxidase/quiescin and related proteins [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK09381 trxA thioredoxin; Provisional | Back alignment and domain information |
|---|
| >cd02983 P5_C P5 family, C-terminal redox inactive TRX-like domain; P5 is a protein disulfide isomerase (PDI)-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain) | Back alignment and domain information |
|---|
| >COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd02997 PDI_a_PDIR PDIa family, PDIR subfamily; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related) | Back alignment and domain information |
|---|
| >PRK10996 thioredoxin 2; Provisional | Back alignment and domain information |
|---|
| >cd02956 ybbN ybbN protein family; ybbN is a hypothetical protein containing a redox-inactive TRX-like domain | Back alignment and domain information |
|---|
| >TIGR00412 redox_disulf_2 small redox-active disulfide protein 2 | Back alignment and domain information |
|---|
| >cd02961 PDI_a_family Protein Disulfide Isomerase (PDIa) family, redox active TRX domains; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants | Back alignment and domain information |
|---|
| >cd02999 PDI_a_ERp44_like PDIa family, endoplasmic reticulum protein 44 (ERp44)-like subfamily; composed of uncharacterized PDI-like eukaryotic proteins containing only one redox active TRX (a) domain with a CXXS motif, similar to ERp44 | Back alignment and domain information |
|---|
| >cd02963 TRX_DnaJ TRX domain, DnaJ domain containing protein family; composed of uncharacterized proteins of about 500-800 amino acids, containing an N-terminal DnaJ domain followed by one redox active TRX domain | Back alignment and domain information |
|---|
| >TIGR01068 thioredoxin thioredoxin | Back alignment and domain information |
|---|
| >TIGR00424 APS_reduc 5'-adenylylsulfate reductase, thioredoxin-independent | Back alignment and domain information |
|---|
| >PRK00293 dipZ thiol:disulfide interchange protein precursor; Provisional | Back alignment and domain information |
|---|
| >cd03000 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed of eukaryotic proteins similar to human TMX3, a TRX related transmembrane protein containing one redox active TRX domain at the N-terminus and a classical ER retrieval sequence for type I transmembrane proteins at the C-terminus | Back alignment and domain information |
|---|
| >cd02965 HyaE HyaE family; HyaE is also called HupG and HoxO | Back alignment and domain information |
|---|
| >PLN02309 5'-adenylylsulfate reductase | Back alignment and domain information |
|---|
| >PHA02125 thioredoxin-like protein | Back alignment and domain information |
|---|
| >cd02950 TxlA TRX-like protein A (TxlA) family; TxlA was originally isolated from the cyanobacterium Synechococcus | Back alignment and domain information |
|---|
| >TIGR02738 TrbB type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB | Back alignment and domain information |
|---|
| >PF13098 Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_A 2L57_A 1EEJ_B 1TJD_A 1JZD_B 1JZO_A 1G0T_B 3GV1_A 1V58_A 2H0H_A | Back alignment and domain information |
|---|
| >TIGR02740 TraF-like TraF-like protein | Back alignment and domain information |
|---|
| >cd02955 SSP411 TRX domain, SSP411 protein family; members of this family are highly conserved proteins present in eukaryotes, bacteria and archaea, about 600-800 amino acids in length, which contain a TRX domain with a redox active CXXC motif | Back alignment and domain information |
|---|
| >KOG0913 consensus Thiol-disulfide isomerase and thioredoxin [Posttranslational modification, protein turnover, chaperones; Energy production and conversion] | Back alignment and domain information |
|---|
| >PHA02278 thioredoxin-like protein | Back alignment and domain information |
|---|
| >KOG1731 consensus FAD-dependent sulfhydryl oxidase/quiescin and related proteins [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >cd02954 DIM1 Dim1 family; Dim1 is also referred to as U5 small nuclear ribonucleoprotein particle (snRNP)-specific 15kD protein | Back alignment and domain information |
|---|
| >cd02948 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fusion protein family; most members of this group are fusion proteins which contain one redox active TRX domain containing a CXXC motif and three NDPK domains, and are characterized as intermediate chains (ICs) of axonemal outer arm dynein | Back alignment and domain information |
|---|
| >cd02989 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thioredoxin (TRX) domain containing protein 9 (TxnDC9) subfamily; composed of predominantly uncharacterized eukaryotic proteins, containing a TRX-like domain without the redox active CXXC motif | Back alignment and domain information |
|---|
| >PRK14018 trifunctional thioredoxin/methionine sulfoxide reductase A/B protein; Provisional | Back alignment and domain information |
|---|
| >PRK11509 hydrogenase-1 operon protein HyaE; Provisional | Back alignment and domain information |
|---|
| >cd02953 DsbDgamma DsbD gamma family; DsbD gamma is the C-terminal periplasmic domain of the bacterial protein DsbD | Back alignment and domain information |
|---|
| >cd02985 TRX_CDSP32 TRX family, chloroplastic drought-induced stress protein of 32 kD (CDSP32); CDSP32 is composed of two TRX domains, a C-terminal TRX domain which contains a redox active CXXC motif and an N-terminal TRX-like domain which contains an SXXS sequence instead of the redox active motif | Back alignment and domain information |
|---|
| >cd02992 PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidase (QSOX) subfamily; QSOX is a eukaryotic protein containing an N-terminal redox active TRX domain, similar to that of PDI, and a small C-terminal flavin adenine dinucleotide (FAD)-binding domain homologous to the yeast ERV1p protein | Back alignment and domain information |
|---|
| >TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit | Back alignment and domain information |
|---|
| >PRK03147 thiol-disulfide oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >cd02962 TMX2 TMX2 family; composed of proteins similar to human TMX2, a 372-amino acid TRX-related transmembrane protein, identified and characterized through the cloning of its cDNA from a human fetal library | Back alignment and domain information |
|---|
| >PLN00410 U5 snRNP protein, DIM1 family; Provisional | Back alignment and domain information |
|---|
| >cd02957 Phd_like Phosducin (Phd)-like family; composed of Phd and Phd-like proteins (PhLP), characterized as cytosolic regulators of G protein functions | Back alignment and domain information |
|---|
| >cd02984 TRX_PICOT TRX domain, PICOT (for PKC-interacting cousin of TRX) subfamily; PICOT is a protein that interacts with protein kinase C (PKC) theta, a calcium independent PKC isoform selectively expressed in skeletal muscle and T lymphocytes | Back alignment and domain information |
|---|
| >cd02975 PfPDO_like_N Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO)-like family, N-terminal TRX-fold subdomain; composed of proteins with similarity to PfPDO, a redox active thermostable protein believed to be the archaeal counterpart of bacterial DsbA and eukaryotic protein disulfide isomerase (PDI), which are both involved in oxidative protein folding | Back alignment and domain information |
|---|
| >PRK15412 thiol:disulfide interchange protein DsbE; Provisional | Back alignment and domain information |
|---|
| >cd02973 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)-like family; composed of archaeal and bacterial proteins that show similarity to both TRX and GRX, including the C-terminal TRX-fold subdomain of Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO) | Back alignment and domain information |
|---|
| >cd02949 TRX_NTR TRX domain, novel NADPH thioredoxin reductase (NTR) family; composed of fusion proteins found only in oxygenic photosynthetic organisms containing both TRX and NTR domains | Back alignment and domain information |
|---|
| >TIGR00385 dsbE periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily | Back alignment and domain information |
|---|
| >cd02964 TryX_like_family Tryparedoxin (TryX)-like family; composed of TryX and related proteins including nucleoredoxin (NRX), rod-derived cone viability factor (RdCVF) and the nematode homolog described as a 16-kD class of TRX | Back alignment and domain information |
|---|
| >PTZ00051 thioredoxin; Provisional | Back alignment and domain information |
|---|
| >cd03009 TryX_like_TryX_NRX Tryparedoxin (TryX)-like family, TryX and nucleoredoxin (NRX) subfamily; TryX and NRX are thioredoxin (TRX)-like protein disulfide oxidoreductases that alter the redox state of target proteins via the reversible oxidation of an active center CXXC motif | Back alignment and domain information |
|---|
| >cd02958 UAS UAS family; UAS is a domain of unknown function | Back alignment and domain information |
|---|
| >cd02960 AGR Anterior Gradient (AGR) family; members of this family are similar to secreted proteins encoded by the cement gland-specific genes XAG-1 and XAG-2, expressed in the anterior region of dorsal ectoderm of Xenopus | Back alignment and domain information |
|---|
| >PF13905 Thioredoxin_8: Thioredoxin-like; PDB: 1FG4_A 1I5G_A 1OC8_B 1O6J_A 1OC9_B 1O81_A 3FKF_A 1O85_A 1O7U_A 1O8W_A | Back alignment and domain information |
|---|
| >cd03011 TlpA_like_ScsD_MtbDsbE TlpA-like family, suppressor for copper sensitivity D protein (ScsD) and actinobacterial DsbE homolog subfamily; composed of ScsD, the DsbE homolog of Mycobacterium tuberculosis (MtbDsbE) and similar proteins, all containing a redox-active CXXC motif | Back alignment and domain information |
|---|
| >cd02947 TRX_family TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains | Back alignment and domain information |
|---|
| >cd03010 TlpA_like_DsbE TlpA-like family, DsbE (also known as CcmG and CycY) subfamily; DsbE is a membrane-anchored, periplasmic TRX-like reductase containing a CXXC motif that specifically donates reducing equivalents to apocytochrome c via CcmH, another cytochrome c maturation (Ccm) factor with a redox active CXXC motif | Back alignment and domain information |
|---|
| >cd02987 Phd_like_Phd Phosducin (Phd)-like family, Phd subfamily; Phd is a cytosolic regulator of G protein functions | Back alignment and domain information |
|---|
| >cd03026 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxide reductase F subunit (AhpF) N-terminal domain (NTD) subfamily, C-terminal TRX-fold subdomain; AhpF is a homodimeric flavoenzyme which catalyzes the NADH-dependent reduction of the peroxiredoxin AhpC, which then reduces hydrogen peroxide and organic hydroperoxides | Back alignment and domain information |
|---|
| >cd02966 TlpA_like_family TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins | Back alignment and domain information |
|---|
| >cd03008 TryX_like_RdCVF Tryparedoxin (TryX)-like family, Rod-derived cone viability factor (RdCVF) subfamily; RdCVF is a thioredoxin (TRX)-like protein specifically expressed in photoreceptors | Back alignment and domain information |
|---|
| >KOG0907 consensus Thioredoxin [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13899 Thioredoxin_7: Thioredoxin-like; PDB: 2LST_A 3PH9_A 1UC7_A 2JU5_A 1VRS_D 2FWG_A 2FWF_A 2FWH_A 2FWE_A 3FK8_A | Back alignment and domain information |
|---|
| >PRK13728 conjugal transfer protein TrbB; Provisional | Back alignment and domain information |
|---|
| >COG4232 Thiol:disulfide interchange protein [Posttranslational modification, protein turnover, chaperones / Energy production and conversion] | Back alignment and domain information |
|---|
| >PLN02919 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >cd03070 PDI_b_ERp44 PDIb family, ERp44 subfamily, first redox inactive TRX-like domain b; ERp44 is an endoplasmic reticulum (ER)-resident protein, induced during stress, involved in thiol-mediated ER retention | Back alignment and domain information |
|---|
| >cd02986 DLP Dim1 family, Dim1-like protein (DLP) subfamily; DLP is a novel protein which shares 38% sequence identity to Dim1 | Back alignment and domain information |
|---|
| >KOG0914 consensus Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd02967 mauD Methylamine utilization (mau) D family; mauD protein is the translation product of the mauD gene found in methylotrophic bacteria, which are able to use methylamine as a sole carbon source and a nitrogen source | Back alignment and domain information |
|---|
| >smart00594 UAS UAS domain | Back alignment and domain information |
|---|
| >TIGR00411 redox_disulf_1 small redox-active disulfide protein 1 | Back alignment and domain information |
|---|
| >cd02988 Phd_like_VIAF Phosducin (Phd)-like family, Viral inhibitor of apoptosis (IAP)-associated factor (VIAF) subfamily; VIAF is a Phd-like protein that functions in caspase activation during apoptosis | Back alignment and domain information |
|---|
| >cd02951 SoxW SoxW family; SoxW is a bacterial periplasmic TRX, containing a redox active CXXC motif, encoded by a genetic locus (sox operon) involved in thiosulfate oxidation | Back alignment and domain information |
|---|
| >PF07912 ERp29_N: ERp29, N-terminal domain; InterPro: IPR012883 ERp29 (P52555 from SWISSPROT) is a ubiquitously expressed endoplasmic reticulum protein, and is involved in the processes of protein maturation and protein secretion in this organelle [, ] | Back alignment and domain information |
|---|
| >TIGR01295 PedC_BrcD bacteriocin transport accessory protein, putative | Back alignment and domain information |
|---|
| >PF02114 Phosducin: Phosducin; InterPro: IPR024253 The outer and inner segments of vertebrate rod photoreceptor cells contain phosducin, a soluble phosphoprotein that complexes with the beta/gamma-subunits of the GTP-binding protein, transducin | Back alignment and domain information |
|---|
| >TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit | Back alignment and domain information |
|---|
| >PRK11509 hydrogenase-1 operon protein HyaE; Provisional | Back alignment and domain information |
|---|
| >PLN02399 phospholipid hydroperoxide glutathione peroxidase | Back alignment and domain information |
|---|
| >cd03012 TlpA_like_DipZ_like TlpA-like family, DipZ-like subfamily; composed uncharacterized proteins containing a TlpA-like TRX domain | Back alignment and domain information |
|---|
| >cd02983 P5_C P5 family, C-terminal redox inactive TRX-like domain; P5 is a protein disulfide isomerase (PDI)-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain) | Back alignment and domain information |
|---|
| >TIGR02661 MauD methylamine dehydrogenase accessory protein MauD | Back alignment and domain information |
|---|
| >PTZ00056 glutathione peroxidase; Provisional | Back alignment and domain information |
|---|
| >cd02952 TRP14_like Human TRX-related protein 14 (TRP14)-like family; composed of proteins similar to TRP14, a 14kD cytosolic protein that shows disulfide reductase activity in vitro with a different substrate specificity compared with another human cytosolic protein, TRX1 | Back alignment and domain information |
|---|
| >KOG0908 consensus Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN02412 probable glutathione peroxidase | Back alignment and domain information |
|---|
| >PRK15317 alkyl hydroperoxide reductase subunit F; Provisional | Back alignment and domain information |
|---|
| >cd01659 TRX_superfamily Thioredoxin (TRX) superfamily; a large, diverse group of proteins containing a TRX-fold | Back alignment and domain information |
|---|
| >PF08534 Redoxin: Redoxin; InterPro: IPR013740 This redoxin domain is found in peroxiredoxin, thioredoxin and glutaredoxin proteins | Back alignment and domain information |
|---|
| >cd02969 PRX_like1 Peroxiredoxin (PRX)-like 1 family; hypothetical proteins that show sequence similarity to PRXs | Back alignment and domain information |
|---|
| >TIGR02196 GlrX_YruB Glutaredoxin-like protein, YruB-family | Back alignment and domain information |
|---|
| >TIGR02200 GlrX_actino Glutaredoxin-like protein | Back alignment and domain information |
|---|
| >PF13192 Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZYN_A 1HYU_A 1ILO_A 1J08_F 2YWM_B 2AYT_B 2HLS_B 1A8L_A 2K8S_B | Back alignment and domain information |
|---|
| >cd03067 PDI_b_PDIR_N PDIb family, PDIR subfamily, N-terminal TRX-like b domain; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related) | Back alignment and domain information |
|---|
| >COG0526 TrxA Thiol-disulfide isomerase and thioredoxins [Posttranslational modification, protein turnover, chaperones / Energy production and conversion] | Back alignment and domain information |
|---|
| >PF13728 TraF: F plasmid transfer operon protein | Back alignment and domain information |
|---|
| >PTZ00256 glutathione peroxidase; Provisional | Back alignment and domain information |
|---|
| >TIGR02540 gpx7 putative glutathione peroxidase Gpx7 | Back alignment and domain information |
|---|
| >TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit | Back alignment and domain information |
|---|
| >cd03072 PDI_b'_ERp44 PDIb' family, ERp44 subfamily, second redox inactive TRX-like domain b'; ERp44 is an endoplasmic reticulum (ER)-resident protein, induced during stress, involved in thiol-mediated ER retention | Back alignment and domain information |
|---|
| >PF07912 ERp29_N: ERp29, N-terminal domain; InterPro: IPR012883 ERp29 (P52555 from SWISSPROT) is a ubiquitously expressed endoplasmic reticulum protein, and is involved in the processes of protein maturation and protein secretion in this organelle [, ] | Back alignment and domain information |
|---|
| >COG2143 Thioredoxin-related protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02739 TraF type-F conjugative transfer system pilin assembly protein TraF | Back alignment and domain information |
|---|
| >PF13098 Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_A 2L57_A 1EEJ_B 1TJD_A 1JZD_B 1JZO_A 1G0T_B 3GV1_A 1V58_A 2H0H_A | Back alignment and domain information |
|---|
| >KOG2603 consensus Oligosaccharyltransferase, gamma subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK13703 conjugal pilus assembly protein TraF; Provisional | Back alignment and domain information |
|---|
| >cd02981 PDI_b_family Protein Disulfide Isomerase (PDIb) family, redox inactive TRX-like domain b; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants | Back alignment and domain information |
|---|
| >PRK14018 trifunctional thioredoxin/methionine sulfoxide reductase A/B protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01626 ytfJ_HI0045 conserved hypothetical protein YtfJ-family, TIGR01626 | Back alignment and domain information |
|---|
| >TIGR02740 TraF-like TraF-like protein | Back alignment and domain information |
|---|
| >PRK11200 grxA glutaredoxin 1; Provisional | Back alignment and domain information |
|---|
| >KOG0911 consensus Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd00340 GSH_Peroxidase Glutathione (GSH) peroxidase family; tetrameric selenoenzymes that catalyze the reduction of a variety of hydroperoxides including lipid peroxidases, using GSH as a specific electron donor substrate | Back alignment and domain information |
|---|
| >cd02991 UAS_ETEA UAS family, ETEA subfamily; composed of proteins similar to human ETEA protein, the translation product of a highly expressed gene in the T-cells and eosinophils of atopic dermatitis patients compared with those of normal individuals | Back alignment and domain information |
|---|
| >PRK03147 thiol-disulfide oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >cd03067 PDI_b_PDIR_N PDIb family, PDIR subfamily, N-terminal TRX-like b domain; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related) | Back alignment and domain information |
|---|
| >cd02973 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)-like family; composed of archaeal and bacterial proteins that show similarity to both TRX and GRX, including the C-terminal TRX-fold subdomain of Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO) | Back alignment and domain information |
|---|
| >TIGR02180 GRX_euk Glutaredoxin | Back alignment and domain information |
|---|
| >TIGR02738 TrbB type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB | Back alignment and domain information |
|---|
| >cd03074 PDI_b'_Calsequestrin_C Protein Disulfide Isomerase (PDIb') family, Calsequestrin subfamily, C-terminal TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle | Back alignment and domain information |
|---|
| >PRK15317 alkyl hydroperoxide reductase subunit F; Provisional | Back alignment and domain information |
|---|
| >cd03073 PDI_b'_ERp72_ERp57 PDIb' family, ERp72 and ERp57 subfamily, second redox inactive TRX-like domain b'; ERp72 and ER57 are involved in oxidative protein folding in the ER, like PDI | Back alignment and domain information |
|---|
| >PF06110 DUF953: Eukaryotic protein of unknown function (DUF953); InterPro: IPR010357 This family consists of several hypothetical eukaryotic proteins of unknown function that are thioredoxin-like | Back alignment and domain information |
|---|
| >cd02959 ERp19 Endoplasmic reticulum protein 19 (ERp19) family; ERp19 is also known as ERp18, a protein located in the ER containing one redox active TRX domain | Back alignment and domain information |
|---|
| >cd02958 UAS UAS family; UAS is a domain of unknown function | Back alignment and domain information |
|---|
| >KOG3170 consensus Conserved phosducin-like protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR00412 redox_disulf_2 small redox-active disulfide protein 2 | Back alignment and domain information |
|---|
| >PF14595 Thioredoxin_9: Thioredoxin; PDB: 1Z6N_A | Back alignment and domain information |
|---|
| >PRK00293 dipZ thiol:disulfide interchange protein precursor; Provisional | Back alignment and domain information |
|---|
| >TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit | Back alignment and domain information |
|---|
| >cd03017 PRX_BCP Peroxiredoxin (PRX) family, Bacterioferritin comigratory protein (BCP) subfamily; composed of thioredoxin-dependent thiol peroxidases, widely expressed in pathogenic bacteria, that protect cells against toxicity from reactive oxygen species by reducing and detoxifying hydroperoxides | Back alignment and domain information |
|---|
| >cd02966 TlpA_like_family TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins | Back alignment and domain information |
|---|
| >smart00594 UAS UAS domain | Back alignment and domain information |
|---|
| >PF13905 Thioredoxin_8: Thioredoxin-like; PDB: 1FG4_A 1I5G_A 1OC8_B 1O6J_A 1OC9_B 1O81_A 3FKF_A 1O85_A 1O7U_A 1O8W_A | Back alignment and domain information |
|---|
| >cd02955 SSP411 TRX domain, SSP411 protein family; members of this family are highly conserved proteins present in eukaryotes, bacteria and archaea, about 600-800 amino acids in length, which contain a TRX domain with a redox active CXXC motif | Back alignment and domain information |
|---|
| >KOG1672 consensus ATP binding protein [Posttranslational modification, protein turnover, chaperones; Energy production and conversion] | Back alignment and domain information |
|---|
| >PHA02125 thioredoxin-like protein | Back alignment and domain information |
|---|
| >cd03015 PRX_Typ2cys Peroxiredoxin (PRX) family, Typical 2-Cys PRX subfamily; PRXs are thiol-specific antioxidant (TSA) proteins, which confer a protective role in cells through its peroxidase activity by reducing hydrogen peroxide, peroxynitrite, and organic hydroperoxides | Back alignment and domain information |
|---|
| >TIGR00385 dsbE periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily | Back alignment and domain information |
|---|
| >PF02114 Phosducin: Phosducin; InterPro: IPR024253 The outer and inner segments of vertebrate rod photoreceptor cells contain phosducin, a soluble phosphoprotein that complexes with the beta/gamma-subunits of the GTP-binding protein, transducin | Back alignment and domain information |
|---|
| >KOG0914 consensus Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF03190 Thioredox_DsbH: Protein of unknown function, DUF255; InterPro: IPR004879 This is a group of uncharacterised proteins | Back alignment and domain information |
|---|
| >PF00578 AhpC-TSA: AhpC/TSA family; InterPro: IPR000866 Peroxiredoxins (Prxs) are a ubiquitous family of antioxidant enzymes that also control cytokine-induced peroxide levels which mediate signal transduction in mammalian cells | Back alignment and domain information |
|---|
| >cd03010 TlpA_like_DsbE TlpA-like family, DsbE (also known as CcmG and CycY) subfamily; DsbE is a membrane-anchored, periplasmic TRX-like reductase containing a CXXC motif that specifically donates reducing equivalents to apocytochrome c via CcmH, another cytochrome c maturation (Ccm) factor with a redox active CXXC motif | Back alignment and domain information |
|---|
| >KOG3425 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >cd02968 SCO SCO (an acronym for Synthesis of Cytochrome c Oxidase) family; composed of proteins similar to Sco1, a membrane-anchored protein possessing a soluble domain with a TRX fold | Back alignment and domain information |
|---|
| >cd02976 NrdH NrdH-redoxin (NrdH) family; NrdH is a small monomeric protein with a conserved redox active CXXC motif within a TRX fold, characterized by a glutaredoxin (GRX)-like sequence and TRX-like activity profile | Back alignment and domain information |
|---|
| >cd03011 TlpA_like_ScsD_MtbDsbE TlpA-like family, suppressor for copper sensitivity D protein (ScsD) and actinobacterial DsbE homolog subfamily; composed of ScsD, the DsbE homolog of Mycobacterium tuberculosis (MtbDsbE) and similar proteins, all containing a redox-active CXXC motif | Back alignment and domain information |
|---|
| >cd03026 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxide reductase F subunit (AhpF) N-terminal domain (NTD) subfamily, C-terminal TRX-fold subdomain; AhpF is a homodimeric flavoenzyme which catalyzes the NADH-dependent reduction of the peroxiredoxin AhpC, which then reduces hydrogen peroxide and organic hydroperoxides | Back alignment and domain information |
|---|
| >KOG2501 consensus Thioredoxin, nucleoredoxin and related proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PF11009 DUF2847: Protein of unknown function (DUF2847); InterPro: IPR022551 Members of this protein family, including YtxJ from Bacillus subtilis, occur in species that encode proteins for synthesizing bacillithiol | Back alignment and domain information |
|---|
| >cd02970 PRX_like2 Peroxiredoxin (PRX)-like 2 family; hypothetical proteins that show sequence similarity to PRXs | Back alignment and domain information |
|---|
| >PF00462 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors | Back alignment and domain information |
|---|
| >KOG0911 consensus Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10606 btuE putative glutathione peroxidase; Provisional | Back alignment and domain information |
|---|
| >cd03018 PRX_AhpE_like Peroxiredoxin (PRX) family, AhpE-like subfamily; composed of proteins similar to Mycobacterium tuberculosis AhpE | Back alignment and domain information |
|---|
| >cd03071 PDI_b'_NRX PDIb' family, NRX subgroup, redox inactive TRX-like domain b'; composed of vertebrate nucleoredoxins (NRX) | Back alignment and domain information |
|---|
| >TIGR02183 GRXA Glutaredoxin, GrxA family | Back alignment and domain information |
|---|
| >PRK15412 thiol:disulfide interchange protein DsbE; Provisional | Back alignment and domain information |
|---|
| >cd02967 mauD Methylamine utilization (mau) D family; mauD protein is the translation product of the mauD gene found in methylotrophic bacteria, which are able to use methylamine as a sole carbon source and a nitrogen source | Back alignment and domain information |
|---|
| >cd03009 TryX_like_TryX_NRX Tryparedoxin (TryX)-like family, TryX and nucleoredoxin (NRX) subfamily; TryX and NRX are thioredoxin (TRX)-like protein disulfide oxidoreductases that alter the redox state of target proteins via the reversible oxidation of an active center CXXC motif | Back alignment and domain information |
|---|
| >TIGR02190 GlrX-dom Glutaredoxin-family domain | Back alignment and domain information |
|---|
| >PRK10329 glutaredoxin-like protein; Provisional | Back alignment and domain information |
|---|
| >cd03419 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX human class 1 and 2 (h_1_2)-like subfamily; composed of proteins similar to human GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain | Back alignment and domain information |
|---|
| >PRK13728 conjugal transfer protein TrbB; Provisional | Back alignment and domain information |
|---|
| >cd02066 GRX_family Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain | Back alignment and domain information |
|---|
| >PLN02919 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >cd03014 PRX_Atyp2cys Peroxiredoxin (PRX) family, Atypical 2-cys PRX subfamily; composed of PRXs containing peroxidatic and resolving cysteines, similar to the homodimeric thiol specific antioxidant (TSA) protein also known as TRX-dependent thiol peroxidase (Tpx) | Back alignment and domain information |
|---|
| >cd02964 TryX_like_family Tryparedoxin (TryX)-like family; composed of TryX and related proteins including nucleoredoxin (NRX), rod-derived cone viability factor (RdCVF) and the nematode homolog described as a 16-kD class of TRX | Back alignment and domain information |
|---|
| >cd03069 PDI_b_ERp57 PDIb family, ERp57 subfamily, first redox inactive TRX-like domain b; ERp57 (or ERp60) exhibits both disulfide oxidase and reductase functions like PDI, by catalyzing the formation of disulfide bonds of newly synthesized polypeptides in the ER and acting as isomerases to correct any non-native disulfide bonds | Back alignment and domain information |
|---|
| >PF13728 TraF: F plasmid transfer operon protein | Back alignment and domain information |
|---|
| >PRK09437 bcp thioredoxin-dependent thiol peroxidase; Reviewed | Back alignment and domain information |
|---|
| >cd02971 PRX_family Peroxiredoxin (PRX) family; composed of the different classes of PRXs including many proteins originally known as bacterioferritin comigratory proteins (BCP), based on their electrophoretic mobility before their function was identified | Back alignment and domain information |
|---|
| >KOG1672 consensus ATP binding protein [Posttranslational modification, protein turnover, chaperones; Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR03137 AhpC peroxiredoxin | Back alignment and domain information |
|---|
| >PRK10877 protein disulfide isomerase II DsbC; Provisional | Back alignment and domain information |
|---|
| >KOG3414 consensus Component of the U4/U6 | Back alignment and domain information |
|---|
| >PRK00522 tpx lipid hydroperoxide peroxidase; Provisional | Back alignment and domain information |
|---|
| >cd03066 PDI_b_Calsequestrin_middle PDIb family, Calsequestrin subfamily, Middle TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle | Back alignment and domain information |
|---|
| >TIGR02189 GlrX-like_plant Glutaredoxin-like family | Back alignment and domain information |
|---|
| >PHA03050 glutaredoxin; Provisional | Back alignment and domain information |
|---|
| >cd03027 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Egl-10, and Pleckstrin (DEP) subfamily; composed of uncharacterized proteins containing a GRX domain and additional domains DEP and DUF547, both of which have unknown functions | Back alignment and domain information |
|---|
| >cd03029 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hybrid subfamily; composed of hybrid proteins containing peroxiredoxin (PRX) and GRX domains, which is found in some pathogenic bacteria and cyanobacteria | Back alignment and domain information |
|---|
| >TIGR00365 monothiol glutaredoxin, Grx4 family | Back alignment and domain information |
|---|
| >PF05768 DUF836: Glutaredoxin-like domain (DUF836); InterPro: IPR008554 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors | Back alignment and domain information |
|---|
| >KOG0913 consensus Thiol-disulfide isomerase and thioredoxin [Posttranslational modification, protein turnover, chaperones; Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR02181 GRX_bact Glutaredoxin, GrxC family | Back alignment and domain information |
|---|
| >TIGR02194 GlrX_NrdH Glutaredoxin-like protein NrdH | Back alignment and domain information |
|---|
| >KOG2603 consensus Oligosaccharyltransferase, gamma subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03028 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-interacting cousin of TRX (PICOT)-like subfamily; composed of PICOT and GRX-PICOT-like proteins | Back alignment and domain information |
|---|
| >TIGR02739 TraF type-F conjugative transfer system pilin assembly protein TraF | Back alignment and domain information |
|---|
| >cd03418 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX bacterial class 1 and 3 (b_1_3)-like subfamily; composed of bacterial GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain | Back alignment and domain information |
|---|
| >cd02991 UAS_ETEA UAS family, ETEA subfamily; composed of proteins similar to human ETEA protein, the translation product of a highly expressed gene in the T-cells and eosinophils of atopic dermatitis patients compared with those of normal individuals | Back alignment and domain information |
|---|
| >cd02969 PRX_like1 Peroxiredoxin (PRX)-like 1 family; hypothetical proteins that show sequence similarity to PRXs | Back alignment and domain information |
|---|
| >cd03008 TryX_like_RdCVF Tryparedoxin (TryX)-like family, Rod-derived cone viability factor (RdCVF) subfamily; RdCVF is a thioredoxin (TRX)-like protein specifically expressed in photoreceptors | Back alignment and domain information |
|---|
| >PTZ00056 glutathione peroxidase; Provisional | Back alignment and domain information |
|---|
| >PRK13703 conjugal pilus assembly protein TraF; Provisional | Back alignment and domain information |
|---|
| >PRK13190 putative peroxiredoxin; Provisional | Back alignment and domain information |
|---|
| >PRK10824 glutaredoxin-4; Provisional | Back alignment and domain information |
|---|
| >PF07449 HyaE: Hydrogenase-1 expression protein HyaE; InterPro: IPR010893 This family contains bacterial hydrogenase-1 expression proteins approximately 120 residues long | Back alignment and domain information |
|---|
| >cd03012 TlpA_like_DipZ_like TlpA-like family, DipZ-like subfamily; composed uncharacterized proteins containing a TlpA-like TRX domain | Back alignment and domain information |
|---|
| >KOG3171 consensus Conserved phosducin-like protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR02661 MauD methylamine dehydrogenase accessory protein MauD | Back alignment and domain information |
|---|
| >PLN02399 phospholipid hydroperoxide glutathione peroxidase | Back alignment and domain information |
|---|
| >COG0695 GrxC Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10638 glutaredoxin 3; Provisional | Back alignment and domain information |
|---|
| >PRK10382 alkyl hydroperoxide reductase subunit C; Provisional | Back alignment and domain information |
|---|
| >PF13192 Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZYN_A 1HYU_A 1ILO_A 1J08_F 2YWM_B 2AYT_B 2HLS_B 1A8L_A 2K8S_B | Back alignment and domain information |
|---|
| >cd03023 DsbA_Com1_like DsbA family, Com1-like subfamily; composed of proteins similar to Com1, a 27-kDa outer membrane-associated immunoreactive protein originally found in both acute and chronic disease strains of the pathogenic bacteria Coxiella burnetti | Back alignment and domain information |
|---|
| >cd03068 PDI_b_ERp72 PDIb family, ERp72 subfamily, first redox inactive TRX-like domain b; ERp72 exhibits both disulfide oxidase and reductase functions like PDI, by catalyzing the formation of disulfide bonds of newly synthesized polypeptides in the ER and acting as isomerases to correct any non-native disulfide bonds | Back alignment and domain information |
|---|
| >cd01659 TRX_superfamily Thioredoxin (TRX) superfamily; a large, diverse group of proteins containing a TRX-fold | Back alignment and domain information |
|---|
| >PF13899 Thioredoxin_7: Thioredoxin-like; PDB: 2LST_A 3PH9_A 1UC7_A 2JU5_A 1VRS_D 2FWG_A 2FWF_A 2FWH_A 2FWE_A 3FK8_A | Back alignment and domain information |
|---|
| >PF11009 DUF2847: Protein of unknown function (DUF2847); InterPro: IPR022551 Members of this protein family, including YtxJ from Bacillus subtilis, occur in species that encode proteins for synthesizing bacillithiol | Back alignment and domain information |
|---|
| >PRK15000 peroxidase; Provisional | Back alignment and domain information |
|---|
| >PRK11657 dsbG disulfide isomerase/thiol-disulfide oxidase; Provisional | Back alignment and domain information |
|---|
| >cd02960 AGR Anterior Gradient (AGR) family; members of this family are similar to secreted proteins encoded by the cement gland-specific genes XAG-1 and XAG-2, expressed in the anterior region of dorsal ectoderm of Xenopus | Back alignment and domain information |
|---|
| >COG0526 TrxA Thiol-disulfide isomerase and thioredoxins [Posttranslational modification, protein turnover, chaperones / Energy production and conversion] | Back alignment and domain information |
|---|
| >PF13462 Thioredoxin_4: Thioredoxin; PDB: 3FEU_A 3HZ8_A 3DVW_A 3A3T_E 3GMF_A 1Z6M_A 3GYK_C 3BCK_A 3BD2_A 3BCI_A | Back alignment and domain information |
|---|
| >PF02966 DIM1: Mitosis protein DIM1; InterPro: IPR004123 Thioredoxins [, , , ] are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms | Back alignment and domain information |
|---|
| >PLN02412 probable glutathione peroxidase | Back alignment and domain information |
|---|
| >TIGR02540 gpx7 putative glutathione peroxidase Gpx7 | Back alignment and domain information |
|---|
| >PF08534 Redoxin: Redoxin; InterPro: IPR013740 This redoxin domain is found in peroxiredoxin, thioredoxin and glutaredoxin proteins | Back alignment and domain information |
|---|
| >COG4232 Thiol:disulfide interchange protein [Posttranslational modification, protein turnover, chaperones / Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG1752 consensus Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG2143 Thioredoxin-related protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03016 PRX_1cys Peroxiredoxin (PRX) family, 1-cys PRX subfamily; composed of PRXs containing only one conserved cysteine, which serves as the peroxidatic cysteine | Back alignment and domain information |
|---|
| >cd03019 DsbA_DsbA DsbA family, DsbA subfamily; DsbA is a monomeric thiol disulfide oxidoreductase protein containing a redox active CXXC motif imbedded in a TRX fold | Back alignment and domain information |
|---|
| >cd03074 PDI_b'_Calsequestrin_C Protein Disulfide Isomerase (PDIb') family, Calsequestrin subfamily, C-terminal TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle | Back alignment and domain information |
|---|
| >cd02974 AhpF_NTD_N Alkyl hydroperoxide reductase F subunit (AhpF) N-terminal domain (NTD) family, N-terminal TRX-fold subdomain; AhpF is a homodimeric flavoenzyme which catalyzes the NADH-dependent reduction of the peroxiredoxin AhpC, which in turn catalyzes the reduction of hydrogen peroxide and organic hydroperoxides | Back alignment and domain information |
|---|
| >PTZ00137 2-Cys peroxiredoxin; Provisional | Back alignment and domain information |
|---|
| >PTZ00253 tryparedoxin peroxidase; Provisional | Back alignment and domain information |
|---|
| >PRK13599 putative peroxiredoxin; Provisional | Back alignment and domain information |
|---|
| >TIGR02196 GlrX_YruB Glutaredoxin-like protein, YruB-family | Back alignment and domain information |
|---|
| >cd02972 DsbA_family DsbA family; consists of DsbA and DsbA-like proteins, including DsbC, DsbG, glutathione (GSH) S-transferase kappa (GSTK), 2-hydroxychromene-2-carboxylate (HCCA) isomerase, an oxidoreductase (FrnE) presumed to be involved in frenolicin biosynthesis, a 27-kDa outer membrane protein, and similar proteins | Back alignment and domain information |
|---|
| >KOG3414 consensus Component of the U4/U6 | Back alignment and domain information |
|---|
| >PRK12759 bifunctional gluaredoxin/ribonucleoside-diphosphate reductase subunit beta; Provisional | Back alignment and domain information |
|---|
| >PRK13191 putative peroxiredoxin; Provisional | Back alignment and domain information |
|---|
| >KOG3170 consensus Conserved phosducin-like protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK13189 peroxiredoxin; Provisional | Back alignment and domain information |
|---|
| >KOG3171 consensus Conserved phosducin-like protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR02180 GRX_euk Glutaredoxin | Back alignment and domain information |
|---|
| >cd03014 PRX_Atyp2cys Peroxiredoxin (PRX) family, Atypical 2-cys PRX subfamily; composed of PRXs containing peroxidatic and resolving cysteines, similar to the homodimeric thiol specific antioxidant (TSA) protein also known as TRX-dependent thiol peroxidase (Tpx) | Back alignment and domain information |
|---|
| >KOG2640 consensus Thioredoxin [Function unknown] | Back alignment and domain information |
|---|
| >PF00578 AhpC-TSA: AhpC/TSA family; InterPro: IPR000866 Peroxiredoxins (Prxs) are a ubiquitous family of antioxidant enzymes that also control cytokine-induced peroxide levels which mediate signal transduction in mammalian cells | Back alignment and domain information |
|---|
| >PTZ00256 glutathione peroxidase; Provisional | Back alignment and domain information |
|---|
| >PF07449 HyaE: Hydrogenase-1 expression protein HyaE; InterPro: IPR010893 This family contains bacterial hydrogenase-1 expression proteins approximately 120 residues long | Back alignment and domain information |
|---|
| >cd03020 DsbA_DsbC_DsbG DsbA family, DsbC and DsbG subfamily; V-shaped homodimeric proteins containing a redox active CXXC motif imbedded in a TRX fold | Back alignment and domain information |
|---|
| >PRK10954 periplasmic protein disulfide isomerase I; Provisional | Back alignment and domain information |
|---|
| >cd03017 PRX_BCP Peroxiredoxin (PRX) family, Bacterioferritin comigratory protein (BCP) subfamily; composed of thioredoxin-dependent thiol peroxidases, widely expressed in pathogenic bacteria, that protect cells against toxicity from reactive oxygen species by reducing and detoxifying hydroperoxides | Back alignment and domain information |
|---|
| >TIGR01626 ytfJ_HI0045 conserved hypothetical protein YtfJ-family, TIGR01626 | Back alignment and domain information |
|---|
| >PRK00522 tpx lipid hydroperoxide peroxidase; Provisional | Back alignment and domain information |
|---|
| >KOG2501 consensus Thioredoxin, nucleoredoxin and related proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PF02966 DIM1: Mitosis protein DIM1; InterPro: IPR004123 Thioredoxins [, , , ] are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms | Back alignment and domain information |
|---|
| >cd03015 PRX_Typ2cys Peroxiredoxin (PRX) family, Typical 2-Cys PRX subfamily; PRXs are thiol-specific antioxidant (TSA) proteins, which confer a protective role in cells through its peroxidase activity by reducing hydrogen peroxide, peroxynitrite, and organic hydroperoxides | Back alignment and domain information |
|---|
| >cd02977 ArsC_family Arsenate Reductase (ArsC) family; composed of TRX-fold arsenic reductases and similar proteins including the transcriptional regulator, Spx | Back alignment and domain information |
|---|
| >cd00340 GSH_Peroxidase Glutathione (GSH) peroxidase family; tetrameric selenoenzymes that catalyze the reduction of a variety of hydroperoxides including lipid peroxidases, using GSH as a specific electron donor substrate | Back alignment and domain information |
|---|
| >PF03190 Thioredox_DsbH: Protein of unknown function, DUF255; InterPro: IPR004879 This is a group of uncharacterised proteins | Back alignment and domain information |
|---|
| >PF05768 DUF836: Glutaredoxin-like domain (DUF836); InterPro: IPR008554 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors | Back alignment and domain information |
|---|
| >cd03031 GRX_GRX_like Glutaredoxin (GRX) family, GRX-like domain containing protein subfamily; composed of uncharacterized eukaryotic proteins containing a GRX-like domain having only one conserved cysteine, aligning to the C-terminal cysteine of the CXXC motif of GRXs | Back alignment and domain information |
|---|
| >KOG3425 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG0278 Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03035 ArsC_Yffb Arsenate Reductase (ArsC) family, Yffb subfamily; Yffb is an uncharacterized bacterial protein encoded by the yffb gene, related to the thioredoxin-fold arsenic reductases, ArsC | Back alignment and domain information |
|---|
| >TIGR02200 GlrX_actino Glutaredoxin-like protein | Back alignment and domain information |
|---|
| >PRK01655 spxA transcriptional regulator Spx; Reviewed | Back alignment and domain information |
|---|
| >PRK10382 alkyl hydroperoxide reductase subunit C; Provisional | Back alignment and domain information |
|---|
| >cd02970 PRX_like2 Peroxiredoxin (PRX)-like 2 family; hypothetical proteins that show sequence similarity to PRXs | Back alignment and domain information |
|---|
| >cd03036 ArsC_like Arsenate Reductase (ArsC) family, unknown subfamily; uncharacterized proteins containing a CXXC motif with similarity to thioredoxin (TRX)-fold arsenic reductases, ArsC | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 360 | ||||
| 3uem_A | 361 | Crystal Structure Of Human Pdi Bb'a' Domains Length | 1e-36 | ||
| 3f8u_A | 481 | TapasinERP57 HETERODIMER Length = 481 | 5e-25 | ||
| 3f8u_A | 481 | TapasinERP57 HETERODIMER Length = 481 | 4e-04 | ||
| 2dmm_A | 142 | The Solution Structure Of The Second Thioredoxin Do | 3e-21 | ||
| 2dj3_A | 133 | The Solution Structure Of The Third Thioredoxin Dom | 3e-21 | ||
| 2djj_A | 121 | Solution Structure Of The A' Domain Of Thermophilic | 1e-17 | ||
| 2b5e_A | 504 | Crystal Structure Of Yeast Protein Disulfide Isomer | 2e-17 | ||
| 2b5e_A | 504 | Crystal Structure Of Yeast Protein Disulfide Isomer | 8e-04 | ||
| 1x5c_A | 121 | The Solution Structure Of The Second Thioredoxin-Li | 4e-15 | ||
| 2k18_A | 228 | Solution Structure Of Bb' Domains Of Human Protein | 1e-13 | ||
| 3bj5_A | 147 | Alternative Conformations Of The X Region Of Human | 5e-10 | ||
| 1mek_A | 120 | Human Protein Disulfide Isomerase, Nmr, 40 Structur | 1e-07 | ||
| 2yj7_A | 106 | Crystal Structure Of A Hyperstable Protein From The | 5e-07 | ||
| 2diz_A | 117 | The Solution Structure Of The Third Thioredoxin Dom | 5e-07 | ||
| 3uj1_A | 110 | Crystal Structure Of The Third Thioredoxin Domain O | 1e-06 | ||
| 3uvt_A | 111 | Crystal Structure Of The Third Catalytic Domain Of | 1e-06 | ||
| 3ed3_A | 298 | Crystal Structure Of The Yeast DithiolDISULFIDE Oxi | 2e-06 | ||
| 1txx_A | 108 | Active-Site Variant Of E.Coli Thioredoxin Length = | 2e-06 | ||
| 2h72_A | 108 | Crystal Structure Of Thioredoxin Mutant E85d In Hex | 3e-06 | ||
| 2tir_A | 108 | Crystal Structure Analysis Of A Mutant Escherichia | 3e-06 | ||
| 2h73_A | 108 | Crystal Structure Of Thioredoxin Mutant D43e In Hex | 5e-06 | ||
| 2h71_A | 108 | Crystal Structure Of Thioredoxin Mutant D47e In Hex | 9e-06 | ||
| 3dxb_A | 222 | Structure Of The Uhm Domain Of Puf60 Fused To Thior | 9e-06 | ||
| 2fch_A | 108 | Crystal Structure Of Thioredoxin Mutant G74s Length | 1e-05 | ||
| 1zzy_A | 108 | Crystal Structure Of Thioredoxin Mutant L7v Length | 1e-05 | ||
| 1keb_A | 108 | Crystal Structure Of Double Mutant M37l,P40s E.Coli | 1e-05 | ||
| 2trx_A | 108 | Crystal Structure Of Thioredoxin From Escherichia C | 1e-05 | ||
| 2h76_A | 108 | Crystal Structure Of Thioredoxin Mutant D10e In Hex | 1e-05 | ||
| 1xob_A | 108 | Thioredoxin (Reduced Dithio Form), Nmr, 20 Structur | 1e-05 | ||
| 2h70_A | 108 | Crystal Structure Of Thioredoxin Mutant D9e In Hexa | 1e-05 | ||
| 2h74_A | 108 | Crystal Structure Of Thioredoxin Mutant D2e In Hexa | 1e-05 | ||
| 3dyr_A | 111 | Crystal Structure Of E. Coli Thioredoxin Mutant I76 | 1e-05 | ||
| 2h6y_A | 108 | Crystal Structure Of Thioredoxin Mutant E48d In Hex | 1e-05 | ||
| 2fd3_A | 108 | Crystal Structure Of Thioredoxin Mutant P34h Length | 2e-05 | ||
| 2dj1_A | 140 | The Solution Structure Of The First Thioredoxin Dom | 2e-05 | ||
| 2h6z_A | 108 | Crystal Structure Of Thioredoxin Mutant E44d In Hex | 2e-05 | ||
| 2eiq_A | 108 | Design Of Disulfide-linked Thioredoxin Dimers And M | 2e-05 | ||
| 3idv_A | 241 | Crystal Structure Of The A0a Fragment Of Erp72 Leng | 3e-05 | ||
| 1fb0_A | 105 | Crystal Structure Of Thioredoxin M From Spinach Chl | 4e-05 | ||
| 2eio_A | 108 | Design Of Disulfide-Linked Thioredoxin Dimers And M | 4e-05 | ||
| 2h75_A | 108 | Crystal Structure Of Thioredoxin Mutant D13e In Hex | 5e-05 | ||
| 2eir_A | 108 | Design Of Disulfide-Linked Thioredoxin Dimers And M | 5e-05 | ||
| 2dj2_A | 120 | The Solution Structure Of The Second Thioredoxin Do | 6e-05 | ||
| 1zcp_A | 108 | Crystal Structure Of A Catalytic Site Mutant E. Col | 8e-05 | ||
| 1gl8_A | 104 | Solution Structure Of Thioredoxin M From Spinach, O | 9e-05 | ||
| 2cvk_A | 110 | Crystal Structure Of Thermus Thermophilus Thioredox | 9e-05 | ||
| 2yzu_A | 109 | Crystal Structure Of Oxidized Thioredoxin From Ther | 9e-05 | ||
| 2alb_A | 113 | Nmr Structure Of The N-Terminal Domain A Of The Gly | 1e-04 | ||
| 2o8v_B | 128 | Paps Reductase In A Covalent Complex With Thioredox | 2e-04 | ||
| 1f6m_C | 108 | Crystal Structure Of A Complex Between Thioredoxin | 2e-04 | ||
| 1tho_A | 109 | Crystal Structure Of A Mutant Escherichia Coli Thio | 2e-04 | ||
| 3aps_A | 122 | Crystal Structure Of Trx4 Domain Of Erdj5 Length = | 5e-04 | ||
| 2puk_C | 106 | Crystal Srtucture Of The Binary Complex Between Fer | 5e-04 | ||
| 1srx_A | 108 | Three-Dimensional Structure Of Escherichia Coli Thi | 7e-04 | ||
| 3h79_A | 127 | Crystal Structure Of Trypanosoma Cruzi Thioredoxin- | 8e-04 |
| >pdb|3UEM|A Chain A, Crystal Structure Of Human Pdi Bb'a' Domains Length = 361 | Back alignment and structure |
|
| >pdb|3F8U|A Chain A, TapasinERP57 HETERODIMER Length = 481 | Back alignment and structure |
| >pdb|3F8U|A Chain A, TapasinERP57 HETERODIMER Length = 481 | Back alignment and structure |
| >pdb|2DMM|A Chain A, The Solution Structure Of The Second Thioredoxin Domain Of Human Protein Disulfide-Isomerase A3 Length = 142 | Back alignment and structure |
| >pdb|2DJ3|A Chain A, The Solution Structure Of The Third Thioredoxin Domain Of Mouse Protein Disulfide-Isomerase A4 Length = 133 | Back alignment and structure |
| >pdb|2DJJ|A Chain A, Solution Structure Of The A' Domain Of Thermophilic Fungal Protein Disulfide Isomerase Length = 121 | Back alignment and structure |
| >pdb|2B5E|A Chain A, Crystal Structure Of Yeast Protein Disulfide Isomerase Length = 504 | Back alignment and structure |
| >pdb|2B5E|A Chain A, Crystal Structure Of Yeast Protein Disulfide Isomerase Length = 504 | Back alignment and structure |
| >pdb|1X5C|A Chain A, The Solution Structure Of The Second Thioredoxin-Like Domain Of Human Protein Disulfide-Isomerase Length = 121 | Back alignment and structure |
| >pdb|2K18|A Chain A, Solution Structure Of Bb' Domains Of Human Protein Disulfide Isomerase Length = 228 | Back alignment and structure |
| >pdb|3BJ5|A Chain A, Alternative Conformations Of The X Region Of Human Protein Disulphide- Isomerase Modulate Exposure Of The Substrate Binding B' Domain Length = 147 | Back alignment and structure |
| >pdb|1MEK|A Chain A, Human Protein Disulfide Isomerase, Nmr, 40 Structures Length = 120 | Back alignment and structure |
| >pdb|2YJ7|A Chain A, Crystal Structure Of A Hyperstable Protein From The Precambrian Period Length = 106 | Back alignment and structure |
| >pdb|2DIZ|A Chain A, The Solution Structure Of The Third Thioredoxin Domain Of Human Thioredoxin Domain-Containing Protein 5 Length = 117 | Back alignment and structure |
| >pdb|3UJ1|A Chain A, Crystal Structure Of The Third Thioredoxin Domain Of Human Erp46 Length = 110 | Back alignment and structure |
| >pdb|3UVT|A Chain A, Crystal Structure Of The Third Catalytic Domain Of Erp46 Length = 111 | Back alignment and structure |
| >pdb|3ED3|A Chain A, Crystal Structure Of The Yeast DithiolDISULFIDE Oxidoreductase Mpd1p Length = 298 | Back alignment and structure |
| >pdb|1TXX|A Chain A, Active-Site Variant Of E.Coli Thioredoxin Length = 108 | Back alignment and structure |
| >pdb|2H72|A Chain A, Crystal Structure Of Thioredoxin Mutant E85d In Hexagonal (P61) Space Group Length = 108 | Back alignment and structure |
| >pdb|2TIR|A Chain A, Crystal Structure Analysis Of A Mutant Escherichia Coli Thioredoxin In Which Lysine 36 Is Replaced By Glutamic Acid Length = 108 | Back alignment and structure |
| >pdb|2H73|A Chain A, Crystal Structure Of Thioredoxin Mutant D43e In Hexagonal (P61) Space Group Length = 108 | Back alignment and structure |
| >pdb|2H71|A Chain A, Crystal Structure Of Thioredoxin Mutant D47e In Hexagonal (P61) Space Group Length = 108 | Back alignment and structure |
| >pdb|3DXB|A Chain A, Structure Of The Uhm Domain Of Puf60 Fused To Thioredoxin Length = 222 | Back alignment and structure |
| >pdb|2FCH|A Chain A, Crystal Structure Of Thioredoxin Mutant G74s Length = 108 | Back alignment and structure |
| >pdb|1ZZY|A Chain A, Crystal Structure Of Thioredoxin Mutant L7v Length = 108 | Back alignment and structure |
| >pdb|1KEB|A Chain A, Crystal Structure Of Double Mutant M37l,P40s E.Coli Thioredoxin Length = 108 | Back alignment and structure |
| >pdb|2TRX|A Chain A, Crystal Structure Of Thioredoxin From Escherichia Coli At 1.68 Angstroms Resolution Length = 108 | Back alignment and structure |
| >pdb|2H76|A Chain A, Crystal Structure Of Thioredoxin Mutant D10e In Hexagonal (P61) Space Group Length = 108 | Back alignment and structure |
| >pdb|1XOB|A Chain A, Thioredoxin (Reduced Dithio Form), Nmr, 20 Structures Length = 108 | Back alignment and structure |
| >pdb|2H70|A Chain A, Crystal Structure Of Thioredoxin Mutant D9e In Hexagonal (P61) Space Group Length = 108 | Back alignment and structure |
| >pdb|2H74|A Chain A, Crystal Structure Of Thioredoxin Mutant D2e In Hexagonal (P61) Space Group Length = 108 | Back alignment and structure |
| >pdb|3DYR|A Chain A, Crystal Structure Of E. Coli Thioredoxin Mutant I76t In Its Oxidized Form Length = 111 | Back alignment and structure |
| >pdb|2H6Y|A Chain A, Crystal Structure Of Thioredoxin Mutant E48d In Hexagonal (P61) Space Group Length = 108 | Back alignment and structure |
| >pdb|2FD3|A Chain A, Crystal Structure Of Thioredoxin Mutant P34h Length = 108 | Back alignment and structure |
| >pdb|2DJ1|A Chain A, The Solution Structure Of The First Thioredoxin Domain Of Mouse Protein Disulfide-Isomerase A4 Length = 140 | Back alignment and structure |
| >pdb|2H6Z|A Chain A, Crystal Structure Of Thioredoxin Mutant E44d In Hexagonal (P61) Space Group Length = 108 | Back alignment and structure |
| >pdb|2EIQ|A Chain A, Design Of Disulfide-linked Thioredoxin Dimers And Multimers Through Analysis Of Crystal Contacts Length = 108 | Back alignment and structure |
| >pdb|3IDV|A Chain A, Crystal Structure Of The A0a Fragment Of Erp72 Length = 241 | Back alignment and structure |
| >pdb|1FB0|A Chain A, Crystal Structure Of Thioredoxin M From Spinach Chloroplast (Reduced Form) Length = 105 | Back alignment and structure |
| >pdb|2EIO|A Chain A, Design Of Disulfide-Linked Thioredoxin Dimers And Multimers Through Analysis Of Crystal Contacts Length = 108 | Back alignment and structure |
| >pdb|2H75|A Chain A, Crystal Structure Of Thioredoxin Mutant D13e In Hexagonal (P61) Space Group Length = 108 | Back alignment and structure |
| >pdb|2EIR|A Chain A, Design Of Disulfide-Linked Thioredoxin Dimers And Multimers Through Analysis Of Crystal Contacts Length = 108 | Back alignment and structure |
| >pdb|2DJ2|A Chain A, The Solution Structure Of The Second Thioredoxin Domain Of Mouse Protein Disulfide-Isomerase A4 Length = 120 | Back alignment and structure |
| >pdb|1ZCP|A Chain A, Crystal Structure Of A Catalytic Site Mutant E. Coli Trxa (Caca) Length = 108 | Back alignment and structure |
| >pdb|1GL8|A Chain A, Solution Structure Of Thioredoxin M From Spinach, Oxidized Form Length = 104 | Back alignment and structure |
| >pdb|2CVK|A Chain A, Crystal Structure Of Thermus Thermophilus Thioredoxin Length = 110 | Back alignment and structure |
| >pdb|2YZU|A Chain A, Crystal Structure Of Oxidized Thioredoxin From Thermus Thermophilus Hb8 Length = 109 | Back alignment and structure |
| >pdb|2ALB|A Chain A, Nmr Structure Of The N-Terminal Domain A Of The Glycoprotein Chaperone Erp57 Length = 113 | Back alignment and structure |
| >pdb|2O8V|B Chain B, Paps Reductase In A Covalent Complex With Thioredoxin C35a Length = 128 | Back alignment and structure |
| >pdb|1F6M|C Chain C, Crystal Structure Of A Complex Between Thioredoxin Reductase, Thioredoxin, And The Nadp+ Analog, Aadp+ Length = 108 | Back alignment and structure |
| >pdb|1THO|A Chain A, Crystal Structure Of A Mutant Escherichia Coli Thioredoxin With An Arginine Insertion In The Active Site Length = 109 | Back alignment and structure |
| >pdb|3APS|A Chain A, Crystal Structure Of Trx4 Domain Of Erdj5 Length = 122 | Back alignment and structure |
| >pdb|2PUK|C Chain C, Crystal Srtucture Of The Binary Complex Between Ferredoxin: Thioredoxin Reductase And Thioredoxin M Length = 106 | Back alignment and structure |
| >pdb|1SRX|A Chain A, Three-Dimensional Structure Of Escherichia Coli Thioredoxin-S2 To 2.8 Angstroms Resolution Length = 108 | Back alignment and structure |
| >pdb|3H79|A Chain A, Crystal Structure Of Trypanosoma Cruzi Thioredoxin-like Hypothetical Protein Q4dv70 Length = 127 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 360 | |||
| 3uem_A | 361 | Protein disulfide-isomerase; thioredoxin-like doma | 1e-70 | |
| 3f8u_A | 481 | Protein disulfide-isomerase A3ERP57; endoplasmic r | 6e-52 | |
| 3f8u_A | 481 | Protein disulfide-isomerase A3ERP57; endoplasmic r | 4e-12 | |
| 2b5e_A | 504 | Protein disulfide-isomerase; 2.40A {Saccharomyces | 2e-50 | |
| 2b5e_A | 504 | Protein disulfide-isomerase; 2.40A {Saccharomyces | 9e-19 | |
| 2dj3_A | 133 | Protein disulfide-isomerase A4; protein ERP-72, ER | 2e-36 | |
| 2djj_A | 121 | PDI, protein disulfide-isomerase; thioredoxin fold | 2e-36 | |
| 2h8l_A | 252 | Protein disulfide-isomerase A3; thioredoxin-like f | 9e-31 | |
| 3h79_A | 127 | Thioredoxin-like protein; thioredoxin fold, cataly | 8e-29 | |
| 3apo_A | 780 | DNAJ homolog subfamily C member 10; PDI family, th | 3e-28 | |
| 3apo_A | 780 | DNAJ homolog subfamily C member 10; PDI family, th | 9e-21 | |
| 3apo_A | 780 | DNAJ homolog subfamily C member 10; PDI family, th | 3e-08 | |
| 3apo_A | 780 | DNAJ homolog subfamily C member 10; PDI family, th | 5e-08 | |
| 2r2j_A | 382 | Thioredoxin domain-containing protein 4; CRFS moti | 3e-28 | |
| 2r2j_A | 382 | Thioredoxin domain-containing protein 4; CRFS moti | 1e-10 | |
| 3ec3_A | 250 | Protein disulfide-isomerase A4; thioredoxin-like f | 5e-27 | |
| 3us3_A | 367 | Calsequestrin-1; calcium-binding protein; 1.74A {O | 1e-25 | |
| 3us3_A | 367 | Calsequestrin-1; calcium-binding protein; 1.74A {O | 2e-07 | |
| 3us3_A | 367 | Calsequestrin-1; calcium-binding protein; 1.74A {O | 1e-04 | |
| 3bj5_A | 147 | Protein disulfide-isomerase; thioredoxin fold, cha | 9e-24 | |
| 2djk_A | 133 | PDI, protein disulfide-isomerase; thioredoxin fold | 1e-20 | |
| 1sji_A | 350 | Calsequestrin 2, calsequestrin, cardiac muscle iso | 2e-19 | |
| 1sji_A | 350 | Calsequestrin 2, calsequestrin, cardiac muscle iso | 1e-07 | |
| 1sji_A | 350 | Calsequestrin 2, calsequestrin, cardiac muscle iso | 9e-04 | |
| 1mek_A | 120 | Protein disulfide isomerase; electron transport, r | 2e-19 | |
| 1x5d_A | 133 | Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC | 3e-19 | |
| 3idv_A | 241 | Protein disulfide-isomerase A4; thioredoxin-like f | 6e-19 | |
| 3idv_A | 241 | Protein disulfide-isomerase A4; thioredoxin-like f | 5e-13 | |
| 3t58_A | 519 | Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2. | 9e-19 | |
| 2dj1_A | 140 | Protein disulfide-isomerase A4; protein ERP-72, ER | 1e-18 | |
| 3q6o_A | 244 | Sulfhydryl oxidase 1; protein disulfide isomerase, | 1e-18 | |
| 2dml_A | 130 | Protein disulfide-isomerase A6; thioredoxin domain | 6e-18 | |
| 3aps_A | 122 | DNAJ homolog subfamily C member 10; thioredoxin fo | 7e-18 | |
| 2qc7_A | 240 | ERP31, ERP28, endoplasmic reticulum protein ERP29; | 8e-18 | |
| 1x5e_A | 126 | Thioredoxin domain containing protein 1; TMX, TXND | 2e-15 | |
| 3uvt_A | 111 | Thioredoxin domain-containing protein 5; thioredox | 7e-15 | |
| 3ed3_A | 298 | Protein disulfide-isomerase MPD1; thioredoxin-like | 8e-14 | |
| 3qcp_A | 470 | QSOX from trypanosoma brucei (tbqsox); ERV fold, t | 2e-12 | |
| 2l57_A | 126 | Uncharacterized protein; structural genomics, unkn | 4e-10 | |
| 1w4v_A | 119 | Thioredoxin, mitochondrial; antioxidant enzyme, mi | 5e-10 | |
| 3hz4_A | 140 | Thioredoxin; NYSGXRC, PSI-II, reduced form, protei | 5e-10 | |
| 2j23_A | 121 | Thioredoxin; immune protein, autoreactivity, cross | 6e-10 | |
| 2l5l_A | 136 | Thioredoxin; structural genomics, electron transpo | 9e-10 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-09 | |
| 2ppt_A | 155 | Thioredoxin-2; thiredoxin, zinc finger, oxidoreduc | 2e-09 | |
| 3gnj_A | 111 | Thioredoxin domain protein; APC92103, STR genomics | 2e-09 | |
| 2kuc_A | 130 | Putative disulphide-isomerase; structural genomics | 3e-09 | |
| 1t00_A | 112 | Thioredoxin, TRX; redox regulation, multifunction | 5e-09 | |
| 2fwh_A | 134 | Thiol:disulfide interchange protein DSBD; thioredo | 6e-09 | |
| 2i1u_A | 121 | Thioredoxin, TRX, MPT46; redox protein, electron t | 7e-09 | |
| 1fb6_A | 105 | Thioredoxin M; electron transport; 2.10A {Spinacia | 9e-09 | |
| 2o8v_B | 128 | Thioredoxin 1; disulfide crosslinked complex, oxid | 1e-08 | |
| 1dby_A | 107 | Chloroplast thioredoxin M CH2; thioredoxin CH2, ch | 1e-08 | |
| 2yj7_A | 106 | LPBCA thioredoxin; oxidoreductase; 1.65A {Syntheti | 1e-08 | |
| 2trx_A | 108 | Thioredoxin; electron transport; 1.68A {Escherichi | 1e-08 | |
| 3tco_A | 109 | Thioredoxin (TRXA-1); disulfide oxidoreductase, ox | 2e-08 | |
| 3p2a_A | 148 | Thioredoxin 2, putative thioredoxin-like protein; | 2e-08 | |
| 1thx_A | 115 | Thioredoxin, thioredoxin 2; oxido-reductase, elect | 2e-08 | |
| 2i4a_A | 107 | Thioredoxin; acidophIle, disulfide exchange, oxido | 2e-08 | |
| 2yzu_A | 109 | Thioredoxin; redox protein, electron transport, st | 4e-08 | |
| 1nsw_A | 105 | Thioredoxin, TRX; thermostability, electron transp | 7e-08 | |
| 3ul3_B | 128 | Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; | 1e-07 | |
| 3hxs_A | 141 | Thioredoxin, TRXP; electron transport; 2.00A {Bact | 1e-07 | |
| 1v98_A | 140 | Thioredoxin; oxidoreductase, structural genomics, | 2e-07 | |
| 3dxb_A | 222 | Thioredoxin N-terminally fused to PUF60(UHM); spli | 2e-07 | |
| 4euy_A | 105 | Uncharacterized protein; structural genomics, PSI- | 3e-07 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 3e-07 | |
| 2e0q_A | 104 | Thioredoxin; electron transport; 1.49A {Sulfolobus | 5e-07 | |
| 2c0g_A | 248 | ERP29 homolog, windbeutel protein; PDI-dbeta, PDI, | 6e-07 | |
| 2lst_A | 130 | Thioredoxin; structural genomics, NEW YORK structu | 6e-07 | |
| 1r26_A | 125 | Thioredoxin; redox-active disulfide, electron tran | 1e-06 | |
| 2dbc_A | 135 | PDCL2, unnamed protein product; phosducin-like pro | 1e-06 | |
| 1sen_A | 164 | Thioredoxin-like protein P19; endoplasmic reticulu | 1e-06 | |
| 3die_A | 106 | Thioredoxin, TRX; electron transport, SWAP domain, | 1e-06 | |
| 2f51_A | 118 | Thioredoxin; electron transport; 1.90A {Trichomona | 1e-06 | |
| 1oaz_A | 123 | Thioredoxin 1; immune system, antibody/complex, an | 2e-06 | |
| 2oe3_A | 114 | Thioredoxin-3; electron transport, alpha/beta sand | 4e-06 | |
| 1a0r_P | 245 | Phosducin, MEKA, PP33; transducin, beta-gamma, sig | 7e-06 | |
| 2l4c_A | 124 | Endoplasmic reticulum resident protein 27; ERP27, | 9e-06 | |
| 3gix_A | 149 | Thioredoxin-like protein 4B; PRE-mRNA splicing, TX | 9e-06 | |
| 3evi_A | 118 | Phosducin-like protein 2; alpha beta, 3-layer(ABA) | 9e-06 | |
| 3apq_A | 210 | DNAJ homolog subfamily C member 10; thioredoxin fo | 9e-06 | |
| 3emx_A | 135 | Thioredoxin; structural genomics, oxidoreductase, | 1e-05 | |
| 2voc_A | 112 | Thioredoxin; electron transport, homodimer, disulf | 2e-05 | |
| 1syr_A | 112 | Thioredoxin; SGPP, structural genomics, PSI, prote | 2e-05 | |
| 2l6c_A | 110 | Thioredoxin; oxidoreductase; NMR {Desulfovibrio vu | 2e-05 | |
| 3f3q_A | 109 | Thioredoxin-1; His TAG, electron transport, cytopl | 3e-05 | |
| 1ep7_A | 112 | Thioredoxin CH1, H-type; electron transport; 2.10A | 6e-05 | |
| 2trc_P | 217 | Phosducin, MEKA, PP33; transducin, beta-gamma, sig | 7e-05 | |
| 2pu9_C | 111 | TRX-F, thioredoxin F-type, chloroplast; protein-pr | 2e-04 | |
| 1faa_A | 124 | Thioredoxin F; electron transport; 1.85A {Spinacia | 3e-04 | |
| 1xwb_A | 106 | Thioredoxin; dimerization, redox regulation, THI X | 4e-04 | |
| 1xfl_A | 124 | Thioredoxin H1; AT3G51030, structural genomics, pr | 4e-04 | |
| 1ti3_A | 113 | Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Popul | 4e-04 | |
| 3d6i_A | 112 | Monothiol glutaredoxin-3; thioredoxin-like, electr | 5e-04 | |
| 3qfa_C | 116 | Thioredoxin; protein-protein complex, rossmann fol | 6e-04 | |
| 2vlu_A | 122 | Thioredoxin, thioredoxin H isoform 2.; oxidoreduct | 6e-04 | |
| 2xc2_A | 117 | Thioredoxinn; oxidoreductase, protein disulfide re | 7e-04 | |
| 2wz9_A | 153 | Glutaredoxin-3; protein binding; 1.55A {Homo sapie | 8e-04 |
| >3uem_A Protein disulfide-isomerase; thioredoxin-like domain, chaper; 2.29A {Homo sapiens} PDB: 2k18_A 1x5c_A 1bjx_A 2bjx_A Length = 361 | Back alignment and structure |
|---|
Score = 224 bits (571), Expect = 1e-70
Identities = 97/342 (28%), Positives = 168/342 (49%), Gaps = 10/342 (2%)
Query: 4 NTVNEAEEFLKKYQTFVLGMFKKFEGSDYEEFVKTAAADNEIQFVETSNFEVAKVLYPDI 63
AE ++ + V+G FK E ++F++ A A ++I F TSN +V
Sbjct: 23 PDGAAAESLVESSEVAVIGFFKDVESDSAKQFLQAAEAIDDIPFGITSNSDVFS----KY 78
Query: 64 KSTDHFLGIVKSEPDRYTGYEETFIMDKILQFLNYNKFPLVTKLTDINSASVHSSPIKLQ 123
+ + + K + +E + +L F+ +N+ PLV + T+ + + IK
Sbjct: 79 QLDKDGVVLFKKFDEGRNNFEGEVTKENLLDFIKHNQLPLVIEFTEQTAPKIFGGEIKTH 138
Query: 124 VYVFA--KADDLKSLLEPLEDIARNFKGKIMFTAVDIADEDLAKPFLTLFGLEESKN-TV 180
+ +F D L + A +FKGKI+F +D D + L FGL++ + V
Sbjct: 139 ILLFLPKSVSDYDGKLSNFKTAAESFKGKILFIFIDS-DHTDNQRILEFFGLKKEECPAV 197
Query: 181 VTAFDNKAISKFLLESD-LTPSNIEEFCSRLLHGTLTPYLKSQPIP-DNTNANVQIVVGK 238
+ ++K+ ES+ LT I EFC R L G + P+L SQ +P D V+++VGK
Sbjct: 198 RLITLEEEMTKYKPESEELTAERITEFCHRFLEGKIKPHLMSQELPEDWDKQPVKVLVGK 257
Query: 239 TFDDLVLNSHKDVLLEVYTPWCVTCETTSKQIEKLAKHFKGLDNLVIAKIDASANEHPKL 298
F+D+ + K+V +E Y PWC C+ + +KL + +K +N+VIAK+D++ANE +
Sbjct: 258 NFEDVAFDEKKNVFVEFYAPWCGHCKQLAPIWDKLGETYKDHENIVIAKMDSTANEVEAV 317
Query: 299 QVEEYPTLLFYPAGDKANPIKVSARSSSKNIAAFIKEQLKEK 340
+V +PTL F+PA I + + F++ ++
Sbjct: 318 KVHSFPTLKFFPASADRTVIDYNGERTLDGFKKFLESGGQDG 359
|
| >3f8u_A Protein disulfide-isomerase A3ERP57; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} PDB: 2dmm_A 2alb_A Length = 481 | Back alignment and structure |
|---|
| >3f8u_A Protein disulfide-isomerase A3ERP57; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} PDB: 2dmm_A 2alb_A Length = 481 | Back alignment and structure |
|---|
| >2b5e_A Protein disulfide-isomerase; 2.40A {Saccharomyces cerevisiae} SCOP: c.47.1.2 c.47.1.2 c.47.1.2 c.47.1.2 PDB: 3boa_A Length = 504 | Back alignment and structure |
|---|
| >2b5e_A Protein disulfide-isomerase; 2.40A {Saccharomyces cerevisiae} SCOP: c.47.1.2 c.47.1.2 c.47.1.2 c.47.1.2 PDB: 3boa_A Length = 504 | Back alignment and structure |
|---|
| >2dj3_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} Length = 133 | Back alignment and structure |
|---|
| >2djj_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp1_A Length = 121 | Back alignment and structure |
|---|
| >2h8l_A Protein disulfide-isomerase A3; thioredoxin-like fold; 2.00A {Homo sapiens} Length = 252 | Back alignment and structure |
|---|
| >3h79_A Thioredoxin-like protein; thioredoxin fold, catalytic cysteines missing, unknown funct; 1.50A {Trypanosoma cruzi} Length = 127 | Back alignment and structure |
|---|
| >3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 | Back alignment and structure |
|---|
| >3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 | Back alignment and structure |
|---|
| >3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 | Back alignment and structure |
|---|
| >3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 | Back alignment and structure |
|---|
| >2r2j_A Thioredoxin domain-containing protein 4; CRFS motif, chaperone, endoplasmic reticulum, S response; 2.60A {Homo sapiens} Length = 382 | Back alignment and structure |
|---|
| >2r2j_A Thioredoxin domain-containing protein 4; CRFS motif, chaperone, endoplasmic reticulum, S response; 2.60A {Homo sapiens} Length = 382 | Back alignment and structure |
|---|
| >3ec3_A Protein disulfide-isomerase A4; thioredoxin-like fold, endoplasmic reticulum, glycoprotein, redox-active center; 1.92A {Rattus norvegicus} Length = 250 | Back alignment and structure |
|---|
| >3us3_A Calsequestrin-1; calcium-binding protein; 1.74A {Oryctolagus cuniculus} PDB: 1a8y_A 3trq_A* 3trp_A* 3uom_A Length = 367 | Back alignment and structure |
|---|
| >3us3_A Calsequestrin-1; calcium-binding protein; 1.74A {Oryctolagus cuniculus} PDB: 1a8y_A 3trq_A* 3trp_A* 3uom_A Length = 367 | Back alignment and structure |
|---|
| >3us3_A Calsequestrin-1; calcium-binding protein; 1.74A {Oryctolagus cuniculus} PDB: 1a8y_A 3trq_A* 3trp_A* 3uom_A Length = 367 | Back alignment and structure |
|---|
| >3bj5_A Protein disulfide-isomerase; thioredoxin fold, chaperone, endoplasmic reticulum, isomeras membrane, redox-active center; 2.20A {Homo sapiens} Length = 147 | Back alignment and structure |
|---|
| >2djk_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp2_A Length = 133 | Back alignment and structure |
|---|
| >1sji_A Calsequestrin 2, calsequestrin, cardiac muscle isoform; glycoprotein, calcium-binding, muscle protein, metal binding protein; 2.40A {Canis lupus familiaris} PDB: 2vaf_A Length = 350 | Back alignment and structure |
|---|
| >1sji_A Calsequestrin 2, calsequestrin, cardiac muscle isoform; glycoprotein, calcium-binding, muscle protein, metal binding protein; 2.40A {Canis lupus familiaris} PDB: 2vaf_A Length = 350 | Back alignment and structure |
|---|
| >1sji_A Calsequestrin 2, calsequestrin, cardiac muscle isoform; glycoprotein, calcium-binding, muscle protein, metal binding protein; 2.40A {Canis lupus familiaris} PDB: 2vaf_A Length = 350 | Back alignment and structure |
|---|
| >1mek_A Protein disulfide isomerase; electron transport, redox-active center, endoplasmic reticulum; NMR {Homo sapiens} SCOP: c.47.1.2 Length = 120 | Back alignment and structure |
|---|
| >1x5d_A Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC7, thioredoxin like domain, redox, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 133 | Back alignment and structure |
|---|
| >3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A Length = 241 | Back alignment and structure |
|---|
| >3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A Length = 241 | Back alignment and structure |
|---|
| >3t58_A Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2.40A {Mus musculus} PDB: 3t59_A* Length = 519 | Back alignment and structure |
|---|
| >2dj1_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} Length = 140 | Back alignment and structure |
|---|
| >3q6o_A Sulfhydryl oxidase 1; protein disulfide isomerase, thioredoxin, thioredoxin fold, oxidoreductase, reductive methylation; HET: MLY; 2.05A {Homo sapiens} Length = 244 | Back alignment and structure |
|---|
| >2dml_A Protein disulfide-isomerase A6; thioredoxin domain-containing protein 7, endoplasmic reticulum, redox-active center, structural genomics, NPPSFA; NMR {Mus musculus} Length = 130 | Back alignment and structure |
|---|
| >3aps_A DNAJ homolog subfamily C member 10; thioredoxin fold, CXXC motif, endoplasmic reticulum, oxidore; 1.90A {Mus musculus} Length = 122 | Back alignment and structure |
|---|
| >2qc7_A ERP31, ERP28, endoplasmic reticulum protein ERP29; B domain (residues 33-153), D domain (residues 154-261), CHA; 2.90A {Homo sapiens} PDB: 1g7e_A 1g7d_A Length = 240 | Back alignment and structure |
|---|
| >1x5e_A Thioredoxin domain containing protein 1; TMX, TXNDC1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 126 | Back alignment and structure |
|---|
| >3uvt_A Thioredoxin domain-containing protein 5; thioredoxin-like fold, isomerase; 2.00A {Homo sapiens} PDB: 2diz_A Length = 111 | Back alignment and structure |
|---|
| >3ed3_A Protein disulfide-isomerase MPD1; thioredoxin-like domain, CXXC, endoplasmic reticulum, glycoprotein, redox-active center; 2.00A {Saccharomyces cerevisiae} Length = 298 | Back alignment and structure |
|---|
| >3qcp_A QSOX from trypanosoma brucei (tbqsox); ERV fold, thioredoxin fold, sulfhydryl oxidase, oxidoreducta; HET: FAD; 2.30A {Trypanosoma brucei} PDB: 3qd9_A* Length = 470 | Back alignment and structure |
|---|
| >2l57_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, PSI protein structure initiative; NMR {Clostridium perfringens} Length = 126 | Back alignment and structure |
|---|
| >1w4v_A Thioredoxin, mitochondrial; antioxidant enzyme, mitochondrion, electron TRA oxidoreductase; 1.80A {Homo sapiens} PDB: 1uvz_A 1w89_A Length = 119 | Back alignment and structure |
|---|
| >3hz4_A Thioredoxin; NYSGXRC, PSI-II, reduced form, protein structure initiative, structural genomics; 2.30A {Methanosarcina mazei} Length = 140 | Back alignment and structure |
|---|
| >2j23_A Thioredoxin; immune protein, autoreactivity, cross-reactivity, IGE, fungi, epitope, allergen; 1.41A {Malassezia sympodialis} Length = 121 | Back alignment and structure |
|---|
| >2l5l_A Thioredoxin; structural genomics, electron transport, PSI-2, protein STRU initiative; NMR {Bacteroides vulgatus} Length = 136 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2ppt_A Thioredoxin-2; thiredoxin, zinc finger, oxidoreductase; 1.92A {Rhodobacter capsulatus} Length = 155 | Back alignment and structure |
|---|
| >3gnj_A Thioredoxin domain protein; APC92103, STR genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.99A {Desulfitobacterium hafniense dcb-2} Length = 111 | Back alignment and structure |
|---|
| >2kuc_A Putative disulphide-isomerase; structural genomics, thioredo PSI-2, protein structure initiative; NMR {Bacteroides thetaiotaomicron} Length = 130 | Back alignment and structure |
|---|
| >1t00_A Thioredoxin, TRX; redox regulation, multifunction macromolecule, electron transport; 1.51A {Streptomyces coelicolor} Length = 112 | Back alignment and structure |
|---|
| >2fwh_A Thiol:disulfide interchange protein DSBD; thioredoxin-like, C-terminal domain, reduced form at PH7, oxidoreductase; 0.99A {Escherichia coli} SCOP: c.47.1.1 PDB: 2fwe_A 2fwf_A 2fwg_A 1vrs_D 1uc7_A Length = 134 | Back alignment and structure |
|---|
| >2i1u_A Thioredoxin, TRX, MPT46; redox protein, electron transport; 1.30A {Mycobacterium tuberculosis} PDB: 3nof_A 3o6t_A* 2l4q_A 2l59_A Length = 121 | Back alignment and structure |
|---|
| >1fb6_A Thioredoxin M; electron transport; 2.10A {Spinacia oleracea} SCOP: c.47.1.1 PDB: 1fb0_A 1gl8_A 2puk_C Length = 105 | Back alignment and structure |
|---|
| >2o8v_B Thioredoxin 1; disulfide crosslinked complex, oxidoreductase; 3.00A {Escherichia coli} Length = 128 | Back alignment and structure |
|---|
| >1dby_A Chloroplast thioredoxin M CH2; thioredoxin CH2, chloroplastic thioredoxin, oxidoreductase; NMR {Chlamydomonas reinhardtii} SCOP: c.47.1.1 Length = 107 | Back alignment and structure |
|---|
| >2yj7_A LPBCA thioredoxin; oxidoreductase; 1.65A {Synthetic construct} Length = 106 | Back alignment and structure |
|---|
| >2trx_A Thioredoxin; electron transport; 1.68A {Escherichia coli} SCOP: c.47.1.1 PDB: 1skr_B* 1skw_B* 1sl0_B* 1sks_B* 1sl2_B* 1t7p_B* 1t8e_B* 1tk0_B* 1tk5_B* 1tk8_B* 1tkd_B* 1sl1_B* 1x9s_B* 1x9w_B* 1xoa_A 1xob_A 1zyq_B* 2ajq_B* 2bto_T* 2h6x_A ... Length = 108 | Back alignment and structure |
|---|
| >3tco_A Thioredoxin (TRXA-1); disulfide oxidoreductase, oxidoreductase; 1.90A {Sulfolobus solfataricus} Length = 109 | Back alignment and structure |
|---|
| >3p2a_A Thioredoxin 2, putative thioredoxin-like protein; structural genomics, center for structural genomics of infec diseases, csgid; 2.19A {Yersinia pestis} Length = 148 | Back alignment and structure |
|---|
| >1thx_A Thioredoxin, thioredoxin 2; oxido-reductase, electron transport; 1.60A {Nostoc SP} SCOP: c.47.1.1 Length = 115 | Back alignment and structure |
|---|
| >2i4a_A Thioredoxin; acidophIle, disulfide exchange, oxidoreductase; 1.00A {Acetobacter aceti} Length = 107 | Back alignment and structure |
|---|
| >2yzu_A Thioredoxin; redox protein, electron transport, structural genomics; 1.90A {Thermus thermophilus} PDB: 2cvk_A Length = 109 | Back alignment and structure |
|---|
| >1nsw_A Thioredoxin, TRX; thermostability, electron transport; 1.90A {Alicyclobacillus acidocaldarius} SCOP: c.47.1.1 PDB: 1rqm_A 1quw_A 1nw2_A Length = 105 | Back alignment and structure |
|---|
| >3ul3_B Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 2.90A {Plasmodium falciparum} Length = 128 | Back alignment and structure |
|---|
| >3hxs_A Thioredoxin, TRXP; electron transport; 2.00A {Bacteroides fragilis} PDB: 3hyp_A Length = 141 | Back alignment and structure |
|---|
| >1v98_A Thioredoxin; oxidoreductase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.82A {Thermus thermophilus} Length = 140 | Back alignment and structure |
|---|
| >3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, alternative splicing, FBP interacting repressor, RRM, electron transport; 2.20A {Escherichia coli O157} Length = 222 | Back alignment and structure |
|---|
| >4euy_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; 2.90A {Bacillus cereus} Length = 105 | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Length = 287 | Back alignment and structure |
|---|
| >2e0q_A Thioredoxin; electron transport; 1.49A {Sulfolobus tokodaii} PDB: 3hhv_A Length = 104 | Back alignment and structure |
|---|
| >2c0g_A ERP29 homolog, windbeutel protein; PDI-dbeta, PDI, protein disulfide isomerase, PIPE, dorsal-ventral patterning, chaperone, WIND mutants; 1.75A {Drosophila melanogaster} SCOP: a.71.1.1 c.47.1.7 PDB: 1ovn_A 2c0f_A 2c1y_A 2c0e_A Length = 248 | Back alignment and structure |
|---|
| >2lst_A Thioredoxin; structural genomics, NEW YORK structural genomics research consortium, oxidoreductase; NMR {Thermus thermophilus} Length = 130 | Back alignment and structure |
|---|
| >1r26_A Thioredoxin; redox-active disulfide, electron transport; 1.40A {Trypanosoma} SCOP: c.47.1.1 Length = 125 | Back alignment and structure |
|---|
| >2dbc_A PDCL2, unnamed protein product; phosducin-like protein, thioredoxin_FOLD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 135 | Back alignment and structure |
|---|
| >1sen_A Thioredoxin-like protein P19; endoplasmic reticulum, RP19, structural genomics, PSI, protein structure initiative; 1.20A {Homo sapiens} SCOP: c.47.1.1 PDB: 2k8v_A Length = 164 | Back alignment and structure |
|---|
| >3die_A Thioredoxin, TRX; electron transport, SWAP domain, redox enzymology, oxidoreductase, redox-active center, transport; 1.85A {Staphylococcus aureus} PDB: 2o7k_A 2o85_A 2o89_A 2o87_A Length = 106 | Back alignment and structure |
|---|
| >2f51_A Thioredoxin; electron transport; 1.90A {Trichomonas vaginalis} Length = 118 | Back alignment and structure |
|---|
| >1oaz_A Thioredoxin 1; immune system, antibody/complex, antibody, allergy, IGE, conformational diversity, multispecficity, redox-active center; 2.77A {Escherichia coli} SCOP: c.47.1.1 Length = 123 | Back alignment and structure |
|---|
| >2oe3_A Thioredoxin-3; electron transport, alpha/beta sandwich, oxidized, dimer; 1.80A {Saccharomyces cerevisiae} PDB: 2oe1_A 2oe0_A Length = 114 | Back alignment and structure |
|---|
| >1a0r_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; HET: FAR; 2.80A {Bos taurus} SCOP: c.47.1.6 PDB: 1b9y_C 1b9x_C Length = 245 | Back alignment and structure |
|---|
| >2l4c_A Endoplasmic reticulum resident protein 27; ERP27, PDI, B domain, peptide binding; NMR {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >3gix_A Thioredoxin-like protein 4B; PRE-mRNA splicing, TXNL4B, DLP, cell cycle, mRNA processing, mRNA splicing, nucleus, phosphoprotein, splicing; HET: SUC; 1.33A {Homo sapiens} PDB: 1xbs_A Length = 149 | Back alignment and structure |
|---|
| >3evi_A Phosducin-like protein 2; alpha beta, 3-layer(ABA) sandwich, unknown function; 2.70A {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Length = 210 | Back alignment and structure |
|---|
| >3emx_A Thioredoxin; structural genomics, oxidoreductase, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.25A {Aeropyrum pernix} Length = 135 | Back alignment and structure |
|---|
| >2voc_A Thioredoxin; electron transport, homodimer, disulfide, transport, redox-active center; 1.50A {Bacillus subtilis} PDB: 2ipa_A 2gzy_A 2gzz_A Length = 112 | Back alignment and structure |
|---|
| >1syr_A Thioredoxin; SGPP, structural genomics, PSI, protein structure initiative structural genomics of pathogenic protozoa consortium; 2.95A {Plasmodium falciparum} SCOP: c.47.1.1 Length = 112 | Back alignment and structure |
|---|
| >2l6c_A Thioredoxin; oxidoreductase; NMR {Desulfovibrio vulgaris} PDB: 2l6d_A Length = 110 | Back alignment and structure |
|---|
| >3f3q_A Thioredoxin-1; His TAG, electron transport, cytoplasm, deoxyribonucleotide synthesis, golgi apparatus, membrane, nucleus; 1.76A {Saccharomyces cerevisiae} PDB: 3f3r_A* 2i9h_A 2fa4_A 2hsy_A 3pin_A 4dss_B Length = 109 | Back alignment and structure |
|---|
| >1ep7_A Thioredoxin CH1, H-type; electron transport; 2.10A {Chlamydomonas reinhardtii} SCOP: c.47.1.1 PDB: 1tof_A 1ep8_A Length = 112 | Back alignment and structure |
|---|
| >2trc_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; 2.40A {Rattus norvegicus} SCOP: c.47.1.6 Length = 217 | Back alignment and structure |
|---|
| >2pu9_C TRX-F, thioredoxin F-type, chloroplast; protein-protein complex, iron-sulfur, electron transport; 1.65A {Spinacia oleracea} PDB: 2pvo_C 1f9m_A Length = 111 | Back alignment and structure |
|---|
| >1faa_A Thioredoxin F; electron transport; 1.85A {Spinacia oleracea} SCOP: c.47.1.1 Length = 124 | Back alignment and structure |
|---|
| >1xwb_A Thioredoxin; dimerization, redox regulation, THI X-RAY electron transport; 2.20A {Drosophila melanogaster} SCOP: c.47.1.1 PDB: 1xw9_A 1xwc_A 1xwa_A Length = 106 | Back alignment and structure |
|---|
| >1xfl_A Thioredoxin H1; AT3G51030, structural genomics, protein structure initiative, CESG, center for eukaryotic structural genomics; NMR {Arabidopsis thaliana} SCOP: c.47.1.1 Length = 124 | Back alignment and structure |
|---|
| >1ti3_A Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Populus tremula} SCOP: c.47.1.1 Length = 113 | Back alignment and structure |
|---|
| >3d6i_A Monothiol glutaredoxin-3; thioredoxin-like, electron transport, redox- active center, transport, oxidoreductase; HET: CME; 1.50A {Saccharomyces cerevisiae} Length = 112 | Back alignment and structure |
|---|
| >3qfa_C Thioredoxin; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_C* Length = 116 | Back alignment and structure |
|---|
| >2vlu_A Thioredoxin, thioredoxin H isoform 2.; oxidoreductase, thioredoxin-fold, protein disulfide reductase; 1.70A {Hordeum vulgare var} PDB: 2vlt_A 2vlv_A 2iwt_A* Length = 122 | Back alignment and structure |
|---|
| >2xc2_A Thioredoxinn; oxidoreductase, protein disulfide reductase; 1.56A {Schistosoma mansoni} PDB: 2xbq_A 2xbi_A Length = 117 | Back alignment and structure |
|---|
| >2wz9_A Glutaredoxin-3; protein binding; 1.55A {Homo sapiens} PDB: 2diy_A Length = 153 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 360 | |||
| 3uem_A | 361 | Protein disulfide-isomerase; thioredoxin-like doma | 100.0 | |
| 3f8u_A | 481 | Protein disulfide-isomerase A3ERP57; endoplasmic r | 100.0 | |
| 2b5e_A | 504 | Protein disulfide-isomerase; 2.40A {Saccharomyces | 100.0 | |
| 3apo_A | 780 | DNAJ homolog subfamily C member 10; PDI family, th | 100.0 | |
| 3apo_A | 780 | DNAJ homolog subfamily C member 10; PDI family, th | 100.0 | |
| 3ec3_A | 250 | Protein disulfide-isomerase A4; thioredoxin-like f | 100.0 | |
| 2h8l_A | 252 | Protein disulfide-isomerase A3; thioredoxin-like f | 100.0 | |
| 4f9z_D | 227 | Endoplasmic reticulum resident protein 27; thiored | 100.0 | |
| 3idv_A | 241 | Protein disulfide-isomerase A4; thioredoxin-like f | 99.97 | |
| 1sji_A | 350 | Calsequestrin 2, calsequestrin, cardiac muscle iso | 99.95 | |
| 3us3_A | 367 | Calsequestrin-1; calcium-binding protein; 1.74A {O | 99.95 | |
| 3us3_A | 367 | Calsequestrin-1; calcium-binding protein; 1.74A {O | 99.95 | |
| 2r2j_A | 382 | Thioredoxin domain-containing protein 4; CRFS moti | 99.94 | |
| 1sji_A | 350 | Calsequestrin 2, calsequestrin, cardiac muscle iso | 99.94 | |
| 1a8l_A | 226 | Protein disulfide oxidoreductase; PDI, thioredoxin | 99.93 | |
| 2ywm_A | 229 | Glutaredoxin-like protein; redox protein, structur | 99.92 | |
| 2r2j_A | 382 | Thioredoxin domain-containing protein 4; CRFS moti | 99.91 | |
| 2hls_A | 243 | Protein disulfide oxidoreductase; thioredoxin fold | 99.9 | |
| 3f8u_A | 481 | Protein disulfide-isomerase A3ERP57; endoplasmic r | 99.87 | |
| 3h79_A | 127 | Thioredoxin-like protein; thioredoxin fold, cataly | 99.85 | |
| 2djj_A | 121 | PDI, protein disulfide-isomerase; thioredoxin fold | 99.84 | |
| 2djk_A | 133 | PDI, protein disulfide-isomerase; thioredoxin fold | 99.84 | |
| 3bj5_A | 147 | Protein disulfide-isomerase; thioredoxin fold, cha | 99.83 | |
| 3idv_A | 241 | Protein disulfide-isomerase A4; thioredoxin-like f | 99.83 | |
| 2b5e_A | 504 | Protein disulfide-isomerase; 2.40A {Saccharomyces | 99.81 | |
| 2dj3_A | 133 | Protein disulfide-isomerase A4; protein ERP-72, ER | 99.81 | |
| 1a8l_A | 226 | Protein disulfide oxidoreductase; PDI, thioredoxin | 99.81 | |
| 3ed3_A | 298 | Protein disulfide-isomerase MPD1; thioredoxin-like | 99.81 | |
| 3zzx_A | 105 | Thioredoxin; oxidoreductase; 1.88A {Litopenaeus va | 99.79 | |
| 3uem_A | 361 | Protein disulfide-isomerase; thioredoxin-like doma | 99.79 | |
| 2trx_A | 108 | Thioredoxin; electron transport; 1.68A {Escherichi | 99.77 | |
| 3gnj_A | 111 | Thioredoxin domain protein; APC92103, STR genomics | 99.76 | |
| 2qsi_A | 137 | Putative hydrogenase expression/formation protein; | 99.76 | |
| 2av4_A | 160 | Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECI | 99.76 | |
| 3ga4_A | 178 | Dolichyl-diphosphooligosaccharide-protein glycosyl | 99.76 | |
| 2o8v_B | 128 | Thioredoxin 1; disulfide crosslinked complex, oxid | 99.76 | |
| 2voc_A | 112 | Thioredoxin; electron transport, homodimer, disulf | 99.75 | |
| 2ywm_A | 229 | Glutaredoxin-like protein; redox protein, structur | 99.75 | |
| 2dj1_A | 140 | Protein disulfide-isomerase A4; protein ERP-72, ER | 99.75 | |
| 2dml_A | 130 | Protein disulfide-isomerase A6; thioredoxin domain | 99.75 | |
| 1x5d_A | 133 | Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC | 99.74 | |
| 2i4a_A | 107 | Thioredoxin; acidophIle, disulfide exchange, oxido | 99.74 | |
| 1w4v_A | 119 | Thioredoxin, mitochondrial; antioxidant enzyme, mi | 99.74 | |
| 1t00_A | 112 | Thioredoxin, TRX; redox regulation, multifunction | 99.73 | |
| 1mek_A | 120 | Protein disulfide isomerase; electron transport, r | 99.73 | |
| 3aps_A | 122 | DNAJ homolog subfamily C member 10; thioredoxin fo | 99.73 | |
| 3uvt_A | 111 | Thioredoxin domain-containing protein 5; thioredox | 99.73 | |
| 3hz4_A | 140 | Thioredoxin; NYSGXRC, PSI-II, reduced form, protei | 99.73 | |
| 3p2a_A | 148 | Thioredoxin 2, putative thioredoxin-like protein; | 99.73 | |
| 3die_A | 106 | Thioredoxin, TRX; electron transport, SWAP domain, | 99.73 | |
| 3tco_A | 109 | Thioredoxin (TRXA-1); disulfide oxidoreductase, ox | 99.73 | |
| 2qgv_A | 140 | Hydrogenase-1 operon protein HYAE; alpha-beta prot | 99.73 | |
| 3dxb_A | 222 | Thioredoxin N-terminally fused to PUF60(UHM); spli | 99.73 | |
| 3hxs_A | 141 | Thioredoxin, TRXP; electron transport; 2.00A {Bact | 99.72 | |
| 1thx_A | 115 | Thioredoxin, thioredoxin 2; oxido-reductase, elect | 99.72 | |
| 3evi_A | 118 | Phosducin-like protein 2; alpha beta, 3-layer(ABA) | 99.72 | |
| 2l5l_A | 136 | Thioredoxin; structural genomics, electron transpo | 99.72 | |
| 2ppt_A | 155 | Thioredoxin-2; thiredoxin, zinc finger, oxidoreduc | 99.72 | |
| 1dby_A | 107 | Chloroplast thioredoxin M CH2; thioredoxin CH2, ch | 99.72 | |
| 4euy_A | 105 | Uncharacterized protein; structural genomics, PSI- | 99.72 | |
| 1fb6_A | 105 | Thioredoxin M; electron transport; 2.10A {Spinacia | 99.71 | |
| 2i1u_A | 121 | Thioredoxin, TRX, MPT46; redox protein, electron t | 99.71 | |
| 1oaz_A | 123 | Thioredoxin 1; immune system, antibody/complex, an | 99.7 | |
| 1nsw_A | 105 | Thioredoxin, TRX; thermostability, electron transp | 99.7 | |
| 2yzu_A | 109 | Thioredoxin; redox protein, electron transport, st | 99.7 | |
| 2l4c_A | 124 | Endoplasmic reticulum resident protein 27; ERP27, | 99.7 | |
| 4f9z_D | 227 | Endoplasmic reticulum resident protein 27; thiored | 99.69 | |
| 2pu9_C | 111 | TRX-F, thioredoxin F-type, chloroplast; protein-pr | 99.69 | |
| 3qfa_C | 116 | Thioredoxin; protein-protein complex, rossmann fol | 99.69 | |
| 1v98_A | 140 | Thioredoxin; oxidoreductase, structural genomics, | 99.68 | |
| 2e0q_A | 104 | Thioredoxin; electron transport; 1.49A {Sulfolobus | 99.68 | |
| 1x5e_A | 126 | Thioredoxin domain containing protein 1; TMX, TXND | 99.68 | |
| 1gh2_A | 107 | Thioredoxin-like protein; redox-active center, ele | 99.68 | |
| 2dbc_A | 135 | PDCL2, unnamed protein product; phosducin-like pro | 99.68 | |
| 2trc_P | 217 | Phosducin, MEKA, PP33; transducin, beta-gamma, sig | 99.67 | |
| 3q6o_A | 244 | Sulfhydryl oxidase 1; protein disulfide isomerase, | 99.67 | |
| 3apq_A | 210 | DNAJ homolog subfamily C member 10; thioredoxin fo | 99.67 | |
| 1xwb_A | 106 | Thioredoxin; dimerization, redox regulation, THI X | 99.67 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 99.66 | |
| 2c0g_A | 248 | ERP29 homolog, windbeutel protein; PDI-dbeta, PDI, | 99.66 | |
| 1r26_A | 125 | Thioredoxin; redox-active disulfide, electron tran | 99.66 | |
| 3f3q_A | 109 | Thioredoxin-1; His TAG, electron transport, cytopl | 99.66 | |
| 3gix_A | 149 | Thioredoxin-like protein 4B; PRE-mRNA splicing, TX | 99.66 | |
| 3q6o_A | 244 | Sulfhydryl oxidase 1; protein disulfide isomerase, | 99.66 | |
| 1ep7_A | 112 | Thioredoxin CH1, H-type; electron transport; 2.10A | 99.65 | |
| 1a0r_P | 245 | Phosducin, MEKA, PP33; transducin, beta-gamma, sig | 99.65 | |
| 3ul3_B | 128 | Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; | 99.65 | |
| 2vlu_A | 122 | Thioredoxin, thioredoxin H isoform 2.; oxidoreduct | 99.65 | |
| 3d6i_A | 112 | Monothiol glutaredoxin-3; thioredoxin-like, electr | 99.64 | |
| 1qgv_A | 142 | Spliceosomal protein U5-15KD; snRNP, thioredoxin, | 99.64 | |
| 1faa_A | 124 | Thioredoxin F; electron transport; 1.85A {Spinacia | 99.63 | |
| 2xc2_A | 117 | Thioredoxinn; oxidoreductase, protein disulfide re | 99.63 | |
| 2l57_A | 126 | Uncharacterized protein; structural genomics, unkn | 99.62 | |
| 2vim_A | 104 | Thioredoxin, TRX; thioredoxin fold, oxidoreductase | 99.62 | |
| 1syr_A | 112 | Thioredoxin; SGPP, structural genomics, PSI, prote | 99.62 | |
| 2qc7_A | 240 | ERP31, ERP28, endoplasmic reticulum protein ERP29; | 99.62 | |
| 2es7_A | 142 | Q8ZP25_salty, putative thiol-disulfide isomerase a | 99.62 | |
| 1xfl_A | 124 | Thioredoxin H1; AT3G51030, structural genomics, pr | 99.62 | |
| 3m9j_A | 105 | Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} | 99.61 | |
| 2hls_A | 243 | Protein disulfide oxidoreductase; thioredoxin fold | 99.61 | |
| 2dj0_A | 137 | Thioredoxin-related transmembrane protein 2; AVLA2 | 99.61 | |
| 2yj7_A | 106 | LPBCA thioredoxin; oxidoreductase; 1.65A {Syntheti | 99.4 | |
| 2l6c_A | 110 | Thioredoxin; oxidoreductase; NMR {Desulfovibrio vu | 99.6 | |
| 2wz9_A | 153 | Glutaredoxin-3; protein binding; 1.55A {Homo sapie | 99.6 | |
| 2oe3_A | 114 | Thioredoxin-3; electron transport, alpha/beta sand | 99.59 | |
| 3ed3_A | 298 | Protein disulfide-isomerase MPD1; thioredoxin-like | 99.59 | |
| 2f51_A | 118 | Thioredoxin; electron transport; 1.90A {Trichomona | 99.59 | |
| 2j23_A | 121 | Thioredoxin; immune protein, autoreactivity, cross | 99.59 | |
| 3emx_A | 135 | Thioredoxin; structural genomics, oxidoreductase, | 99.59 | |
| 3d22_A | 139 | TRXH4, thioredoxin H-type; electron transport, cyt | 99.58 | |
| 2vm1_A | 118 | Thioredoxin, thioredoxin H isoform 1.; oxidoreduct | 99.58 | |
| 1ti3_A | 113 | Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Popul | 99.57 | |
| 3cxg_A | 133 | Putative thioredoxin; malaria, structural GEN oxid | 99.57 | |
| 3qcp_A | 470 | QSOX from trypanosoma brucei (tbqsox); ERV fold, t | 99.57 | |
| 3t58_A | 519 | Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2. | 99.55 | |
| 3t58_A | 519 | Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2. | 99.55 | |
| 1zma_A | 118 | Bacterocin transport accessory protein; alpha-beta | 99.55 | |
| 2kuc_A | 130 | Putative disulphide-isomerase; structural genomics | 99.51 | |
| 1fo5_A | 85 | Thioredoxin; disulfide oxidoreductase, structural | 99.51 | |
| 2djk_A | 133 | PDI, protein disulfide-isomerase; thioredoxin fold | 99.49 | |
| 1nho_A | 85 | Probable thioredoxin; beta sheet, alpha helix, oxi | 99.48 | |
| 2h8l_A | 252 | Protein disulfide-isomerase A3; thioredoxin-like f | 99.47 | |
| 3dml_A | 116 | Putative uncharacterized protein; thioredoxin, oxi | 99.46 | |
| 3fk8_A | 133 | Disulphide isomerase; APC61824.1, xylella fastidio | 99.45 | |
| 1wmj_A | 130 | Thioredoxin H-type; structural genomics, program f | 99.45 | |
| 1wou_A | 123 | Thioredoxin -related protein, 14 kDa; electron tra | 99.44 | |
| 3h79_A | 127 | Thioredoxin-like protein; thioredoxin fold, cataly | 99.43 | |
| 2fwh_A | 134 | Thiol:disulfide interchange protein DSBD; thioredo | 99.42 | |
| 3f9u_A | 172 | Putative exported cytochrome C biogenesis-related; | 99.41 | |
| 3ga4_A | 178 | Dolichyl-diphosphooligosaccharide-protein glycosyl | 99.34 | |
| 2lst_A | 130 | Thioredoxin; structural genomics, NEW YORK structu | 99.03 | |
| 3iv4_A | 112 | Putative oxidoreductase; APC23140, meticillin-resi | 99.34 | |
| 3ec3_A | 250 | Protein disulfide-isomerase A4; thioredoxin-like f | 99.32 | |
| 1un2_A | 197 | DSBA, thiol-disulfide interchange protein; disulfi | 99.32 | |
| 3tco_A | 109 | Thioredoxin (TRXA-1); disulfide oxidoreductase, ox | 99.32 | |
| 2ju5_A | 154 | Thioredoxin disulfide isomerase; protein, oxidored | 99.31 | |
| 3hz4_A | 140 | Thioredoxin; NYSGXRC, PSI-II, reduced form, protei | 99.31 | |
| 3gnj_A | 111 | Thioredoxin domain protein; APC92103, STR genomics | 99.3 | |
| 2c0g_A | 248 | ERP29 homolog, windbeutel protein; PDI-dbeta, PDI, | 99.3 | |
| 2dj1_A | 140 | Protein disulfide-isomerase A4; protein ERP-72, ER | 99.3 | |
| 3kp8_A | 106 | Vkorc1/thioredoxin domain protein; blood coagulati | 99.29 | |
| 2dml_A | 130 | Protein disulfide-isomerase A6; thioredoxin domain | 99.29 | |
| 3die_A | 106 | Thioredoxin, TRX; electron transport, SWAP domain, | 99.29 | |
| 2trx_A | 108 | Thioredoxin; electron transport; 1.68A {Escherichi | 99.28 | |
| 2dj3_A | 133 | Protein disulfide-isomerase A4; protein ERP-72, ER | 99.28 | |
| 1lu4_A | 136 | Soluble secreted antigen MPT53; thioredoxin-like f | 99.27 | |
| 1zzo_A | 136 | RV1677; thioredoxin fold, structural genomics, PSI | 99.26 | |
| 2b5x_A | 148 | YKUV protein, TRXY; thioredoxin-like, oxidoreducta | 99.26 | |
| 1x5d_A | 133 | Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC | 99.26 | |
| 1thx_A | 115 | Thioredoxin, thioredoxin 2; oxido-reductase, elect | 99.26 | |
| 2voc_A | 112 | Thioredoxin; electron transport, homodimer, disulf | 99.25 | |
| 3p2a_A | 148 | Thioredoxin 2, putative thioredoxin-like protein; | 99.25 | |
| 3or5_A | 165 | Thiol:disulfide interchange protein, thioredoxin p | 99.25 | |
| 1nsw_A | 105 | Thioredoxin, TRX; thermostability, electron transp | 99.25 | |
| 3ph9_A | 151 | Anterior gradient protein 3 homolog; thioredoxin f | 99.25 | |
| 2djj_A | 121 | PDI, protein disulfide-isomerase; thioredoxin fold | 99.25 | |
| 2ppt_A | 155 | Thioredoxin-2; thiredoxin, zinc finger, oxidoreduc | 99.25 | |
| 2i4a_A | 107 | Thioredoxin; acidophIle, disulfide exchange, oxido | 99.24 | |
| 2yzu_A | 109 | Thioredoxin; redox protein, electron transport, st | 99.24 | |
| 3hxs_A | 141 | Thioredoxin, TRXP; electron transport; 2.00A {Bact | 99.23 | |
| 1sen_A | 164 | Thioredoxin-like protein P19; endoplasmic reticulu | 99.23 | |
| 2o8v_B | 128 | Thioredoxin 1; disulfide crosslinked complex, oxid | 99.22 | |
| 2e0q_A | 104 | Thioredoxin; electron transport; 1.49A {Sulfolobus | 99.22 | |
| 1ilo_A | 77 | Conserved hypothetical protein MTH895; beta-alpha- | 99.22 | |
| 1mek_A | 120 | Protein disulfide isomerase; electron transport, r | 99.22 | |
| 1x5e_A | 126 | Thioredoxin domain containing protein 1; TMX, TXND | 99.22 | |
| 1v98_A | 140 | Thioredoxin; oxidoreductase, structural genomics, | 99.21 | |
| 3aps_A | 122 | DNAJ homolog subfamily C member 10; thioredoxin fo | 99.21 | |
| 3raz_A | 151 | Thioredoxin-related protein; structural genomics, | 99.21 | |
| 3zzx_A | 105 | Thioredoxin; oxidoreductase; 1.88A {Litopenaeus va | 99.2 | |
| 3qfa_C | 116 | Thioredoxin; protein-protein complex, rossmann fol | 99.2 | |
| 1w4v_A | 119 | Thioredoxin, mitochondrial; antioxidant enzyme, mi | 99.2 | |
| 1t00_A | 112 | Thioredoxin, TRX; redox regulation, multifunction | 99.2 | |
| 4euy_A | 105 | Uncharacterized protein; structural genomics, PSI- | 99.2 | |
| 1fb6_A | 105 | Thioredoxin M; electron transport; 2.10A {Spinacia | 99.19 | |
| 1dby_A | 107 | Chloroplast thioredoxin M CH2; thioredoxin CH2, ch | 99.19 | |
| 2f9s_A | 151 | Thiol-disulfide oxidoreductase RESA; thioredoxin-l | 99.18 | |
| 2i1u_A | 121 | Thioredoxin, TRX, MPT46; redox protein, electron t | 99.17 | |
| 3uvt_A | 111 | Thioredoxin domain-containing protein 5; thioredox | 99.17 | |
| 2l5l_A | 136 | Thioredoxin; structural genomics, electron transpo | 99.17 | |
| 2qsi_A | 137 | Putative hydrogenase expression/formation protein; | 99.17 | |
| 3erw_A | 145 | Sporulation thiol-disulfide oxidoreductase A; thio | 99.17 | |
| 3dxb_A | 222 | Thioredoxin N-terminally fused to PUF60(UHM); spli | 99.16 | |
| 3apq_A | 210 | DNAJ homolog subfamily C member 10; thioredoxin fo | 99.16 | |
| 1oaz_A | 123 | Thioredoxin 1; immune system, antibody/complex, an | 99.15 | |
| 1z6n_A | 167 | Hypothetical protein PA1234; alpha-beta-alpha sand | 99.15 | |
| 2h30_A | 164 | Thioredoxin, peptide methionine sulfoxide reductas | 99.14 | |
| 3ia1_A | 154 | THIO-disulfide isomerase/thioredoxin; oxidoreducta | 99.14 | |
| 3ul3_B | 128 | Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; | 99.14 | |
| 3lor_A | 160 | Thiol-disulfide isomerase and thioredoxins; PSI, M | 99.13 | |
| 2lja_A | 152 | Putative thiol-disulfide oxidoreductase; structura | 99.13 | |
| 2l57_A | 126 | Uncharacterized protein; structural genomics, unkn | 99.13 | |
| 1xwb_A | 106 | Thioredoxin; dimerization, redox regulation, THI X | 99.13 | |
| 1r26_A | 125 | Thioredoxin; redox-active disulfide, electron tran | 99.13 | |
| 3eyt_A | 158 | Uncharacterized protein SPOA0173; thioredoxin-like | 99.12 | |
| 1jfu_A | 186 | Thiol:disulfide interchange protein TLPA; thioredo | 99.12 | |
| 2l5o_A | 153 | Putative thioredoxin; structural genomics, unknown | 99.12 | |
| 1ep7_A | 112 | Thioredoxin CH1, H-type; electron transport; 2.10A | 99.12 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 99.11 | |
| 2vlu_A | 122 | Thioredoxin, thioredoxin H isoform 2.; oxidoreduct | 99.11 | |
| 1gh2_A | 107 | Thioredoxin-like protein; redox-active center, ele | 99.1 | |
| 2wz9_A | 153 | Glutaredoxin-3; protein binding; 1.55A {Homo sapie | 99.1 | |
| 4evm_A | 138 | Thioredoxin family protein; structural genomics, n | 99.1 | |
| 2pu9_C | 111 | TRX-F, thioredoxin F-type, chloroplast; protein-pr | 99.09 | |
| 3ewl_A | 142 | Uncharacterized conserved protein BF1870; alpha-be | 99.08 | |
| 2qc7_A | 240 | ERP31, ERP28, endoplasmic reticulum protein ERP29; | 99.08 | |
| 2qgv_A | 140 | Hydrogenase-1 operon protein HYAE; alpha-beta prot | 99.08 | |
| 2av4_A | 160 | Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECI | 99.08 | |
| 3eur_A | 142 | Uncharacterized protein; PSI2,MCSG, conserved prot | 99.07 | |
| 3m9j_A | 105 | Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} | 99.07 | |
| 1syr_A | 112 | Thioredoxin; SGPP, structural genomics, PSI, prote | 99.07 | |
| 3d6i_A | 112 | Monothiol glutaredoxin-3; thioredoxin-like, electr | 99.06 | |
| 3f3q_A | 109 | Thioredoxin-1; His TAG, electron transport, cytopl | 99.06 | |
| 2vim_A | 104 | Thioredoxin, TRX; thioredoxin fold, oxidoreductase | 99.05 | |
| 3fkf_A | 148 | Thiol-disulfide oxidoreductase; structural genomic | 99.05 | |
| 2fgx_A | 107 | Putative thioredoxin; NET3, NESG, GFT-glutaredoxin | 99.05 | |
| 2j23_A | 121 | Thioredoxin; immune protein, autoreactivity, cross | 99.05 | |
| 2b1k_A | 168 | Thiol:disulfide interchange protein DSBE; C-termin | 99.04 | |
| 3lwa_A | 183 | Secreted thiol-disulfide isomerase; thioredoxin, P | 99.04 | |
| 2xc2_A | 117 | Thioredoxinn; oxidoreductase, protein disulfide re | 99.03 | |
| 2l6c_A | 110 | Thioredoxin; oxidoreductase; NMR {Desulfovibrio vu | 99.03 | |
| 3gl3_A | 152 | Putative thiol:disulfide interchange protein DSBE; | 99.03 | |
| 1hyu_A | 521 | AHPF, alkyl hydroperoxide reductase subunit F; thi | 99.03 | |
| 2es7_A | 142 | Q8ZP25_salty, putative thiol-disulfide isomerase a | 99.03 | |
| 3kcm_A | 154 | Thioredoxin family protein; SGX, thioredoxin prote | 99.03 | |
| 2lrn_A | 152 | Thiol:disulfide interchange protein; structural ge | 99.03 | |
| 3hcz_A | 148 | Possible thiol-disulfide isomerase; APC61559.2, cy | 99.02 | |
| 1ttz_A | 87 | Conserved hypothetical protein; structural genomic | 99.01 | |
| 3ira_A | 173 | Conserved protein; methanosarcina mazei,structural | 99.01 | |
| 3gix_A | 149 | Thioredoxin-like protein 4B; PRE-mRNA splicing, TX | 99.0 | |
| 1faa_A | 124 | Thioredoxin F; electron transport; 1.85A {Spinacia | 98.99 | |
| 3hdc_A | 158 | Thioredoxin family protein; ATCC53774, DSM 7210, , | 98.99 | |
| 3ha9_A | 165 | Uncharacterized thioredoxin-like protein; PSI, MCS | 98.98 | |
| 1kng_A | 156 | Thiol:disulfide interchange protein CYCY; thioredo | 98.97 | |
| 1xfl_A | 124 | Thioredoxin H1; AT3G51030, structural genomics, pr | 98.96 | |
| 2oe3_A | 114 | Thioredoxin-3; electron transport, alpha/beta sand | 98.93 | |
| 1ti3_A | 113 | Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Popul | 98.92 | |
| 3emx_A | 135 | Thioredoxin; structural genomics, oxidoreductase, | 98.91 | |
| 2dj0_A | 137 | Thioredoxin-related transmembrane protein 2; AVLA2 | 98.91 | |
| 2yj7_A | 106 | LPBCA thioredoxin; oxidoreductase; 1.65A {Syntheti | 98.41 | |
| 2vm1_A | 118 | Thioredoxin, thioredoxin H isoform 1.; oxidoreduct | 98.88 | |
| 1qgv_A | 142 | Spliceosomal protein U5-15KD; snRNP, thioredoxin, | 98.88 | |
| 1zma_A | 118 | Bacterocin transport accessory protein; alpha-beta | 98.87 | |
| 3kp9_A | 291 | Vkorc1/thioredoxin domain protein; warfarin, disul | 98.87 | |
| 2ywi_A | 196 | Hypothetical conserved protein; uncharacterized co | 98.87 | |
| 2lrt_A | 152 | Uncharacterized protein; structural genomics, thio | 98.87 | |
| 3d22_A | 139 | TRXH4, thioredoxin H-type; electron transport, cyt | 98.87 | |
| 1i5g_A | 144 | Tryparedoxin II; electron transport; HET: TS5; 1.4 | 98.86 | |
| 3qcp_A | 470 | QSOX from trypanosoma brucei (tbqsox); ERV fold, t | 98.86 | |
| 2hyx_A | 352 | Protein DIPZ; thioredoxin fold, jelly-roll, struct | 98.86 | |
| 3cxg_A | 133 | Putative thioredoxin; malaria, structural GEN oxid | 98.85 | |
| 1fo5_A | 85 | Thioredoxin; disulfide oxidoreductase, structural | 98.84 | |
| 3s9f_A | 165 | Tryparedoxin; thioredoxin fold, disulfide reductas | 98.84 | |
| 1o8x_A | 146 | Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrot | 98.83 | |
| 2f51_A | 118 | Thioredoxin; electron transport; 1.90A {Trichomona | 98.83 | |
| 2dbc_A | 135 | PDCL2, unnamed protein product; phosducin-like pro | 98.8 | |
| 3kh7_A | 176 | Thiol:disulfide interchange protein DSBE; TRX-like | 98.8 | |
| 1o73_A | 144 | Tryparedoxin; electron transport, trypanosomatid, | 98.8 | |
| 3fw2_A | 150 | Thiol-disulfide oxidoreductase; structural genomic | 98.79 | |
| 2cvb_A | 188 | Probable thiol-disulfide isomerase/thioredoxin; re | 98.78 | |
| 1nho_A | 85 | Probable thioredoxin; beta sheet, alpha helix, oxi | 98.77 | |
| 2dlx_A | 153 | UBX domain-containing protein 7; UAS domain, prote | 98.76 | |
| 3evi_A | 118 | Phosducin-like protein 2; alpha beta, 3-layer(ABA) | 98.75 | |
| 2kuc_A | 130 | Putative disulphide-isomerase; structural genomics | 98.75 | |
| 3u5r_E | 218 | Uncharacterized protein; structural genomics, PSI- | 98.73 | |
| 1wou_A | 123 | Thioredoxin -related protein, 14 kDa; electron tra | 98.72 | |
| 4fo5_A | 143 | Thioredoxin-like protein; AHPC/TSA family protein, | 98.72 | |
| 1wmj_A | 130 | Thioredoxin H-type; structural genomics, program f | 98.7 | |
| 2ls5_A | 159 | Uncharacterized protein; structural genomics, unkn | 98.16 | |
| 3fk8_A | 133 | Disulphide isomerase; APC61824.1, xylella fastidio | 98.68 | |
| 3cmi_A | 171 | Peroxiredoxin HYR1; thioredoxin-like fold, oxidore | 98.67 | |
| 3dwv_A | 187 | Glutathione peroxidase-like protein; alpha beta, 3 | 98.66 | |
| 2fwh_A | 134 | Thiol:disulfide interchange protein DSBD; thioredo | 98.66 | |
| 1wjk_A | 100 | C330018D20RIK protein; glutaredoxin, thioredoxin f | 98.66 | |
| 2p5q_A | 170 | Glutathione peroxidase 5; thioredoxin fold, oxidor | 98.66 | |
| 2k6v_A | 172 | Putative cytochrome C oxidase assembly protein; th | 98.66 | |
| 2vup_A | 190 | Glutathione peroxidase-like protein; oxidoreductas | 98.64 | |
| 2lus_A | 143 | Thioredoxion; CR-Trp16, oxidoreductase; NMR {Carci | 98.08 | |
| 2ggt_A | 164 | SCO1 protein homolog, mitochondrial; copper chaper | 98.62 | |
| 2v1m_A | 169 | Glutathione peroxidase; selenium, selenocysteine, | 98.61 | |
| 3drn_A | 161 | Peroxiredoxin, bacterioferritin comigratory prote | 98.6 | |
| 2e7p_A | 116 | Glutaredoxin; thioredoxin fold, poplar, electron t | 98.6 | |
| 2rli_A | 171 | SCO2 protein homolog, mitochondrial; copper protei | 98.6 | |
| 2trc_P | 217 | Phosducin, MEKA, PP33; transducin, beta-gamma, sig | 98.58 | |
| 2obi_A | 183 | PHGPX, GPX-4, phospholipid hydroperoxide glutathio | 98.56 | |
| 2f8a_A | 208 | Glutathione peroxidase 1; thioredoxin fold, struct | 98.55 | |
| 2k8s_A | 80 | Thioredoxin; dimer, structural genomics, PSI-2, pr | 98.51 | |
| 2p31_A | 181 | CL683, glutathione peroxidase 7; thioredoxin fold, | 98.51 | |
| 1a0r_P | 245 | Phosducin, MEKA, PP33; transducin, beta-gamma, sig | 98.51 | |
| 1hyu_A | 521 | AHPF, alkyl hydroperoxide reductase subunit F; thi | 98.5 | |
| 2b5x_A | 148 | YKUV protein, TRXY; thioredoxin-like, oxidoreducta | 98.49 | |
| 2lst_A | 130 | Thioredoxin; structural genomics, NEW YORK structu | 97.87 | |
| 1lu4_A | 136 | Soluble secreted antigen MPT53; thioredoxin-like f | 98.48 | |
| 3kij_A | 180 | Probable glutathione peroxidase 8; human PDI-perox | 98.46 | |
| 1xvw_A | 160 | Hypothetical protein RV2238C/MT2298; thioredoxin f | 98.46 | |
| 1ego_A | 85 | Glutaredoxin; electron transport; NMR {Escherichia | 98.45 | |
| 2bmx_A | 195 | Alkyl hydroperoxidase C; peroxiredoxin, antioxidan | 98.42 | |
| 1zzo_A | 136 | RV1677; thioredoxin fold, structural genomics, PSI | 98.4 | |
| 1we0_A | 187 | Alkyl hydroperoxide reductase C; peroxiredoxin, AH | 98.39 | |
| 2gs3_A | 185 | PHGPX, GPX-4, phospholipid hydroperoxide glutathio | 98.38 | |
| 2ju5_A | 154 | Thioredoxin disulfide isomerase; protein, oxidored | 98.38 | |
| 1zof_A | 198 | Alkyl hydroperoxide-reductase; decamer, toroide-sh | 98.37 | |
| 3or5_A | 165 | Thiol:disulfide interchange protein, thioredoxin p | 98.36 | |
| 3iv4_A | 112 | Putative oxidoreductase; APC23140, meticillin-resi | 98.36 | |
| 3f9u_A | 172 | Putative exported cytochrome C biogenesis-related; | 98.35 | |
| 2f9s_A | 151 | Thiol-disulfide oxidoreductase RESA; thioredoxin-l | 98.32 | |
| 2l5o_A | 153 | Putative thioredoxin; structural genomics, unknown | 98.31 | |
| 3kp8_A | 106 | Vkorc1/thioredoxin domain protein; blood coagulati | 98.29 | |
| 1qmv_A | 197 | Human thioredoxin peroxidase-B; peroxiredoxin, sul | 98.28 | |
| 1xzo_A | 174 | BSSCO, hypothetical protein YPMQ; thioredoxin-like | 98.28 | |
| 1ilo_A | 77 | Conserved hypothetical protein MTH895; beta-alpha- | 98.28 | |
| 3erw_A | 145 | Sporulation thiol-disulfide oxidoreductase A; thio | 98.27 | |
| 3raz_A | 151 | Thioredoxin-related protein; structural genomics, | 98.27 | |
| 1h75_A | 81 | Glutaredoxin-like protein NRDH; electron transport | 98.23 | |
| 1eej_A | 216 | Thiol:disulfide interchange protein; oxidoreductas | 98.21 | |
| 2lja_A | 152 | Putative thiol-disulfide oxidoreductase; structura | 98.2 | |
| 2l4c_A | 124 | Endoplasmic reticulum resident protein 27; ERP27, | 98.19 | |
| 3gyk_A | 175 | 27KDA outer membrane protein; APC61738.2, siliciba | 98.19 | |
| 3fkf_A | 148 | Thiol-disulfide oxidoreductase; structural genomic | 98.17 | |
| 3hcz_A | 148 | Possible thiol-disulfide isomerase; APC61559.2, cy | 98.16 | |
| 1sen_A | 164 | Thioredoxin-like protein P19; endoplasmic reticulu | 98.15 | |
| 1t3b_A | 211 | Thiol:disulfide interchange protein DSBC; oxidored | 98.11 | |
| 1uul_A | 202 | Tryparedoxin peroxidase homologue; peroxiredoxin, | 98.11 | |
| 2lrn_A | 152 | Thiol:disulfide interchange protein; structural ge | 98.1 | |
| 3lor_A | 160 | Thiol-disulfide isomerase and thioredoxins; PSI, M | 98.1 | |
| 2h30_A | 164 | Thioredoxin, peptide methionine sulfoxide reductas | 98.1 | |
| 4evm_A | 138 | Thioredoxin family protein; structural genomics, n | 98.09 | |
| 2b7k_A | 200 | SCO1 protein; metallochaperone, cytochrome C oxida | 98.08 | |
| 3ia1_A | 154 | THIO-disulfide isomerase/thioredoxin; oxidoreducta | 98.08 | |
| 1zye_A | 220 | Thioredoxin-dependent peroxide reductase; catenane | 98.08 | |
| 3ha9_A | 165 | Uncharacterized thioredoxin-like protein; PSI, MCS | 98.08 | |
| 1r7h_A | 75 | NRDH-redoxin; thioredoxin, glutaredoxin, redox pro | 98.07 | |
| 2h01_A | 192 | 2-Cys peroxiredoxin; thioredoxin peroxidase, struc | 98.06 | |
| 3h93_A | 192 | Thiol:disulfide interchange protein DSBA; disulfid | 98.04 | |
| 2i81_A | 213 | 2-Cys peroxiredoxin; structural genomics consortiu | 98.02 | |
| 2jsy_A | 167 | Probable thiol peroxidase; solution structure, ant | 98.0 | |
| 3gl3_A | 152 | Putative thiol:disulfide interchange protein DSBE; | 98.0 | |
| 3ztl_A | 222 | Thioredoxin peroxidase; oxidoreductase, reductase, | 97.99 | |
| 3kcm_A | 154 | Thioredoxin family protein; SGX, thioredoxin prote | 97.96 | |
| 3lwa_A | 183 | Secreted thiol-disulfide isomerase; thioredoxin, P | 97.95 | |
| 1nm3_A | 241 | Protein HI0572; hybrid, peroxiredoxin, glutaredoxi | 97.94 | |
| 1v58_A | 241 | Thiol:disulfide interchange protein DSBG; reduced | 97.93 | |
| 1kng_A | 156 | Thiol:disulfide interchange protein CYCY; thioredo | 97.91 | |
| 3eyt_A | 158 | Uncharacterized protein SPOA0173; thioredoxin-like | 97.9 | |
| 2ywi_A | 196 | Hypothetical conserved protein; uncharacterized co | 97.89 | |
| 3bj5_A | 147 | Protein disulfide-isomerase; thioredoxin fold, cha | 97.89 | |
| 3gkn_A | 163 | Bacterioferritin comigratory protein; BCP, PRX, at | 97.88 | |
| 2i3y_A | 215 | Epididymal secretory glutathione peroxidase; thior | 97.85 | |
| 2b1k_A | 168 | Thiol:disulfide interchange protein DSBE; C-termin | 97.83 | |
| 1xvq_A | 175 | Thiol peroxidase; thioredoxin fold, structural gen | 97.83 | |
| 3dml_A | 116 | Putative uncharacterized protein; thioredoxin, oxi | 97.81 | |
| 3hdc_A | 158 | Thioredoxin family protein; ATCC53774, DSM 7210, , | 97.79 | |
| 2cvb_A | 188 | Probable thiol-disulfide isomerase/thioredoxin; re | 97.76 | |
| 2c0d_A | 221 | Thioredoxin peroxidase 2; peroxiredoxin, 2-Cys, th | 97.72 | |
| 3ira_A | 173 | Conserved protein; methanosarcina mazei,structural | 97.7 | |
| 3me7_A | 170 | Putative uncharacterized protein; electron transfe | 97.69 | |
| 2r37_A | 207 | Glutathione peroxidase 3; plasma, structural genom | 97.69 | |
| 2lrt_A | 152 | Uncharacterized protein; structural genomics, thio | 97.68 | |
| 3fw2_A | 150 | Thiol-disulfide oxidoreductase; structural genomic | 97.68 | |
| 2lqo_A | 92 | Putative glutaredoxin RV3198.1/MT3292; TRX fold, o | 97.66 | |
| 2fgx_A | 107 | Putative thioredoxin; NET3, NESG, GFT-glutaredoxin | 97.65 | |
| 2dlx_A | 153 | UBX domain-containing protein 7; UAS domain, prote | 97.63 | |
| 1jfu_A | 186 | Thiol:disulfide interchange protein TLPA; thioredo | 97.63 | |
| 3kh7_A | 176 | Thiol:disulfide interchange protein DSBE; TRX-like | 97.62 | |
| 3ewl_A | 142 | Uncharacterized conserved protein BF1870; alpha-be | 97.61 | |
| 2hyx_A | 352 | Protein DIPZ; thioredoxin fold, jelly-roll, struct | 97.59 | |
| 1kte_A | 105 | Thioltransferase; redox-active center, electron tr | 97.57 | |
| 2a4v_A | 159 | Peroxiredoxin DOT5; yeast nuclear thiol peroxidase | 97.57 | |
| 3nzn_A | 103 | Glutaredoxin; structural genomics, PSI2, MCSG, pro | 97.56 | |
| 1ttz_A | 87 | Conserved hypothetical protein; structural genomic | 97.56 | |
| 1z6n_A | 167 | Hypothetical protein PA1234; alpha-beta-alpha sand | 97.56 | |
| 3kp9_A | 291 | Vkorc1/thioredoxin domain protein; warfarin, disul | 97.53 | |
| 3hd5_A | 195 | Thiol:disulfide interchange protein DSBA; protein | 97.53 | |
| 2pn8_A | 211 | Peroxiredoxin-4; thioredoxin, oxidoreductase, stru | 97.52 | |
| 2hze_A | 114 | Glutaredoxin-1; thioredoxin fold, arsenic, dimethy | 97.5 | |
| 3u5r_E | 218 | Uncharacterized protein; structural genomics, PSI- | 97.49 | |
| 2cq9_A | 130 | GLRX2 protein, glutaredoxin 2; glutathione-S-trans | 97.46 | |
| 3qmx_A | 99 | Glutaredoxin A, glutaredoxin 3; electron transport | 97.44 | |
| 3ic4_A | 92 | Glutaredoxin (GRX-1); structural genomics, PSI, MC | 97.44 | |
| 3s9f_A | 165 | Tryparedoxin; thioredoxin fold, disulfide reductas | 97.44 | |
| 2ec4_A | 178 | FAS-associated factor 1; UAS domain, protein FAF1, | 97.43 | |
| 1i5g_A | 144 | Tryparedoxin II; electron transport; HET: TS5; 1.4 | 97.42 | |
| 3a2v_A | 249 | Probable peroxiredoxin; thioredoxin peroxidase, hy | 97.4 | |
| 3hz8_A | 193 | Thiol:disulfide interchange protein DSBA; thiol-ox | 97.4 | |
| 2znm_A | 195 | Thiol:disulfide interchange protein DSBA; thioredo | 97.39 | |
| 3ph9_A | 151 | Anterior gradient protein 3 homolog; thioredoxin f | 97.38 | |
| 1n8j_A | 186 | AHPC, alkyl hydroperoxide reductase C22 protein; p | 97.36 | |
| 1o8x_A | 146 | Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrot | 97.35 | |
| 3eur_A | 142 | Uncharacterized protein; PSI2,MCSG, conserved prot | 97.34 | |
| 1o73_A | 144 | Tryparedoxin; electron transport, trypanosomatid, | 97.33 | |
| 2ht9_A | 146 | Glutaredoxin-2; thioredoxin fold, iron-sulfur clus | 97.32 | |
| 3qpm_A | 240 | Peroxiredoxin; oxidoreductase, thioredoxin fold, p | 97.29 | |
| 2ggt_A | 164 | SCO1 protein homolog, mitochondrial; copper chaper | 97.27 | |
| 3cmi_A | 171 | Peroxiredoxin HYR1; thioredoxin-like fold, oxidore | 97.23 | |
| 1fov_A | 82 | Glutaredoxin 3, GRX3; active site disulfide, CIS P | 97.21 | |
| 2rli_A | 171 | SCO2 protein homolog, mitochondrial; copper protei | 97.19 | |
| 2klx_A | 89 | Glutaredoxin; thioredoxin type domain, ssgcid, ele | 97.19 | |
| 2vup_A | 190 | Glutathione peroxidase-like protein; oxidoreductas | 97.19 | |
| 3gv1_A | 147 | Disulfide interchange protein; neisseria gonorrhoe | 97.14 | |
| 3c1r_A | 118 | Glutaredoxin-1; oxidized form, oxidoreductase, cyt | 97.13 | |
| 2bmx_A | 195 | Alkyl hydroperoxidase C; peroxiredoxin, antioxidan | 97.11 | |
| 4hde_A | 170 | SCO1/SENC family lipoprotein; structural genomics, | 97.1 | |
| 4g2e_A | 157 | Peroxiredoxin; redox protein, structural genomics, | 97.09 | |
| 2yan_A | 105 | Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {H | 97.07 | |
| 2p5q_A | 170 | Glutathione peroxidase 5; thioredoxin fold, oxidor | 97.06 | |
| 2khp_A | 92 | Glutaredoxin; thioredoxin type domain, ssgcid, ele | 97.06 | |
| 3tjj_A | 254 | Peroxiredoxin-4; thioredoxin fold, sulfenylation, | 96.99 | |
| 3l9v_A | 189 | Putative thiol-disulfide isomerase or thioredoxin; | 96.98 | |
| 2v1m_A | 169 | Glutathione peroxidase; selenium, selenocysteine, | 96.97 | |
| 3ixr_A | 179 | Bacterioferritin comigratory protein; alpha beta p | 96.91 | |
| 3dwv_A | 187 | Glutathione peroxidase-like protein; alpha beta, 3 | 96.9 | |
| 2k6v_A | 172 | Putative cytochrome C oxidase assembly protein; th | 96.89 | |
| 4fo5_A | 143 | Thioredoxin-like protein; AHPC/TSA family protein, | 96.87 | |
| 1q98_A | 165 | Thiol peroxidase, TPX; structural genomics, NYSGXR | 96.87 | |
| 3drn_A | 161 | Peroxiredoxin, bacterioferritin comigratory prote | 96.86 | |
| 3rhb_A | 113 | ATGRXC5, glutaredoxin-C5, chloroplastic; thioredox | 96.84 | |
| 3msz_A | 89 | Glutaredoxin 1; alpha-beta sandwich, center for st | 96.84 | |
| 2k8s_A | 80 | Thioredoxin; dimer, structural genomics, PSI-2, pr | 96.8 | |
| 2ls5_A | 159 | Uncharacterized protein; structural genomics, unkn | 95.84 | |
| 2wfc_A | 167 | Peroxiredoxin 5, PRDX5; oxidoreductase, antioxidan | 96.79 | |
| 1wjk_A | 100 | C330018D20RIK protein; glutaredoxin, thioredoxin f | 96.77 | |
| 2yzh_A | 171 | Probable thiol peroxidase; redox protein, antioxid | 96.77 | |
| 1psq_A | 163 | Probable thiol peroxidase; structural genomics, NY | 96.76 | |
| 1tp9_A | 162 | Peroxiredoxin, PRX D (type II); oligomer, thioredo | 96.73 | |
| 1zof_A | 198 | Alkyl hydroperoxide-reductase; decamer, toroide-sh | 96.68 | |
| 2p31_A | 181 | CL683, glutathione peroxidase 7; thioredoxin fold, | 96.64 | |
| 4gqc_A | 164 | Thiol peroxidase, peroxiredoxin Q; CXXXXC motif, f | 96.63 | |
| 1we0_A | 187 | Alkyl hydroperoxide reductase C; peroxiredoxin, AH | 96.61 | |
| 2lus_A | 143 | Thioredoxion; CR-Trp16, oxidoreductase; NMR {Carci | 95.62 | |
| 1wik_A | 109 | Thioredoxin-like protein 2; picot homology 2 domai | 96.59 | |
| 2pwj_A | 171 | Mitochondrial peroxiredoxin; alpha and beta protei | 96.5 | |
| 1xvw_A | 160 | Hypothetical protein RV2238C/MT2298; thioredoxin f | 96.48 | |
| 3feu_A | 185 | Putative lipoprotein; alpha-beta structure, struct | 96.47 | |
| 1nm3_A | 241 | Protein HI0572; hybrid, peroxiredoxin, glutaredoxi | 96.46 | |
| 3h8q_A | 114 | Thioredoxin reductase 3; oxidoreductase, structura | 96.46 | |
| 3zrd_A | 200 | Thiol peroxidase; oxidoreductase, 2Cys peroxiredox | 96.37 | |
| 3uma_A | 184 | Hypothetical peroxiredoxin protein; nysgrc, PSI bi | 96.31 | |
| 3kij_A | 180 | Probable glutathione peroxidase 8; human PDI-perox | 96.29 | |
| 2f8a_A | 208 | Glutathione peroxidase 1; thioredoxin fold, struct | 96.19 | |
| 2obi_A | 183 | PHGPX, GPX-4, phospholipid hydroperoxide glutathio | 96.14 | |
| 3gyk_A | 175 | 27KDA outer membrane protein; APC61738.2, siliciba | 96.14 | |
| 1z6m_A | 175 | Conserved hypothetical protein; structural genomic | 96.08 | |
| 2e7p_A | 116 | Glutaredoxin; thioredoxin fold, poplar, electron t | 96.05 | |
| 1un2_A | 197 | DSBA, thiol-disulfide interchange protein; disulfi | 96.01 | |
| 3ctg_A | 129 | Glutaredoxin-2; reduced form, electron transport, | 96.01 | |
| 2gs3_A | 185 | PHGPX, GPX-4, phospholipid hydroperoxide glutathio | 95.99 | |
| 1qmv_A | 197 | Human thioredoxin peroxidase-B; peroxiredoxin, sul | 95.96 | |
| 3p7x_A | 166 | Probable thiol peroxidase; thioredoxin fold, oxido | 95.89 | |
| 2rem_A | 193 | Disulfide oxidoreductase; disulfide oxidoreductase | 95.88 | |
| 1ego_A | 85 | Glutaredoxin; electron transport; NMR {Escherichia | 95.87 | |
| 3mng_A | 173 | Peroxiredoxin-5, mitochondrial; peroxidase, PRXV, | 95.85 | |
| 1uul_A | 202 | Tryparedoxin peroxidase homologue; peroxiredoxin, | 95.85 | |
| 1zye_A | 220 | Thioredoxin-dependent peroxide reductase; catenane | 95.58 | |
| 2i81_A | 213 | 2-Cys peroxiredoxin; structural genomics consortiu | 95.52 | |
| 3l9s_A | 191 | Thiol:disulfide interchange protein; thioredoxin-f | 95.51 | |
| 1xzo_A | 174 | BSSCO, hypothetical protein YPMQ; thioredoxin-like | 95.48 | |
| 2b7k_A | 200 | SCO1 protein; metallochaperone, cytochrome C oxida | 95.47 | |
| 2v2g_A | 233 | Peroxiredoxin 6; oxidoreductase, antioxidant enzym | 95.38 | |
| 1prx_A | 224 | HORF6; peroxiredoxin, hydrogen peroxide, redox reg | 95.38 | |
| 2h01_A | 192 | 2-Cys peroxiredoxin; thioredoxin peroxidase, struc | 95.33 | |
| 2jsy_A | 167 | Probable thiol peroxidase; solution structure, ant | 95.21 | |
| 3gx8_A | 121 | Monothiol glutaredoxin-5, mitochondrial; TRX fold, | 94.98 | |
| 2wci_A | 135 | Glutaredoxin-4; redox-active center, iron-sulfur c | 94.95 | |
| 1eej_A | 216 | Thiol:disulfide interchange protein; oxidoreductas | 94.78 | |
| 2ct6_A | 111 | SH3 domain-binding glutamic acid-rich-like protein | 94.78 | |
| 1aba_A | 87 | Glutaredoxin; electron transport; HET: MES; 1.45A | 94.73 | |
| 3zyw_A | 111 | Glutaredoxin-3; metal binding protein; 1.84A {Homo | 94.71 | |
| 1xcc_A | 220 | 1-Cys peroxiredoxin; unknown function, structural | 94.63 | |
| 3ipz_A | 109 | Monothiol glutaredoxin-S14, chloroplastic; electro | 94.56 | |
| 3ztl_A | 222 | Thioredoxin peroxidase; oxidoreductase, reductase, | 94.45 | |
| 3c7m_A | 195 | Thiol:disulfide interchange protein DSBA-like; red | 94.34 | |
| 1t1v_A | 93 | SH3BGRL3, SH3 domain-binding glutamic acid-rich pr | 94.25 | |
| 2wem_A | 118 | Glutaredoxin-related protein 5; chromosome 14 open | 94.2 | |
| 1t3b_A | 211 | Thiol:disulfide interchange protein DSBC; oxidored | 94.15 | |
| 4dvc_A | 184 | Thiol:disulfide interchange protein DSBA; pilus as | 93.78 | |
| 3gkn_A | 163 | Bacterioferritin comigratory protein; BCP, PRX, at | 93.76 | |
| 1xvq_A | 175 | Thiol peroxidase; thioredoxin fold, structural gen | 93.28 | |
| 2axo_A | 270 | Hypothetical protein ATU2684; alpha beta protein., | 93.26 | |
| 1h75_A | 81 | Glutaredoxin-like protein NRDH; electron transport | 92.79 | |
| 1v58_A | 241 | Thiol:disulfide interchange protein DSBG; reduced | 92.72 | |
| 1r7h_A | 75 | NRDH-redoxin; thioredoxin, glutaredoxin, redox pro | 92.58 | |
| 3h93_A | 192 | Thiol:disulfide interchange protein DSBA; disulfid | 91.91 | |
| 3gha_A | 202 | Disulfide bond formation protein D; BDBD, DSBA-lik | 91.75 | |
| 3sbc_A | 216 | Peroxiredoxin TSA1; alpha-beta fold, peroxidase, c | 91.74 | |
| 4f82_A | 176 | Thioredoxin reductase; structural genomics, niaid, | 91.48 | |
| 2i3y_A | 215 | Epididymal secretory glutathione peroxidase; thior | 91.46 | |
| 2wul_A | 118 | Glutaredoxin related protein 5; chromosome 14 open | 90.69 | |
| 1kte_A | 105 | Thioltransferase; redox-active center, electron tr | 90.57 | |
| 3bci_A | 186 | Disulfide bond protein A; thiol-disulfide oxidored | 90.54 | |
| 2a4v_A | 159 | Peroxiredoxin DOT5; yeast nuclear thiol peroxidase | 90.48 | |
| 3l4n_A | 127 | Monothiol glutaredoxin-6; C-terminal domain of GRX | 90.31 | |
| 3a2v_A | 249 | Probable peroxiredoxin; thioredoxin peroxidase, hy | 90.26 | |
| 2r37_A | 207 | Glutathione peroxidase 3; plasma, structural genom | 89.67 | |
| 2yzh_A | 171 | Probable thiol peroxidase; redox protein, antioxid | 89.51 | |
| 3f4s_A | 226 | Alpha-DSBA1, putative uncharacterized protein; thi | 89.4 | |
| 1q98_A | 165 | Thiol peroxidase, TPX; structural genomics, NYSGXR | 89.12 | |
| 3gn3_A | 182 | Putative protein-disulfide isomerase; MCSG, PSI, s | 88.69 | |
| 1u6t_A | 121 | SH3 domain-binding glutamic acid-rich-like protein | 88.65 | |
| 1psq_A | 163 | Probable thiol peroxidase; structural genomics, NY | 88.54 | |
| 3ixr_A | 179 | Bacterioferritin comigratory protein; alpha beta p | 88.48 |
| >3uem_A Protein disulfide-isomerase; thioredoxin-like domain, chaper; 2.29A {Homo sapiens} PDB: 2k18_A 1x5c_A 1bjx_A 2bjx_A | Back alignment and structure |
|---|
Probab=100.00 E-value=2.9e-56 Score=407.90 Aligned_cols=332 Identities=29% Similarity=0.532 Sum_probs=298.0
Q ss_pred ccCCHHHHHHHhhhCCeEEEEEecCCCCccHHHHHHHHhcCCCceEEEeccHHHHHHcCCCCCCCCCEEEEEecCCCCcc
Q 018164 2 RTNTVNEAEEFLKKYQTFVLGMFKKFEGSDYEEFVKTAAADNEIQFVETSNFEVAKVLYPDIKSTDHFLGIVKSEPDRYT 81 (360)
Q Consensus 2 ~i~s~~~~~~~~~~~~~~vv~ff~~~~~~~~~~f~~~a~~~~~~~F~~~~~~~~~~~~~~~~~~~~p~i~~~~~~~~~~~ 81 (360)
+|+|.+++++|++.++++|||||++.+++..+.|.++|+..+++.|++++++++|++++++ .|+|++||++++...
T Consensus 21 ~l~~~~~~~~~~~~~~~~vvgff~~~~~~~~~~f~~~A~~~~~~~F~~t~~~~v~~~~~v~----~~~i~lfk~f~~~~~ 96 (361)
T 3uem_A 21 TLPDGAAAESLVESSEVAVIGFFKDVESDSAKQFLQAAEAIDDIPFGITSNSDVFSKYQLD----KDGVVLFKKFDEGRN 96 (361)
T ss_dssp ECCSHHHHHHHHHTSSEEEEEECSCTTSHHHHHHHHHHHHCSSSCEEEECCHHHHHHTTCS----SSEEEEEESSTTSEE
T ss_pred ecCCHHHHHHHHhcCCcEEEEEEcCCCchHHHHHHHHHhcCCCceEEEECcHHHHHHhCCC----CCeEEEEEecCCCcc
Confidence 4789999999999999999999999999999999999955589999999999999999996 599999999888889
Q ss_pred ccCCCCChHHHHHHHhhccCCceeecCcccccccccCCCc-eEEEEEEec-cchHHHHHHHHHHHHhhcCceEEEEEeCC
Q 018164 82 GYEETFIMDKILQFLNYNKFPLVTKLTDINSASVHSSPIK-LQVYVFAKA-DDLKSLLEPLEDIARNFKGKIMFTAVDIA 159 (360)
Q Consensus 82 ~y~g~~~~~~l~~fi~~~~~p~v~~l~~~~~~~~~~~~~~-~~v~f~~~~-~~~~~~~~~~~~la~~~~~~i~f~~vd~~ 159 (360)
.|+|+++.++|.+||+.++.|+|.+++++++..++..+.+ ++++||++| ++|+++.+.|+++|+++++++.|+.+||+
T Consensus 97 ~~~g~~~~~~i~~fi~~~~~p~v~~~~~~~~~~~~~~~~~~~~v~F~~~~~~~~~~~~~~~~~~A~~~~~~i~f~~vd~~ 176 (361)
T 3uem_A 97 NFEGEVTKENLLDFIKHNQLPLVIEFTEQTAPKIFGGEIKTHILLFLPKSVSDYDGKLSNFKTAAESFKGKILFIFIDSD 176 (361)
T ss_dssp ECCSCCCHHHHHHHHHHHSSCSEEECSTTTHHHHHSCSCCEEEEEECCSSSSSHHHHHHHHHHHHGGGTTTCEEEEECTT
T ss_pred ccCCcCCHHHHHHHHHHcCCCcceecCcccHHHHhcCCCCcEEEEEEeCCchhHHHHHHHHHHHHHHccCceEEEEecCC
Confidence 9999999999999999999999999999999998877654 567788888 89999999999999999999999999999
Q ss_pred CcccchhHHhhcCCCC--CCCceEEEEeCCCcccccCC-CCCCHHHHHHHHHHHhcCccCCccccCCCCCC-CCCceEEE
Q 018164 160 DEDLAKPFLTLFGLEE--SKNTVVTAFDNKAISKFLLE-SDLTPSNIEEFCSRLLHGTLTPYLKSQPIPDN-TNANVQIV 235 (360)
Q Consensus 160 ~~~~~~~l~~~~gi~~--~~p~~~~~~~~~~~~~y~~~-~~~~~~~i~~fi~~~~~g~~~~~~~se~~p~~-~~~~v~~l 235 (360)
... ..++|+.|||+. + |+++++..++...+|.+. +.++.+.|.+|++++++|+++|..+|+++|+. ..+.|..+
T Consensus 177 ~~~-~~~~~~~fgi~~~~~-P~~~~~~~~~~~~ky~~~~~~~~~~~l~~fi~~~l~g~~~~~~~s~~~p~~~~~~~v~~l 254 (361)
T 3uem_A 177 HTD-NQRILEFFGLKKEEC-PAVRLITLEEEMTKYKPESEELTAERITEFCHRFLEGKIKPHLMSQELPEDWDKQPVKVL 254 (361)
T ss_dssp SGG-GHHHHHHTTCCTTTC-SEEEEEECC--CCEECCSSCCCCHHHHHHHHHHHHTTCSCCCCBCCCCCTTTTTSSSEEE
T ss_pred hHH-HHHHHHHcCCCccCC-ccEEEEEcCCcccccCCCccccCHHHHHHHHHHHhcCCCcccccCCCCCcccccCCcEEe
Confidence 321 148999999996 6 888544433555678764 67999999999999999999999999999987 47889999
Q ss_pred cCccccccccccCccEEEEEeCCCChhhHHHHHHHHHHHHHhcCCCCEEEEEEeCCCCCCCCCCCCCCcEEEEEeCCCcc
Q 018164 236 VGKTFDDLVLNSHKDVLLEVYTPWCVTCETTSKQIEKLAKHFKGLDNLVIAKIDASANEHPKLQVEEYPTLLFYPAGDKA 315 (360)
Q Consensus 236 ~~~~~~~~~~~~~~~~~v~f~~~~c~~c~~~~~~~~~la~~~~~~~~~~~~~id~~~~~~~~~~i~~~Pti~~~~~g~~~ 315 (360)
++++|++.+.+++++++|+||||||++|+.+.|.|+++++.+++..++.++.+|++.+....++|.++||+++|++|...
T Consensus 255 ~~~~f~~~~~~~~k~~lv~f~a~wC~~C~~~~p~~~~la~~~~~~~~v~~~~vd~~~~~~~~~~v~~~Pt~~~~~~~~~~ 334 (361)
T 3uem_A 255 VGKNFEDVAFDEKKNVFVEFYAPWCGHCKQLAPIWDKLGETYKDHENIVIAKMDSTANEVEAVKVHSFPTLKFFPASADR 334 (361)
T ss_dssp CTTTHHHHHTCTTCEEEEEEECTTCHHHHHHHHHHHHHHHHTTTCSSEEEEEEETTTCBCSSCCCCSSSEEEEECSSSSC
T ss_pred ecCchhhhcccCCCcEEEEEecCcCHhHHHHHHHHHHHHHHhccCCcEEEEEEECCccchhhcCCcccCeEEEEECCCCc
Confidence 99999999988899999999999999999999999999999987667999999999998888999999999999887544
Q ss_pred CceEecCCCCHHHHHHHHHHhcCC
Q 018164 316 NPIKVSARSSSKNIAAFIKEQLKE 339 (360)
Q Consensus 316 ~~~~~~g~~~~~~l~~~i~~~~~~ 339 (360)
.+.+|.|.++.+.|.+||+++.+.
T Consensus 335 ~~~~~~G~~~~~~l~~~l~~~~~~ 358 (361)
T 3uem_A 335 TVIDYNGERTLDGFKKFLESGGQD 358 (361)
T ss_dssp CCEECCSCSSHHHHHHHHTTTSCS
T ss_pred ceeEecCCCCHHHHHHHHHhcCCC
Confidence 578999999999999999988764
|
| >3f8u_A Protein disulfide-isomerase A3ERP57; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} PDB: 2dmm_A 2alb_A | Back alignment and structure |
|---|
| >2b5e_A Protein disulfide-isomerase; 2.40A {Saccharomyces cerevisiae} SCOP: c.47.1.2 c.47.1.2 c.47.1.2 c.47.1.2 PDB: 3boa_A | Back alignment and structure |
|---|
| >3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} | Back alignment and structure |
|---|
| >3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} | Back alignment and structure |
|---|
| >3ec3_A Protein disulfide-isomerase A4; thioredoxin-like fold, endoplasmic reticulum, glycoprotein, redox-active center; 1.92A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2h8l_A Protein disulfide-isomerase A3; thioredoxin-like fold; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4f9z_D Endoplasmic reticulum resident protein 27; thioredoxin fold, ER foldase, ERP57, binding protein; HET: PE3 PE4; 2.20A {Homo sapiens} PDB: 2l4c_A | Back alignment and structure |
|---|
| >3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A | Back alignment and structure |
|---|
| >1sji_A Calsequestrin 2, calsequestrin, cardiac muscle isoform; glycoprotein, calcium-binding, muscle protein, metal binding protein; 2.40A {Canis lupus familiaris} PDB: 2vaf_A | Back alignment and structure |
|---|
| >3us3_A Calsequestrin-1; calcium-binding protein; 1.74A {Oryctolagus cuniculus} PDB: 1a8y_A 3v1w_A* 3trq_A* 3trp_A* 3uom_A | Back alignment and structure |
|---|
| >3us3_A Calsequestrin-1; calcium-binding protein; 1.74A {Oryctolagus cuniculus} PDB: 1a8y_A 3v1w_A* 3trq_A* 3trp_A* 3uom_A | Back alignment and structure |
|---|
| >2r2j_A Thioredoxin domain-containing protein 4; CRFS motif, chaperone, endoplasmic reticulum, S response; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1sji_A Calsequestrin 2, calsequestrin, cardiac muscle isoform; glycoprotein, calcium-binding, muscle protein, metal binding protein; 2.40A {Canis lupus familiaris} PDB: 2vaf_A | Back alignment and structure |
|---|
| >1a8l_A Protein disulfide oxidoreductase; PDI, thioredoxin fold; 1.90A {Pyrococcus furiosus} SCOP: c.47.1.2 c.47.1.2 PDB: 1j08_A | Back alignment and structure |
|---|
| >2ywm_A Glutaredoxin-like protein; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 2.30A {Aquifex aeolicus} PDB: 2ayt_A | Back alignment and structure |
|---|
| >2r2j_A Thioredoxin domain-containing protein 4; CRFS motif, chaperone, endoplasmic reticulum, S response; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2hls_A Protein disulfide oxidoreductase; thioredoxin fold; 1.93A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3f8u_A Protein disulfide-isomerase A3ERP57; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} PDB: 2dmm_A 2alb_A | Back alignment and structure |
|---|
| >3h79_A Thioredoxin-like protein; thioredoxin fold, catalytic cysteines missing, unknown funct; 1.50A {Trypanosoma cruzi} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >2djj_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp1_A | Back alignment and structure |
|---|
| >2djk_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp2_A | Back alignment and structure |
|---|
| >3bj5_A Protein disulfide-isomerase; thioredoxin fold, chaperone, endoplasmic reticulum, isomeras membrane, redox-active center; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A | Back alignment and structure |
|---|
| >2b5e_A Protein disulfide-isomerase; 2.40A {Saccharomyces cerevisiae} SCOP: c.47.1.2 c.47.1.2 c.47.1.2 c.47.1.2 PDB: 3boa_A | Back alignment and structure |
|---|
| >2dj3_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1a8l_A Protein disulfide oxidoreductase; PDI, thioredoxin fold; 1.90A {Pyrococcus furiosus} SCOP: c.47.1.2 c.47.1.2 PDB: 1j08_A | Back alignment and structure |
|---|
| >3ed3_A Protein disulfide-isomerase MPD1; thioredoxin-like domain, CXXC, endoplasmic reticulum, glycoprotein, redox-active center; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3zzx_A Thioredoxin; oxidoreductase; 1.88A {Litopenaeus vannamei} | Back alignment and structure |
|---|
| >3uem_A Protein disulfide-isomerase; thioredoxin-like domain, chaper; 2.29A {Homo sapiens} PDB: 2k18_A 1x5c_A 1bjx_A 2bjx_A | Back alignment and structure |
|---|
| >2trx_A Thioredoxin; electron transport; 1.68A {Escherichia coli} SCOP: c.47.1.1 PDB: 1skr_B* 1skw_B* 1sl0_B* 1sks_B* 1sl2_B* 1t7p_B* 1t8e_B* 1tk0_B* 1tk5_B* 1tk8_B* 1tkd_B* 1sl1_B* 1x9s_B* 1x9w_B* 1xoa_A 1xob_A 1zyq_B* 2ajq_B* 2bto_T* 2h6x_A ... | Back alignment and structure |
|---|
| >3gnj_A Thioredoxin domain protein; APC92103, STR genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.99A {Desulfitobacterium hafniense dcb-2} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >2qsi_A Putative hydrogenase expression/formation protein; HUPG, MCS SAD, structural genomics, protein structure initiative; 1.80A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >2av4_A Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECIFIC 15KD prote structural genomics, structural genomics consortium, SGC, U function; 1.73A {Plasmodium yoelii} | Back alignment and structure |
|---|
| >3ga4_A Dolichyl-diphosphooligosaccharide-protein glycosyltransferase subunit OST6; oxidoreductase, active site loop, redox state, membrane; HET: PG4; 1.30A {Saccharomyces cerevisiae} PDB: 3g7y_A 3g9b_A* | Back alignment and structure |
|---|
| >2o8v_B Thioredoxin 1; disulfide crosslinked complex, oxidoreductase; 3.00A {Escherichia coli} | Back alignment and structure |
|---|
| >2voc_A Thioredoxin; electron transport, homodimer, disulfide, transport, redox-active center; 1.50A {Bacillus subtilis} PDB: 2ipa_A 2gzy_A 2gzz_A | Back alignment and structure |
|---|
| >2ywm_A Glutaredoxin-like protein; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 2.30A {Aquifex aeolicus} PDB: 2ayt_A | Back alignment and structure |
|---|
| >2dj1_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2dml_A Protein disulfide-isomerase A6; thioredoxin domain-containing protein 7, endoplasmic reticulum, redox-active center, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1x5d_A Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC7, thioredoxin like domain, redox, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2i4a_A Thioredoxin; acidophIle, disulfide exchange, oxidoreductase; 1.00A {Acetobacter aceti} | Back alignment and structure |
|---|
| >1w4v_A Thioredoxin, mitochondrial; antioxidant enzyme, mitochondrion, electron TRA oxidoreductase; 1.80A {Homo sapiens} PDB: 1uvz_A 1w89_A | Back alignment and structure |
|---|
| >1t00_A Thioredoxin, TRX; redox regulation, multifunction macromolecule, electron transport; 1.51A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >1mek_A Protein disulfide isomerase; electron transport, redox-active center, endoplasmic reticulum; NMR {Homo sapiens} SCOP: c.47.1.2 | Back alignment and structure |
|---|
| >3aps_A DNAJ homolog subfamily C member 10; thioredoxin fold, CXXC motif, endoplasmic reticulum, oxidore; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >3uvt_A Thioredoxin domain-containing protein 5; thioredoxin-like fold, isomerase; 2.00A {Homo sapiens} PDB: 2diz_A 3uj1_A | Back alignment and structure |
|---|
| >3hz4_A Thioredoxin; NYSGXRC, PSI-II, reduced form, protein structure initiative, structural genomics; 2.30A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3p2a_A Thioredoxin 2, putative thioredoxin-like protein; structural genomics, center for structural genomics of infec diseases, csgid; 2.19A {Yersinia pestis} | Back alignment and structure |
|---|
| >3die_A Thioredoxin, TRX; electron transport, SWAP domain, redox enzymology, oxidoreductase, redox-active center, transport; 1.85A {Staphylococcus aureus} SCOP: c.47.1.1 PDB: 2o7k_A 2o85_A 2o89_A 2o87_A | Back alignment and structure |
|---|
| >3tco_A Thioredoxin (TRXA-1); disulfide oxidoreductase, oxidoreductase; 1.90A {Sulfolobus solfataricus} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >2qgv_A Hydrogenase-1 operon protein HYAE; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Shigella flexneri 2A} PDB: 2hfd_A | Back alignment and structure |
|---|
| >3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} | Back alignment and structure |
|---|
| >3hxs_A Thioredoxin, TRXP; electron transport; 2.00A {Bacteroides fragilis} PDB: 3hyp_A | Back alignment and structure |
|---|
| >1thx_A Thioredoxin, thioredoxin 2; oxido-reductase, electron transport; 1.60A {Nostoc SP} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3evi_A Phosducin-like protein 2; alpha beta, 3-layer(ABA) sandwich, unknown function; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2l5l_A Thioredoxin; structural genomics, electron transport, PSI-2, protein STRU initiative; NMR {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >2ppt_A Thioredoxin-2; thiredoxin, zinc finger, oxidoreductase; 1.92A {Rhodobacter capsulatus} | Back alignment and structure |
|---|
| >1dby_A Chloroplast thioredoxin M CH2; thioredoxin CH2, chloroplastic thioredoxin, oxidoreductase; NMR {Chlamydomonas reinhardtii} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >4euy_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; 2.90A {Bacillus cereus} | Back alignment and structure |
|---|
| >1fb6_A Thioredoxin M; electron transport; 2.10A {Spinacia oleracea} SCOP: c.47.1.1 PDB: 1fb0_A 1gl8_A 2puk_C | Back alignment and structure |
|---|
| >2i1u_A Thioredoxin, TRX, MPT46; redox protein, electron transport; 1.30A {Mycobacterium tuberculosis} PDB: 3nof_A 3o6t_A* 2l4q_A 2l59_A | Back alignment and structure |
|---|
| >1oaz_A Thioredoxin 1; immune system, antibody/complex, antibody, allergy, IGE, conformational diversity, multispecficity, redox-active center; 2.77A {Escherichia coli} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1nsw_A Thioredoxin, TRX; thermostability, electron transport; 1.90A {Alicyclobacillus acidocaldarius} SCOP: c.47.1.1 PDB: 1rqm_A 1quw_A 1nw2_A | Back alignment and structure |
|---|
| >2yzu_A Thioredoxin; redox protein, electron transport, structural genomics; 1.90A {Thermus thermophilus} PDB: 2cvk_A | Back alignment and structure |
|---|
| >2l4c_A Endoplasmic reticulum resident protein 27; ERP27, PDI, B domain, peptide binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4f9z_D Endoplasmic reticulum resident protein 27; thioredoxin fold, ER foldase, ERP57, binding protein; HET: PE3 PE4; 2.20A {Homo sapiens} PDB: 2l4c_A | Back alignment and structure |
|---|
| >2pu9_C TRX-F, thioredoxin F-type, chloroplast; protein-protein complex, iron-sulfur, electron transport; 1.65A {Spinacia oleracea} PDB: 2pvo_C 1f9m_A | Back alignment and structure |
|---|
| >3qfa_C Thioredoxin; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_C* | Back alignment and structure |
|---|
| >1v98_A Thioredoxin; oxidoreductase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.82A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2e0q_A Thioredoxin; electron transport; 1.49A {Sulfolobus tokodaii} PDB: 3hhv_A | Back alignment and structure |
|---|
| >1x5e_A Thioredoxin domain containing protein 1; TMX, TXNDC1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1gh2_A Thioredoxin-like protein; redox-active center, electron transport; 2.22A {Homo sapiens} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2dbc_A PDCL2, unnamed protein product; phosducin-like protein, thioredoxin_FOLD, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2trc_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; 2.40A {Rattus norvegicus} SCOP: c.47.1.6 | Back alignment and structure |
|---|
| >3q6o_A Sulfhydryl oxidase 1; protein disulfide isomerase, thioredoxin, thioredoxin fold, oxidoreductase, reductive methylation; HET: MLY; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} | Back alignment and structure |
|---|
| >1xwb_A Thioredoxin; dimerization, redox regulation, THI X-RAY electron transport; 2.20A {Drosophila melanogaster} SCOP: c.47.1.1 PDB: 1xw9_A 1xwc_A 1xwa_A | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* | Back alignment and structure |
|---|
| >2c0g_A ERP29 homolog, windbeutel protein; PDI-dbeta, PDI, protein disulfide isomerase, PIPE, dorsal-ventral patterning, chaperone, WIND mutants; 1.75A {Drosophila melanogaster} SCOP: a.71.1.1 c.47.1.7 PDB: 1ovn_A 2c0f_A 2c1y_A 2c0e_A | Back alignment and structure |
|---|
| >1r26_A Thioredoxin; redox-active disulfide, electron transport; 1.40A {Trypanosoma} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3f3q_A Thioredoxin-1; His TAG, electron transport, cytoplasm, deoxyribonucleotide synthesis, golgi apparatus, membrane, nucleus; 1.76A {Saccharomyces cerevisiae} PDB: 3f3r_A* 2i9h_A 2fa4_A 2hsy_A 3pin_A 4dss_B | Back alignment and structure |
|---|
| >3gix_A Thioredoxin-like protein 4B; PRE-mRNA splicing, TXNL4B, DLP, cell cycle, mRNA processing, mRNA splicing, nucleus, phosphoprotein, splicing; HET: SUC; 1.33A {Homo sapiens} SCOP: c.47.1.0 PDB: 1xbs_A | Back alignment and structure |
|---|
| >3q6o_A Sulfhydryl oxidase 1; protein disulfide isomerase, thioredoxin, thioredoxin fold, oxidoreductase, reductive methylation; HET: MLY; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >1ep7_A Thioredoxin CH1, H-type; electron transport; 2.10A {Chlamydomonas reinhardtii} SCOP: c.47.1.1 PDB: 1tof_A 1ep8_A | Back alignment and structure |
|---|
| >1a0r_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; HET: FAR; 2.80A {Bos taurus} SCOP: c.47.1.6 PDB: 1b9y_C 1b9x_C | Back alignment and structure |
|---|
| >3ul3_B Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 2.90A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2vlu_A Thioredoxin, thioredoxin H isoform 2.; oxidoreductase, thioredoxin-fold, protein disulfide reductase; 1.70A {Hordeum vulgare var} PDB: 2vlt_A 2vlv_A 2iwt_A* | Back alignment and structure |
|---|
| >3d6i_A Monothiol glutaredoxin-3; thioredoxin-like, electron transport, redox- active center, transport, oxidoreductase; HET: CME; 1.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1qgv_A Spliceosomal protein U5-15KD; snRNP, thioredoxin, transcription; 1.40A {Homo sapiens} SCOP: c.47.1.8 PDB: 1syx_A 1pqn_A | Back alignment and structure |
|---|
| >1faa_A Thioredoxin F; electron transport; 1.85A {Spinacia oleracea} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2xc2_A Thioredoxinn; oxidoreductase, protein disulfide reductase; 1.56A {Schistosoma mansoni} PDB: 2xbq_A 2xbi_A | Back alignment and structure |
|---|
| >2l57_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, PSI protein structure initiative; NMR {Clostridium perfringens} | Back alignment and structure |
|---|
| >2vim_A Thioredoxin, TRX; thioredoxin fold, oxidoreductase; 1.38A {Fasciola hepatica} | Back alignment and structure |
|---|
| >1syr_A Thioredoxin; SGPP, structural genomics, PSI, protein structure initiative structural genomics of pathogenic protozoa consortium; 2.95A {Plasmodium falciparum} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2qc7_A ERP31, ERP28, endoplasmic reticulum protein ERP29; B domain (residues 33-153), D domain (residues 154-261), CHA; 2.90A {Homo sapiens} PDB: 1g7e_A 1g7d_A | Back alignment and structure |
|---|
| >2es7_A Q8ZP25_salty, putative thiol-disulfide isomerase and thioredoxi; structural genomics, PSI, protein structure initiative; 2.80A {Salmonella typhimurium} SCOP: c.47.1.20 PDB: 2gzp_A 2jzt_A | Back alignment and structure |
|---|
| >1xfl_A Thioredoxin H1; AT3G51030, structural genomics, protein structure initiative, CESG, center for eukaryotic structural genomics; NMR {Arabidopsis thaliana} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3m9j_A Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} SCOP: c.47.1.1 PDB: 3m9k_A 2hsh_A 1erv_A 2ifq_A 2ifq_B 1auc_A 1eru_A 1ert_A 3kd0_A 1aiu_A 3trx_A 4trx_A 1trs_A 1tru_A 1trv_A 1trw_A 3e3e_A* 1cqg_A 1cqh_A 1mdi_A ... | Back alignment and structure |
|---|
| >2hls_A Protein disulfide oxidoreductase; thioredoxin fold; 1.93A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2dj0_A Thioredoxin-related transmembrane protein 2; AVLA237, CGI-31 protein, TXNDC14, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yj7_A LPBCA thioredoxin; oxidoreductase; 1.65A {Synthetic construct} | Back alignment and structure |
|---|
| >2l6c_A Thioredoxin; oxidoreductase; NMR {Desulfovibrio vulgaris} PDB: 2l6d_A | Back alignment and structure |
|---|
| >2wz9_A Glutaredoxin-3; protein binding; 1.55A {Homo sapiens} PDB: 2diy_A | Back alignment and structure |
|---|
| >2oe3_A Thioredoxin-3; electron transport, alpha/beta sandwich, oxidized, dimer; 1.80A {Saccharomyces cerevisiae} PDB: 2oe1_A 2oe0_A | Back alignment and structure |
|---|
| >3ed3_A Protein disulfide-isomerase MPD1; thioredoxin-like domain, CXXC, endoplasmic reticulum, glycoprotein, redox-active center; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2f51_A Thioredoxin; electron transport; 1.90A {Trichomonas vaginalis} | Back alignment and structure |
|---|
| >2j23_A Thioredoxin; immune protein, autoreactivity, cross-reactivity, IGE, fungi, epitope, allergen; 1.41A {Malassezia sympodialis} | Back alignment and structure |
|---|
| >3emx_A Thioredoxin; structural genomics, oxidoreductase, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.25A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3d22_A TRXH4, thioredoxin H-type; electron transport, cytoplasm, redox-active center, transport, oxidoreductase; 1.60A {Populus trichocarpa x populusdeltoides} PDB: 3d21_A | Back alignment and structure |
|---|
| >2vm1_A Thioredoxin, thioredoxin H isoform 1.; oxidoreductase, protein disulfide reductase, thioredoxin-FOL; 1.7A {Hordeum vulgare var} PDB: 2vm2_A | Back alignment and structure |
|---|
| >1ti3_A Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Populus tremula} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3cxg_A Putative thioredoxin; malaria, structural GEN oxidoreductase, structural genomics consortium, SGC; 2.00A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3qcp_A QSOX from trypanosoma brucei (tbqsox); ERV fold, thioredoxin fold, sulfhydryl oxidase, oxidoreducta; HET: FAD; 2.30A {Trypanosoma brucei} PDB: 3qd9_A* | Back alignment and structure |
|---|
| >3t58_A Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2.40A {Mus musculus} PDB: 3t59_A* | Back alignment and structure |
|---|
| >3t58_A Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2.40A {Mus musculus} PDB: 3t59_A* | Back alignment and structure |
|---|
| >1zma_A Bacterocin transport accessory protein; alpha-beta-alpha-sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.25A {Streptococcus pneumoniae} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2kuc_A Putative disulphide-isomerase; structural genomics, thioredo PSI-2, protein structure initiative; NMR {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1fo5_A Thioredoxin; disulfide oxidoreductase, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; NMR {Methanocaldococcus jannaschii} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2djk_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp2_A | Back alignment and structure |
|---|
| >1nho_A Probable thioredoxin; beta sheet, alpha helix, oxidoreductase; NMR {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2h8l_A Protein disulfide-isomerase A3; thioredoxin-like fold; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3dml_A Putative uncharacterized protein; thioredoxin, oxidoreductase, sulfur oxidation, thiol- disulfide oxidoreductase; HET: MSE; 1.90A {Paracoccus denitrificans} PDB: 3d4t_A* | Back alignment and structure |
|---|
| >3fk8_A Disulphide isomerase; APC61824.1, xylella fastidiosa temecul structural genomics, PSI-2, protein structure initiative; 1.30A {Xylella fastidiosa} | Back alignment and structure |
|---|
| >1wmj_A Thioredoxin H-type; structural genomics, program for RICE genome research, oxidoreductase; NMR {Oryza sativa} | Back alignment and structure |
|---|
| >1wou_A Thioredoxin -related protein, 14 kDa; electron transport; 1.80A {Homo sapiens} SCOP: c.47.1.16 PDB: 1v9w_A | Back alignment and structure |
|---|
| >3h79_A Thioredoxin-like protein; thioredoxin fold, catalytic cysteines missing, unknown funct; 1.50A {Trypanosoma cruzi} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >2fwh_A Thiol:disulfide interchange protein DSBD; thioredoxin-like, C-terminal domain, reduced form at PH7, oxidoreductase; 0.99A {Escherichia coli} SCOP: c.47.1.1 PDB: 2fwe_A 2fwf_A 2fwg_A 1vrs_D 1uc7_A | Back alignment and structure |
|---|
| >3f9u_A Putative exported cytochrome C biogenesis-related; exported cytochrome C biogenesis-related protein, bacteroide fragilis; 2.20A {Bacteroides fragilis nctc 9343} | Back alignment and structure |
|---|
| >3ga4_A Dolichyl-diphosphooligosaccharide-protein glycosyltransferase subunit OST6; oxidoreductase, active site loop, redox state, membrane; HET: PG4; 1.30A {Saccharomyces cerevisiae} PDB: 3g7y_A 3g9b_A* | Back alignment and structure |
|---|
| >2lst_A Thioredoxin; structural genomics, NEW YORK structural genomics research consortium, oxidoreductase; NMR {Thermus thermophilus} | Back alignment and structure |
|---|
| >3iv4_A Putative oxidoreductase; APC23140, meticillin-resistant staphylococcus aureus, oxidor thioredoxin fold, structural genomics, PSI-2; HET: MSE; 1.50A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >3ec3_A Protein disulfide-isomerase A4; thioredoxin-like fold, endoplasmic reticulum, glycoprotein, redox-active center; 1.92A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1un2_A DSBA, thiol-disulfide interchange protein; disulfide oxidoreductase, oxidoreductase, protein disulfide isomerase, protein folding, thioredoxin; 2.4A {Escherichia coli} SCOP: c.47.1.13 | Back alignment and structure |
|---|
| >3tco_A Thioredoxin (TRXA-1); disulfide oxidoreductase, oxidoreductase; 1.90A {Sulfolobus solfataricus} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >2ju5_A Thioredoxin disulfide isomerase; protein, oxidoreductase; NMR {Chlamydophila pneumoniae} | Back alignment and structure |
|---|
| >3hz4_A Thioredoxin; NYSGXRC, PSI-II, reduced form, protein structure initiative, structural genomics; 2.30A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3gnj_A Thioredoxin domain protein; APC92103, STR genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.99A {Desulfitobacterium hafniense dcb-2} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >2c0g_A ERP29 homolog, windbeutel protein; PDI-dbeta, PDI, protein disulfide isomerase, PIPE, dorsal-ventral patterning, chaperone, WIND mutants; 1.75A {Drosophila melanogaster} SCOP: a.71.1.1 c.47.1.7 PDB: 1ovn_A 2c0f_A 2c1y_A 2c0e_A | Back alignment and structure |
|---|
| >2dj1_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3kp8_A Vkorc1/thioredoxin domain protein; blood coagulation, disulfide formation, redox partner, oxidoreductase; 1.66A {Synechococcus SP} | Back alignment and structure |
|---|
| >2dml_A Protein disulfide-isomerase A6; thioredoxin domain-containing protein 7, endoplasmic reticulum, redox-active center, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3die_A Thioredoxin, TRX; electron transport, SWAP domain, redox enzymology, oxidoreductase, redox-active center, transport; 1.85A {Staphylococcus aureus} SCOP: c.47.1.1 PDB: 2o7k_A 2o85_A 2o89_A 2o87_A | Back alignment and structure |
|---|
| >2trx_A Thioredoxin; electron transport; 1.68A {Escherichia coli} SCOP: c.47.1.1 PDB: 1skr_B* 1skw_B* 1sl0_B* 1sks_B* 1sl2_B* 1t7p_B* 1t8e_B* 1tk0_B* 1tk5_B* 1tk8_B* 1tkd_B* 1sl1_B* 1x9s_B* 1x9w_B* 1xoa_A 1xob_A 1zyq_B* 2ajq_B* 2bto_T* 2h6x_A ... | Back alignment and structure |
|---|
| >2dj3_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1lu4_A Soluble secreted antigen MPT53; thioredoxin-like fold, structural genomics, PSI, protein structure initiative; 1.12A {Mycobacterium tuberculosis} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >1zzo_A RV1677; thioredoxin fold, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 1.60A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 3ios_A | Back alignment and structure |
|---|
| >2b5x_A YKUV protein, TRXY; thioredoxin-like, oxidoreductase; NMR {Bacillus subtilis} SCOP: c.47.1.10 PDB: 2b5y_A | Back alignment and structure |
|---|
| >1x5d_A Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC7, thioredoxin like domain, redox, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1thx_A Thioredoxin, thioredoxin 2; oxido-reductase, electron transport; 1.60A {Nostoc SP} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2voc_A Thioredoxin; electron transport, homodimer, disulfide, transport, redox-active center; 1.50A {Bacillus subtilis} PDB: 2ipa_A 2gzy_A 2gzz_A | Back alignment and structure |
|---|
| >3p2a_A Thioredoxin 2, putative thioredoxin-like protein; structural genomics, center for structural genomics of infec diseases, csgid; 2.19A {Yersinia pestis} | Back alignment and structure |
|---|
| >3or5_A Thiol:disulfide interchange protein, thioredoxin protein; PSI-II, structural genomics, protein structure initiative; 1.66A {Chlorobaculum tepidum} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >1nsw_A Thioredoxin, TRX; thermostability, electron transport; 1.90A {Alicyclobacillus acidocaldarius} SCOP: c.47.1.1 PDB: 1rqm_A 1quw_A 1nw2_A | Back alignment and structure |
|---|
| >3ph9_A Anterior gradient protein 3 homolog; thioredoxin fold, protein disulfide isomerase, endoplasmic R isomerase; 1.83A {Homo sapiens} SCOP: c.47.1.0 PDB: 2lns_A 2lnt_A | Back alignment and structure |
|---|
| >2djj_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp1_A | Back alignment and structure |
|---|
| >2ppt_A Thioredoxin-2; thiredoxin, zinc finger, oxidoreductase; 1.92A {Rhodobacter capsulatus} | Back alignment and structure |
|---|
| >2i4a_A Thioredoxin; acidophIle, disulfide exchange, oxidoreductase; 1.00A {Acetobacter aceti} | Back alignment and structure |
|---|
| >2yzu_A Thioredoxin; redox protein, electron transport, structural genomics; 1.90A {Thermus thermophilus} PDB: 2cvk_A | Back alignment and structure |
|---|
| >3hxs_A Thioredoxin, TRXP; electron transport; 2.00A {Bacteroides fragilis} PDB: 3hyp_A | Back alignment and structure |
|---|
| >1sen_A Thioredoxin-like protein P19; endoplasmic reticulum, RP19, structural genomics, PSI, protein structure initiative; 1.20A {Homo sapiens} SCOP: c.47.1.1 PDB: 2k8v_A | Back alignment and structure |
|---|
| >2o8v_B Thioredoxin 1; disulfide crosslinked complex, oxidoreductase; 3.00A {Escherichia coli} | Back alignment and structure |
|---|
| >2e0q_A Thioredoxin; electron transport; 1.49A {Sulfolobus tokodaii} PDB: 3hhv_A | Back alignment and structure |
|---|
| >1ilo_A Conserved hypothetical protein MTH895; beta-alpha-beta-alpha-beta-BETA-alpha motif, structural genomics, PSI; NMR {Methanothermobacterthermautotrophicus str} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1mek_A Protein disulfide isomerase; electron transport, redox-active center, endoplasmic reticulum; NMR {Homo sapiens} SCOP: c.47.1.2 | Back alignment and structure |
|---|
| >1x5e_A Thioredoxin domain containing protein 1; TMX, TXNDC1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1v98_A Thioredoxin; oxidoreductase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.82A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3aps_A DNAJ homolog subfamily C member 10; thioredoxin fold, CXXC motif, endoplasmic reticulum, oxidore; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >3raz_A Thioredoxin-related protein; structural genomics, PSI-2, protein structure initiative; 2.00A {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >3zzx_A Thioredoxin; oxidoreductase; 1.88A {Litopenaeus vannamei} | Back alignment and structure |
|---|
| >3qfa_C Thioredoxin; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_C* | Back alignment and structure |
|---|
| >1w4v_A Thioredoxin, mitochondrial; antioxidant enzyme, mitochondrion, electron TRA oxidoreductase; 1.80A {Homo sapiens} PDB: 1uvz_A 1w89_A | Back alignment and structure |
|---|
| >1t00_A Thioredoxin, TRX; redox regulation, multifunction macromolecule, electron transport; 1.51A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >4euy_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; 2.90A {Bacillus cereus} | Back alignment and structure |
|---|
| >1fb6_A Thioredoxin M; electron transport; 2.10A {Spinacia oleracea} SCOP: c.47.1.1 PDB: 1fb0_A 1gl8_A 2puk_C | Back alignment and structure |
|---|
| >1dby_A Chloroplast thioredoxin M CH2; thioredoxin CH2, chloroplastic thioredoxin, oxidoreductase; NMR {Chlamydomonas reinhardtii} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2f9s_A Thiol-disulfide oxidoreductase RESA; thioredoxin-like protein; HET: MSE; 1.40A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1st9_A 1su9_A 2h1d_A 2h1b_A 2h1a_A 2h19_A 2h1g_A 3c71_A 3c73_A | Back alignment and structure |
|---|
| >2i1u_A Thioredoxin, TRX, MPT46; redox protein, electron transport; 1.30A {Mycobacterium tuberculosis} PDB: 3nof_A 3o6t_A* 2l4q_A 2l59_A | Back alignment and structure |
|---|
| >3uvt_A Thioredoxin domain-containing protein 5; thioredoxin-like fold, isomerase; 2.00A {Homo sapiens} PDB: 2diz_A 3uj1_A | Back alignment and structure |
|---|
| >2l5l_A Thioredoxin; structural genomics, electron transport, PSI-2, protein STRU initiative; NMR {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >2qsi_A Putative hydrogenase expression/formation protein; HUPG, MCS SAD, structural genomics, protein structure initiative; 1.80A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3erw_A Sporulation thiol-disulfide oxidoreductase A; thioredoxin-like fold, RESA-like fold, dithiol, STOA, redox-active center; 2.50A {Bacillus subtilis} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} | Back alignment and structure |
|---|
| >3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} | Back alignment and structure |
|---|
| >1oaz_A Thioredoxin 1; immune system, antibody/complex, antibody, allergy, IGE, conformational diversity, multispecficity, redox-active center; 2.77A {Escherichia coli} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1z6n_A Hypothetical protein PA1234; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.47.1.1 PDB: 3lef_A | Back alignment and structure |
|---|
| >2h30_A Thioredoxin, peptide methionine sulfoxide reductase MSRA/MSRB; reduced, thiol-disulfide exchange, oxidoreductase; 1.60A {Neisseria gonorrhoeae} PDB: 2jzr_A 2jzs_A 2k9f_A 2fy6_A | Back alignment and structure |
|---|
| >3ia1_A THIO-disulfide isomerase/thioredoxin; oxidoreductase, PSI-2, NYSGXRC, structu genomics, protein structure initiative; 1.76A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3ul3_B Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 2.90A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3lor_A Thiol-disulfide isomerase and thioredoxins; PSI, MCSG, structural genomics, midwest CE structural genomics; HET: MSE; 2.20A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >2lja_A Putative thiol-disulfide oxidoreductase; structural genomics, unknown function, thioredoxin-like; NMR {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >2l57_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, PSI protein structure initiative; NMR {Clostridium perfringens} | Back alignment and structure |
|---|
| >1xwb_A Thioredoxin; dimerization, redox regulation, THI X-RAY electron transport; 2.20A {Drosophila melanogaster} SCOP: c.47.1.1 PDB: 1xw9_A 1xwc_A 1xwa_A | Back alignment and structure |
|---|
| >1r26_A Thioredoxin; redox-active disulfide, electron transport; 1.40A {Trypanosoma} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3eyt_A Uncharacterized protein SPOA0173; thioredoxin-like superfamily protein SPOA0173, silicibacter DSS, structural genomics, PSI-2; 1.95A {Silicibacter pomeroyi} | Back alignment and structure |
|---|
| >1jfu_A Thiol:disulfide interchange protein TLPA; thioredoxin-like, double disulfide bridge, membrane protein; 1.60A {Bradyrhizobium japonicum} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >2l5o_A Putative thioredoxin; structural genomics, unknown function, PSI-2, protein struct initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >1ep7_A Thioredoxin CH1, H-type; electron transport; 2.10A {Chlamydomonas reinhardtii} SCOP: c.47.1.1 PDB: 1tof_A 1ep8_A | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* | Back alignment and structure |
|---|
| >2vlu_A Thioredoxin, thioredoxin H isoform 2.; oxidoreductase, thioredoxin-fold, protein disulfide reductase; 1.70A {Hordeum vulgare var} PDB: 2vlt_A 2vlv_A 2iwt_A* | Back alignment and structure |
|---|
| >1gh2_A Thioredoxin-like protein; redox-active center, electron transport; 2.22A {Homo sapiens} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2wz9_A Glutaredoxin-3; protein binding; 1.55A {Homo sapiens} PDB: 2diy_A | Back alignment and structure |
|---|
| >4evm_A Thioredoxin family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.51A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >2pu9_C TRX-F, thioredoxin F-type, chloroplast; protein-protein complex, iron-sulfur, electron transport; 1.65A {Spinacia oleracea} PDB: 2pvo_C 1f9m_A | Back alignment and structure |
|---|
| >3ewl_A Uncharacterized conserved protein BF1870; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; 2.00A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2qc7_A ERP31, ERP28, endoplasmic reticulum protein ERP29; B domain (residues 33-153), D domain (residues 154-261), CHA; 2.90A {Homo sapiens} PDB: 1g7e_A 1g7d_A | Back alignment and structure |
|---|
| >2qgv_A Hydrogenase-1 operon protein HYAE; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Shigella flexneri 2A} PDB: 2hfd_A | Back alignment and structure |
|---|
| >2av4_A Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECIFIC 15KD prote structural genomics, structural genomics consortium, SGC, U function; 1.73A {Plasmodium yoelii} | Back alignment and structure |
|---|
| >3eur_A Uncharacterized protein; PSI2,MCSG, conserved protein, structural genomics, protein S initiative, midwest center for structural genomics; HET: MSE; 1.30A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3m9j_A Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} SCOP: c.47.1.1 PDB: 3m9k_A 2hsh_A 1erv_A 2ifq_A 2ifq_B 1auc_A 1eru_A 1ert_A 3kd0_A 1aiu_A 3trx_A 4trx_A 1trs_A 1tru_A 1trv_A 1trw_A 3e3e_A* 1cqg_A 1cqh_A 1mdi_A ... | Back alignment and structure |
|---|
| >1syr_A Thioredoxin; SGPP, structural genomics, PSI, protein structure initiative structural genomics of pathogenic protozoa consortium; 2.95A {Plasmodium falciparum} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3d6i_A Monothiol glutaredoxin-3; thioredoxin-like, electron transport, redox- active center, transport, oxidoreductase; HET: CME; 1.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3f3q_A Thioredoxin-1; His TAG, electron transport, cytoplasm, deoxyribonucleotide synthesis, golgi apparatus, membrane, nucleus; 1.76A {Saccharomyces cerevisiae} PDB: 3f3r_A* 2i9h_A 2fa4_A 2hsy_A 3pin_A 4dss_B | Back alignment and structure |
|---|
| >2vim_A Thioredoxin, TRX; thioredoxin fold, oxidoreductase; 1.38A {Fasciola hepatica} | Back alignment and structure |
|---|
| >3fkf_A Thiol-disulfide oxidoreductase; structural genomics, PSI-2, structure initiative, midwest center for structural genomic oxidoreductase; 2.20A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2fgx_A Putative thioredoxin; NET3, NESG, GFT-glutaredoxin-like, structural genomics, PSI, protein structure initiative; NMR {Nitrosomonas europaea} | Back alignment and structure |
|---|
| >2j23_A Thioredoxin; immune protein, autoreactivity, cross-reactivity, IGE, fungi, epitope, allergen; 1.41A {Malassezia sympodialis} | Back alignment and structure |
|---|
| >2b1k_A Thiol:disulfide interchange protein DSBE; C-terminal thioredoxin-like domain, N-terminal beta-sheet, fingerprint rigion, oxidoreductase; 1.90A {Escherichia coli} PDB: 3k8n_A 2g0f_A 1z5y_E 2b1l_A | Back alignment and structure |
|---|
| >3lwa_A Secreted thiol-disulfide isomerase; thioredoxin, PSI, MCSG, structural genomics, midwest center for structural genomics; 1.75A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >2xc2_A Thioredoxinn; oxidoreductase, protein disulfide reductase; 1.56A {Schistosoma mansoni} PDB: 2xbq_A 2xbi_A | Back alignment and structure |
|---|
| >2l6c_A Thioredoxin; oxidoreductase; NMR {Desulfovibrio vulgaris} PDB: 2l6d_A | Back alignment and structure |
|---|
| >3gl3_A Putative thiol:disulfide interchange protein DSBE; oxidoreductase, PSI-II, structural genomics, protein structure initiative; 2.09A {Chlorobium tepidum tls} | Back alignment and structure |
|---|
| >1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A | Back alignment and structure |
|---|
| >2es7_A Q8ZP25_salty, putative thiol-disulfide isomerase and thioredoxi; structural genomics, PSI, protein structure initiative; 2.80A {Salmonella typhimurium} SCOP: c.47.1.20 PDB: 2gzp_A 2jzt_A | Back alignment and structure |
|---|
| >3kcm_A Thioredoxin family protein; SGX, thioredoxin protein, PSI, structural genomics, protein initiative; 2.45A {Geobacter metallireducens gs-15} | Back alignment and structure |
|---|
| >2lrn_A Thiol:disulfide interchange protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, oxidoreductase; NMR {Bacteroides SP} | Back alignment and structure |
|---|
| >3hcz_A Possible thiol-disulfide isomerase; APC61559.2, cytophaga hutchinsoni structural genomics, PSI-2, protein structure initiative; 1.88A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >1ttz_A Conserved hypothetical protein; structural genomics, unknown function, PSI, protein structure initiative; 2.11A {Xanthomonas campestris} SCOP: c.47.1.1 PDB: 1xpv_A | Back alignment and structure |
|---|
| >3ira_A Conserved protein; methanosarcina mazei,structural genomics, MCSG, protein structure initiative, midwest center for STRU genomics; 2.10A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3gix_A Thioredoxin-like protein 4B; PRE-mRNA splicing, TXNL4B, DLP, cell cycle, mRNA processing, mRNA splicing, nucleus, phosphoprotein, splicing; HET: SUC; 1.33A {Homo sapiens} SCOP: c.47.1.0 PDB: 1xbs_A | Back alignment and structure |
|---|
| >1faa_A Thioredoxin F; electron transport; 1.85A {Spinacia oleracea} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3hdc_A Thioredoxin family protein; ATCC53774, DSM 7210, , structural genomics, PSI-2, protein structure initiative; 1.77A {Geobacter metallireducens gs-15} | Back alignment and structure |
|---|
| >3ha9_A Uncharacterized thioredoxin-like protein; PSI, MCSG, structural G midwest center for structural genomics, protein structure initiative; 1.70A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1kng_A Thiol:disulfide interchange protein CYCY; thioredoxin fold, cytochrome C maturation, atomic resolution oxidoreductase; 1.14A {Bradyrhizobium japonicum} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >1xfl_A Thioredoxin H1; AT3G51030, structural genomics, protein structure initiative, CESG, center for eukaryotic structural genomics; NMR {Arabidopsis thaliana} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2oe3_A Thioredoxin-3; electron transport, alpha/beta sandwich, oxidized, dimer; 1.80A {Saccharomyces cerevisiae} PDB: 2oe1_A 2oe0_A | Back alignment and structure |
|---|
| >1ti3_A Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Populus tremula} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3emx_A Thioredoxin; structural genomics, oxidoreductase, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.25A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2dj0_A Thioredoxin-related transmembrane protein 2; AVLA237, CGI-31 protein, TXNDC14, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yj7_A LPBCA thioredoxin; oxidoreductase; 1.65A {Synthetic construct} | Back alignment and structure |
|---|
| >2vm1_A Thioredoxin, thioredoxin H isoform 1.; oxidoreductase, protein disulfide reductase, thioredoxin-FOL; 1.7A {Hordeum vulgare var} PDB: 2vm2_A | Back alignment and structure |
|---|
| >1qgv_A Spliceosomal protein U5-15KD; snRNP, thioredoxin, transcription; 1.40A {Homo sapiens} SCOP: c.47.1.8 PDB: 1syx_A 1pqn_A | Back alignment and structure |
|---|
| >1zma_A Bacterocin transport accessory protein; alpha-beta-alpha-sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.25A {Streptococcus pneumoniae} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3kp9_A Vkorc1/thioredoxin domain protein; warfarin, disulfide formation, blood coagulation, oxidoreduc blood coagulation,oxidoreductase; HET: U10; 3.60A {Synechococcus SP} | Back alignment and structure |
|---|
| >2ywi_A Hypothetical conserved protein; uncharacterized conserved protein, NPPSFA, national project protein structural and functional analyses; 1.60A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >2lrt_A Uncharacterized protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, nysgrc, PSI-biology; NMR {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >3d22_A TRXH4, thioredoxin H-type; electron transport, cytoplasm, redox-active center, transport, oxidoreductase; 1.60A {Populus trichocarpa x populusdeltoides} PDB: 3d21_A | Back alignment and structure |
|---|
| >1i5g_A Tryparedoxin II; electron transport; HET: TS5; 1.40A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1o6j_A 1o81_A 1oc8_A 1oc9_B 1fg4_A 1oc9_A | Back alignment and structure |
|---|
| >3qcp_A QSOX from trypanosoma brucei (tbqsox); ERV fold, thioredoxin fold, sulfhydryl oxidase, oxidoreducta; HET: FAD; 2.30A {Trypanosoma brucei} PDB: 3qd9_A* | Back alignment and structure |
|---|
| >2hyx_A Protein DIPZ; thioredoxin fold, jelly-roll, structural genomics, TB struct genomics consortium, TBSGC, unknown function; 1.90A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3cxg_A Putative thioredoxin; malaria, structural GEN oxidoreductase, structural genomics consortium, SGC; 2.00A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1fo5_A Thioredoxin; disulfide oxidoreductase, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; NMR {Methanocaldococcus jannaschii} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3s9f_A Tryparedoxin; thioredoxin fold, disulfide reductase, electron transport; 1.80A {Leishmania major} | Back alignment and structure |
|---|
| >1o8x_A Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrotron radiation, disulfide bonds tryparedoxin, thioredoxin, trypanosome; 1.3A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1okd_A 1qk8_A 1o85_A 1o8w_A 1o7u_A 1ezk_A 1ewx_A | Back alignment and structure |
|---|
| >2f51_A Thioredoxin; electron transport; 1.90A {Trichomonas vaginalis} | Back alignment and structure |
|---|
| >2dbc_A PDCL2, unnamed protein product; phosducin-like protein, thioredoxin_FOLD, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3kh7_A Thiol:disulfide interchange protein DSBE; TRX-like, thiol-disulfide exchange, cell inner membrane, CYT C-type biogenesis, disulfide bond; 1.75A {Pseudomonas aeruginosa} PDB: 3kh9_A | Back alignment and structure |
|---|
| >1o73_A Tryparedoxin; electron transport, trypanosomatid, thioredoxin; 2.28A {Trypanosoma brucei brucei} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >3fw2_A Thiol-disulfide oxidoreductase; structural genomics, APC61456.1, thiol-disulfide oxidoreduct TLPA-like family, PSI-2; 1.74A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2cvb_A Probable thiol-disulfide isomerase/thioredoxin; redox protein, structural genomics, riken struc genomics/proteomics initiative, RSGI; 1.80A {Thermus thermophilus} SCOP: c.47.1.10 PDB: 2ywo_A | Back alignment and structure |
|---|
| >1nho_A Probable thioredoxin; beta sheet, alpha helix, oxidoreductase; NMR {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2dlx_A UBX domain-containing protein 7; UAS domain, protein KIAA0794, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: c.47.1.24 | Back alignment and structure |
|---|
| >3evi_A Phosducin-like protein 2; alpha beta, 3-layer(ABA) sandwich, unknown function; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2kuc_A Putative disulphide-isomerase; structural genomics, thioredo PSI-2, protein structure initiative; NMR {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3u5r_E Uncharacterized protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, hypothetical protein; 2.05A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1wou_A Thioredoxin -related protein, 14 kDa; electron transport; 1.80A {Homo sapiens} SCOP: c.47.1.16 PDB: 1v9w_A | Back alignment and structure |
|---|
| >4fo5_A Thioredoxin-like protein; AHPC/TSA family protein, structural genomics, joint center F structural genomics, JCSG; 2.02A {Parabacteroides distasonis} | Back alignment and structure |
|---|
| >1wmj_A Thioredoxin H-type; structural genomics, program for RICE genome research, oxidoreductase; NMR {Oryza sativa} | Back alignment and structure |
|---|
| >2ls5_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, NEW structural genomics research consortium; NMR {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3fk8_A Disulphide isomerase; APC61824.1, xylella fastidiosa temecul structural genomics, PSI-2, protein structure initiative; 1.30A {Xylella fastidiosa} | Back alignment and structure |
|---|
| >3cmi_A Peroxiredoxin HYR1; thioredoxin-like fold, oxidoreductase, peroxidase, redox-ACT center; 2.02A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3dwv_A Glutathione peroxidase-like protein; alpha beta, 3-layer(ABA) sandwich, glutaredoxin fold, oxidor peroxidase; 1.41A {Trypanosoma brucei} PDB: 2rm5_A 2rm6_A 3e0u_A | Back alignment and structure |
|---|
| >2fwh_A Thiol:disulfide interchange protein DSBD; thioredoxin-like, C-terminal domain, reduced form at PH7, oxidoreductase; 0.99A {Escherichia coli} SCOP: c.47.1.1 PDB: 2fwe_A 2fwf_A 2fwg_A 1vrs_D 1uc7_A | Back alignment and structure |
|---|
| >1wjk_A C330018D20RIK protein; glutaredoxin, thioredoxin fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2p5q_A Glutathione peroxidase 5; thioredoxin fold, oxidoreductase; 2.00A {Populus trichocarpa x populusdeltoides} PDB: 2p5r_A | Back alignment and structure |
|---|
| >2k6v_A Putative cytochrome C oxidase assembly protein; thioredoxin fold, electron transfer protein, metal binding protein, electron transport; NMR {Thermus thermophilus} | Back alignment and structure |
|---|
| >2vup_A Glutathione peroxidase-like protein; oxidoreductase, trypanothione, dithiol-dependant peroxidase; 2.10A {Trypanosoma brucei} | Back alignment and structure |
|---|
| >2lus_A Thioredoxion; CR-Trp16, oxidoreductase; NMR {Carcinoscorpius rotundicauda} | Back alignment and structure |
|---|
| >2ggt_A SCO1 protein homolog, mitochondrial; copper chaperone, Cu-binding protein, mitochondrial assembly factor, redox, nickel, disuplhide, mitochondrion; 2.40A {Homo sapiens} SCOP: c.47.1.10 PDB: 2gqk_A 2gql_A 2gqm_A 2gt5_A 2gt6_A 2gvp_A 2hrf_A 2hrn_A 1wp0_A | Back alignment and structure |
|---|
| >2v1m_A Glutathione peroxidase; selenium, selenocysteine, oxidoreductase, lipid peroxidase, schistosoma detoxification pathway; 1.00A {Schistosoma mansoni} PDB: 2wgr_A | Back alignment and structure |
|---|
| >3drn_A Peroxiredoxin, bacterioferritin comigratory prote homolog; bacterioferritin comigratory protein, oxidore; HET: CIT; 2.15A {Sulfolobus solfataricus} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >2e7p_A Glutaredoxin; thioredoxin fold, poplar, electron transport; HET: GSH; 2.10A {Populus tremula x populus tremuloides} PDB: 1z7p_A 1z7r_A | Back alignment and structure |
|---|
| >2rli_A SCO2 protein homolog, mitochondrial; copper protein, thioredoxin fold, metal transport, structural genomics, spine2-complexes; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2trc_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; 2.40A {Rattus norvegicus} SCOP: c.47.1.6 | Back alignment and structure |
|---|
| >2obi_A PHGPX, GPX-4, phospholipid hydroperoxide glutathione peroxidase (GPX4); human GPX4, selenoprotein, thioredoxin-fold, anti-oxidatve defense system; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >2f8a_A Glutathione peroxidase 1; thioredoxin fold, structural genomics, structural genomics consortium, SGC, oxidoreductase; 1.50A {Homo sapiens} SCOP: c.47.1.10 PDB: 1gp1_A 2he3_A | Back alignment and structure |
|---|
| >2k8s_A Thioredoxin; dimer, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Nitrosomonas europaea} | Back alignment and structure |
|---|
| >2p31_A CL683, glutathione peroxidase 7; thioredoxin fold, NPGPX, phospholipid hydroperoxidase, struc genomics, structural genomics consortium, SGC; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1a0r_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; HET: FAR; 2.80A {Bos taurus} SCOP: c.47.1.6 PDB: 1b9y_C 1b9x_C | Back alignment and structure |
|---|
| >1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A | Back alignment and structure |
|---|
| >2b5x_A YKUV protein, TRXY; thioredoxin-like, oxidoreductase; NMR {Bacillus subtilis} SCOP: c.47.1.10 PDB: 2b5y_A | Back alignment and structure |
|---|
| >2lst_A Thioredoxin; structural genomics, NEW YORK structural genomics research consortium, oxidoreductase; NMR {Thermus thermophilus} | Back alignment and structure |
|---|
| >1lu4_A Soluble secreted antigen MPT53; thioredoxin-like fold, structural genomics, PSI, protein structure initiative; 1.12A {Mycobacterium tuberculosis} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >3kij_A Probable glutathione peroxidase 8; human PDI-peroxidase, membrane, oxidoreductase, transmembrane; 1.80A {Homo sapiens} SCOP: c.47.1.0 PDB: 3cyn_A | Back alignment and structure |
|---|
| >1xvw_A Hypothetical protein RV2238C/MT2298; thioredoxin fold, oxidized cystein sulfenic acid, structural genomics, PSI; 1.90A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 1xxu_A | Back alignment and structure |
|---|
| >1ego_A Glutaredoxin; electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 1egr_A 1grx_A* 1qfn_A | Back alignment and structure |
|---|
| >2bmx_A Alkyl hydroperoxidase C; peroxiredoxin, antioxidant defense system, oxidoreductase, structural proteomics in EURO spine; 2.4A {Mycobacterium tuberculosis} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >1zzo_A RV1677; thioredoxin fold, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 1.60A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 3ios_A | Back alignment and structure |
|---|
| >1we0_A Alkyl hydroperoxide reductase C; peroxiredoxin, AHPC, oxidoreductase; 2.90A {Amphibacillus xylanus} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >2gs3_A PHGPX, GPX-4, phospholipid hydroperoxide glutathione peroxidase; GSHPX-4,phospholipid hydroperoxide; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2ju5_A Thioredoxin disulfide isomerase; protein, oxidoreductase; NMR {Chlamydophila pneumoniae} | Back alignment and structure |
|---|
| >1zof_A Alkyl hydroperoxide-reductase; decamer, toroide-shaped complex, oxidoreductase; 2.95A {Helicobacter pylori} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >3or5_A Thiol:disulfide interchange protein, thioredoxin protein; PSI-II, structural genomics, protein structure initiative; 1.66A {Chlorobaculum tepidum} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3iv4_A Putative oxidoreductase; APC23140, meticillin-resistant staphylococcus aureus, oxidor thioredoxin fold, structural genomics, PSI-2; HET: MSE; 1.50A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >3f9u_A Putative exported cytochrome C biogenesis-related; exported cytochrome C biogenesis-related protein, bacteroide fragilis; 2.20A {Bacteroides fragilis nctc 9343} | Back alignment and structure |
|---|
| >2f9s_A Thiol-disulfide oxidoreductase RESA; thioredoxin-like protein; HET: MSE; 1.40A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1st9_A 1su9_A 2h1d_A 2h1b_A 2h1a_A 2h19_A 2h1g_A 3c71_A 3c73_A | Back alignment and structure |
|---|
| >2l5o_A Putative thioredoxin; structural genomics, unknown function, PSI-2, protein struct initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >3kp8_A Vkorc1/thioredoxin domain protein; blood coagulation, disulfide formation, redox partner, oxidoreductase; 1.66A {Synechococcus SP} | Back alignment and structure |
|---|
| >1xzo_A BSSCO, hypothetical protein YPMQ; thioredoxin-like fold, structural genomics, montreal-kingsto bacterial structural genomics initiative, BSGI; 1.70A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1on4_A | Back alignment and structure |
|---|
| >1ilo_A Conserved hypothetical protein MTH895; beta-alpha-beta-alpha-beta-BETA-alpha motif, structural genomics, PSI; NMR {Methanothermobacterthermautotrophicus str} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3erw_A Sporulation thiol-disulfide oxidoreductase A; thioredoxin-like fold, RESA-like fold, dithiol, STOA, redox-active center; 2.50A {Bacillus subtilis} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3raz_A Thioredoxin-related protein; structural genomics, PSI-2, protein structure initiative; 2.00A {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >1h75_A Glutaredoxin-like protein NRDH; electron transport, thioredoxin, redox protein; 1.7A {Escherichia coli} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1eej_A Thiol:disulfide interchange protein; oxidoreductase, protein disulfide isomerase, protein folding, redox protein, redox-active center; HET: MES; 1.90A {Escherichia coli} SCOP: c.47.1.9 d.17.3.1 PDB: 1tjd_A 1jzd_A 1jzo_A 1g0t_A 2iyj_A | Back alignment and structure |
|---|
| >2lja_A Putative thiol-disulfide oxidoreductase; structural genomics, unknown function, thioredoxin-like; NMR {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >2l4c_A Endoplasmic reticulum resident protein 27; ERP27, PDI, B domain, peptide binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3gyk_A 27KDA outer membrane protein; APC61738.2, silicibacter pomeroyi DSS-3, thioredoxin-like, oxidoreductase, structural genomics, PSI-2; HET: MSE; 1.76A {Silicibacter pomeroyi} | Back alignment and structure |
|---|
| >3fkf_A Thiol-disulfide oxidoreductase; structural genomics, PSI-2, structure initiative, midwest center for structural genomic oxidoreductase; 2.20A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3hcz_A Possible thiol-disulfide isomerase; APC61559.2, cytophaga hutchinsoni structural genomics, PSI-2, protein structure initiative; 1.88A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >1sen_A Thioredoxin-like protein P19; endoplasmic reticulum, RP19, structural genomics, PSI, protein structure initiative; 1.20A {Homo sapiens} SCOP: c.47.1.1 PDB: 2k8v_A | Back alignment and structure |
|---|
| >1t3b_A Thiol:disulfide interchange protein DSBC; oxidoreductase, protein disulfide isomerase, protein folding, redox protein; 2.50A {Haemophilus influenzae} SCOP: c.47.1.9 d.17.3.1 | Back alignment and structure |
|---|
| >1uul_A Tryparedoxin peroxidase homologue; peroxiredoxin, oxidoreductase; 2.8A {Trypanosoma cruzi} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >2lrn_A Thiol:disulfide interchange protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, oxidoreductase; NMR {Bacteroides SP} | Back alignment and structure |
|---|
| >3lor_A Thiol-disulfide isomerase and thioredoxins; PSI, MCSG, structural genomics, midwest CE structural genomics; HET: MSE; 2.20A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >2h30_A Thioredoxin, peptide methionine sulfoxide reductase MSRA/MSRB; reduced, thiol-disulfide exchange, oxidoreductase; 1.60A {Neisseria gonorrhoeae} PDB: 2jzr_A 2jzs_A 2k9f_A 2fy6_A | Back alignment and structure |
|---|
| >4evm_A Thioredoxin family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.51A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >2b7k_A SCO1 protein; metallochaperone, cytochrome C oxidase, metal binding protein; 1.80A {Saccharomyces cerevisiae} SCOP: c.47.1.10 PDB: 2b7j_A | Back alignment and structure |
|---|
| >3ia1_A THIO-disulfide isomerase/thioredoxin; oxidoreductase, PSI-2, NYSGXRC, structu genomics, protein structure initiative; 1.76A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1zye_A Thioredoxin-dependent peroxide reductase; catenane, dodecamer, peroxiredoxin, oxidoreductase; 3.30A {Bos taurus} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >3ha9_A Uncharacterized thioredoxin-like protein; PSI, MCSG, structural G midwest center for structural genomics, protein structure initiative; 1.70A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1r7h_A NRDH-redoxin; thioredoxin, glutaredoxin, redox protein, domain swapping, electron transport; 2.69A {Corynebacterium ammoniagenes} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2h01_A 2-Cys peroxiredoxin; thioredoxin peroxidase, structural genomics, SGC, structural genomics consortium, oxidoreductase; 2.30A {Plasmodium yoelii} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >3h93_A Thiol:disulfide interchange protein DSBA; disulfide bond, redox-active center, transcription regulator; HET: MSE GOL; 1.50A {Pseudomonas aeruginosa PAO1} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >2i81_A 2-Cys peroxiredoxin; structural genomics consortium, SGC, oxidoreductase; 2.45A {Plasmodium vivax sai-1} PDB: 2h66_A | Back alignment and structure |
|---|
| >2jsy_A Probable thiol peroxidase; solution structure, antioxidant, oxidoreductase; NMR {Bacillus subtilis} PDB: 2jsz_A | Back alignment and structure |
|---|
| >3gl3_A Putative thiol:disulfide interchange protein DSBE; oxidoreductase, PSI-II, structural genomics, protein structure initiative; 2.09A {Chlorobium tepidum tls} | Back alignment and structure |
|---|
| >3ztl_A Thioredoxin peroxidase; oxidoreductase, reductase, schistosomiasis, thioredoxin fold; 3.00A {Schistosoma mansoni} PDB: 3zvj_A 3zvj_D | Back alignment and structure |
|---|
| >3kcm_A Thioredoxin family protein; SGX, thioredoxin protein, PSI, structural genomics, protein initiative; 2.45A {Geobacter metallireducens gs-15} | Back alignment and structure |
|---|
| >3lwa_A Secreted thiol-disulfide isomerase; thioredoxin, PSI, MCSG, structural genomics, midwest center for structural genomics; 1.75A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >1nm3_A Protein HI0572; hybrid, peroxiredoxin, glutaredoxin, electron transport; 2.80A {Haemophilus influenzae} SCOP: c.47.1.1 c.47.1.10 | Back alignment and structure |
|---|
| >1v58_A Thiol:disulfide interchange protein DSBG; reduced DSBG, redox protein, protein disulfide isomerase, thioredoxin fold; 1.70A {Escherichia coli} SCOP: c.47.1.9 d.17.3.1 PDB: 1v57_A 2h0i_A 2h0h_A 2h0g_A 2iy2_A | Back alignment and structure |
|---|
| >1kng_A Thiol:disulfide interchange protein CYCY; thioredoxin fold, cytochrome C maturation, atomic resolution oxidoreductase; 1.14A {Bradyrhizobium japonicum} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >3eyt_A Uncharacterized protein SPOA0173; thioredoxin-like superfamily protein SPOA0173, silicibacter DSS, structural genomics, PSI-2; 1.95A {Silicibacter pomeroyi} | Back alignment and structure |
|---|
| >2ywi_A Hypothetical conserved protein; uncharacterized conserved protein, NPPSFA, national project protein structural and functional analyses; 1.60A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >3bj5_A Protein disulfide-isomerase; thioredoxin fold, chaperone, endoplasmic reticulum, isomeras membrane, redox-active center; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3gkn_A Bacterioferritin comigratory protein; BCP, PRX, atypical 2-Cys, oxidoreduc; HET: BIH; 1.47A {Xanthomonas campestris PV} PDB: 3gkk_A 3gkm_A | Back alignment and structure |
|---|
| >2i3y_A Epididymal secretory glutathione peroxidase; thioredoxin fold, epididymal androgen related protein, struc genomics, structural genomics consortium; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2b1k_A Thiol:disulfide interchange protein DSBE; C-terminal thioredoxin-like domain, N-terminal beta-sheet, fingerprint rigion, oxidoreductase; 1.90A {Escherichia coli} PDB: 3k8n_A 2g0f_A 1z5y_E 2b1l_A | Back alignment and structure |
|---|
| >1xvq_A Thiol peroxidase; thioredoxin fold, structural genomics, PSI, protein structur initiative, TB structural genomics consortium, TBSGC; 1.75A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 1y25_A | Back alignment and structure |
|---|
| >3dml_A Putative uncharacterized protein; thioredoxin, oxidoreductase, sulfur oxidation, thiol- disulfide oxidoreductase; HET: MSE; 1.90A {Paracoccus denitrificans} PDB: 3d4t_A* | Back alignment and structure |
|---|
| >3hdc_A Thioredoxin family protein; ATCC53774, DSM 7210, , structural genomics, PSI-2, protein structure initiative; 1.77A {Geobacter metallireducens gs-15} | Back alignment and structure |
|---|
| >2cvb_A Probable thiol-disulfide isomerase/thioredoxin; redox protein, structural genomics, riken struc genomics/proteomics initiative, RSGI; 1.80A {Thermus thermophilus} SCOP: c.47.1.10 PDB: 2ywo_A | Back alignment and structure |
|---|
| >2c0d_A Thioredoxin peroxidase 2; peroxiredoxin, 2-Cys, thioredoxin dependant, mitochondrial, antioxidant, oxidoreductase, redox-active center; 1.78A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3ira_A Conserved protein; methanosarcina mazei,structural genomics, MCSG, protein structure initiative, midwest center for STRU genomics; 2.10A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3me7_A Putative uncharacterized protein; electron transfer protein, electron transport, structural GE PSI-2, protein structure initiative; 1.50A {Aquifex aeolicus} PDB: 3me8_A | Back alignment and structure |
|---|
| >2r37_A Glutathione peroxidase 3; plasma, structural genomics consort oxidoreductase, secreted, selenium, selenocysteine; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >2lrt_A Uncharacterized protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, nysgrc, PSI-biology; NMR {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >3fw2_A Thiol-disulfide oxidoreductase; structural genomics, APC61456.1, thiol-disulfide oxidoreduct TLPA-like family, PSI-2; 1.74A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2lqo_A Putative glutaredoxin RV3198.1/MT3292; TRX fold, oxidoreductase; NMR {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2fgx_A Putative thioredoxin; NET3, NESG, GFT-glutaredoxin-like, structural genomics, PSI, protein structure initiative; NMR {Nitrosomonas europaea} | Back alignment and structure |
|---|
| >2dlx_A UBX domain-containing protein 7; UAS domain, protein KIAA0794, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: c.47.1.24 | Back alignment and structure |
|---|
| >1jfu_A Thiol:disulfide interchange protein TLPA; thioredoxin-like, double disulfide bridge, membrane protein; 1.60A {Bradyrhizobium japonicum} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >3kh7_A Thiol:disulfide interchange protein DSBE; TRX-like, thiol-disulfide exchange, cell inner membrane, CYT C-type biogenesis, disulfide bond; 1.75A {Pseudomonas aeruginosa} PDB: 3kh9_A | Back alignment and structure |
|---|
| >3ewl_A Uncharacterized conserved protein BF1870; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; 2.00A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2hyx_A Protein DIPZ; thioredoxin fold, jelly-roll, structural genomics, TB struct genomics consortium, TBSGC, unknown function; 1.90A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1kte_A Thioltransferase; redox-active center, electron transport, acetylation; 2.20A {Sus scrofa} SCOP: c.47.1.1 PDB: 1jhb_A 1b4q_A* | Back alignment and structure |
|---|
| >2a4v_A Peroxiredoxin DOT5; yeast nuclear thiol peroxidase, atypical 2-Cys peroxiredoxin, oxidoreductase; 1.80A {Saccharomyces cerevisiae} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >3nzn_A Glutaredoxin; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics, rossmann fold; 1.10A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >1ttz_A Conserved hypothetical protein; structural genomics, unknown function, PSI, protein structure initiative; 2.11A {Xanthomonas campestris} SCOP: c.47.1.1 PDB: 1xpv_A | Back alignment and structure |
|---|
| >1z6n_A Hypothetical protein PA1234; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.47.1.1 PDB: 3lef_A | Back alignment and structure |
|---|
| >3kp9_A Vkorc1/thioredoxin domain protein; warfarin, disulfide formation, blood coagulation, oxidoreduc blood coagulation,oxidoreductase; HET: U10; 3.60A {Synechococcus SP} | Back alignment and structure |
|---|
| >3hd5_A Thiol:disulfide interchange protein DSBA; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.35A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >2pn8_A Peroxiredoxin-4; thioredoxin, oxidoreductase, structural genomics consortium, SGC; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2hze_A Glutaredoxin-1; thioredoxin fold, arsenic, dimethylarsenite., electron trans oxidoreductase; 1.80A {Ectromelia virus} PDB: 2hzf_A 2hze_B | Back alignment and structure |
|---|
| >3u5r_E Uncharacterized protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, hypothetical protein; 2.05A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2cq9_A GLRX2 protein, glutaredoxin 2; glutathione-S-transferase, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3qmx_A Glutaredoxin A, glutaredoxin 3; electron transport; 1.82A {Synechocystis SP} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3ic4_A Glutaredoxin (GRX-1); structural genomics, PSI, MCSG, protein structure initiative, midwest center for structural genomic oxidoreductase; 1.70A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3s9f_A Tryparedoxin; thioredoxin fold, disulfide reductase, electron transport; 1.80A {Leishmania major} | Back alignment and structure |
|---|
| >2ec4_A FAS-associated factor 1; UAS domain, protein FAF1, HFAF1, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1i5g_A Tryparedoxin II; electron transport; HET: TS5; 1.40A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1o6j_A 1o81_A 1oc8_A 1oc9_B 1fg4_A 1oc9_A | Back alignment and structure |
|---|
| >3a2v_A Probable peroxiredoxin; thioredoxin peroxidase, hydrogen peroxide, antioxidant, oxidoreductase, redox-active center; 1.65A {Aeropyrum pernix} PDB: 1x0r_A 2zct_A 2nvl_A 2e2g_A 2cv4_A* 3a5w_A 2e2m_A 3a2x_A 3a2w_A | Back alignment and structure |
|---|
| >3hz8_A Thiol:disulfide interchange protein DSBA; thiol-oxidoreductase, disulfide bond; 1.45A {Neisseria meningitidis MC58} PDB: 3dvw_A 3a3t_A | Back alignment and structure |
|---|
| >2znm_A Thiol:disulfide interchange protein DSBA; thioredoxin fold, DSBA-like, oxidoreductase; 2.30A {Neisseria meningitidis serogroup B} PDB: 3dvx_A | Back alignment and structure |
|---|
| >3ph9_A Anterior gradient protein 3 homolog; thioredoxin fold, protein disulfide isomerase, endoplasmic R isomerase; 1.83A {Homo sapiens} SCOP: c.47.1.0 PDB: 2lns_A 2lnt_A | Back alignment and structure |
|---|
| >1n8j_A AHPC, alkyl hydroperoxide reductase C22 protein; peroxiredoxin, decamer, antioxidant, peroxidase, AHPF, oxidoreductase; 2.17A {Salmonella typhimurium} SCOP: c.47.1.10 PDB: 1yep_A 1yf1_A 1yf0_A 1yex_A 3emp_A | Back alignment and structure |
|---|
| >1o8x_A Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrotron radiation, disulfide bonds tryparedoxin, thioredoxin, trypanosome; 1.3A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1okd_A 1qk8_A 1o85_A 1o8w_A 1o7u_A 1ezk_A 1ewx_A | Back alignment and structure |
|---|
| >3eur_A Uncharacterized protein; PSI2,MCSG, conserved protein, structural genomics, protein S initiative, midwest center for structural genomics; HET: MSE; 1.30A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1o73_A Tryparedoxin; electron transport, trypanosomatid, thioredoxin; 2.28A {Trypanosoma brucei brucei} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >2ht9_A Glutaredoxin-2; thioredoxin fold, iron-sulfur cluster, 2Fe2S, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: GSH; 1.90A {Homo sapiens} PDB: 2fls_A* | Back alignment and structure |
|---|
| >3qpm_A Peroxiredoxin; oxidoreductase, thioredoxin fold, peroxidase; 1.90A {Larimichthys crocea} | Back alignment and structure |
|---|
| >2ggt_A SCO1 protein homolog, mitochondrial; copper chaperone, Cu-binding protein, mitochondrial assembly factor, redox, nickel, disuplhide, mitochondrion; 2.40A {Homo sapiens} SCOP: c.47.1.10 PDB: 2gqk_A 2gql_A 2gqm_A 2gt5_A 2gt6_A 2gvp_A 2hrf_A 2hrn_A 1wp0_A | Back alignment and structure |
|---|
| >3cmi_A Peroxiredoxin HYR1; thioredoxin-like fold, oxidoreductase, peroxidase, redox-ACT center; 2.02A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1fov_A Glutaredoxin 3, GRX3; active site disulfide, CIS Pro 53, electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 3grx_A* | Back alignment and structure |
|---|
| >2rli_A SCO2 protein homolog, mitochondrial; copper protein, thioredoxin fold, metal transport, structural genomics, spine2-complexes; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2klx_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Bartonella henselae} | Back alignment and structure |
|---|
| >2vup_A Glutathione peroxidase-like protein; oxidoreductase, trypanothione, dithiol-dependant peroxidase; 2.10A {Trypanosoma brucei} | Back alignment and structure |
|---|
| >3gv1_A Disulfide interchange protein; neisseria gonorrhoeae (strain 700825 / FA 1090), DSBC, structural genomics, unknown funct 2; 2.00A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >3c1r_A Glutaredoxin-1; oxidized form, oxidoreductase, cytoplasm, electron transport, redox-active center, transport; HET: MES; 2.00A {Saccharomyces cerevisiae} PDB: 3c1s_A* 2jac_A* | Back alignment and structure |
|---|
| >2bmx_A Alkyl hydroperoxidase C; peroxiredoxin, antioxidant defense system, oxidoreductase, structural proteomics in EURO spine; 2.4A {Mycobacterium tuberculosis} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >4hde_A SCO1/SENC family lipoprotein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; HET: MSE; 1.32A {Bacillus anthracis} | Back alignment and structure |
|---|
| >4g2e_A Peroxiredoxin; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 1.40A {Sulfolobus tokodaii} PDB: 2ywn_A 3hjp_A | Back alignment and structure |
|---|
| >2yan_A Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2p5q_A Glutathione peroxidase 5; thioredoxin fold, oxidoreductase; 2.00A {Populus trichocarpa x populusdeltoides} PDB: 2p5r_A | Back alignment and structure |
|---|
| >2khp_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Brucella melitensis} | Back alignment and structure |
|---|
| >3tjj_A Peroxiredoxin-4; thioredoxin fold, sulfenylation, endoplasmic reticulum, oxidoreductase; HET: CSO; 1.91A {Homo sapiens} PDB: 3tjk_A 3tjb_A 3tjf_A 3tjg_A 3tkq_A 3tkp_A 3tks_A 3tkr_A 3tks_C | Back alignment and structure |
|---|
| >3l9v_A Putative thiol-disulfide isomerase or thioredoxin; thioredoxin-fold, SRGA, thiol-disulfide oxidoreductase, ISOM oxidoreductase; HET: PE8 P4C P6G; 2.15A {Salmonella enterica subsp} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >2v1m_A Glutathione peroxidase; selenium, selenocysteine, oxidoreductase, lipid peroxidase, schistosoma detoxification pathway; 1.00A {Schistosoma mansoni} PDB: 2wgr_A | Back alignment and structure |
|---|
| >3ixr_A Bacterioferritin comigratory protein; alpha beta protein, oxidoreductase; 1.60A {Xylella fastidiosa} | Back alignment and structure |
|---|
| >3dwv_A Glutathione peroxidase-like protein; alpha beta, 3-layer(ABA) sandwich, glutaredoxin fold, oxidor peroxidase; 1.41A {Trypanosoma brucei} PDB: 2rm5_A 2rm6_A 3e0u_A | Back alignment and structure |
|---|
| >2k6v_A Putative cytochrome C oxidase assembly protein; thioredoxin fold, electron transfer protein, metal binding protein, electron transport; NMR {Thermus thermophilus} | Back alignment and structure |
|---|
| >4fo5_A Thioredoxin-like protein; AHPC/TSA family protein, structural genomics, joint center F structural genomics, JCSG; 2.02A {Parabacteroides distasonis} | Back alignment and structure |
|---|
| >1q98_A Thiol peroxidase, TPX; structural genomics, NYSGXRC, PSI, protein structure initiative; 1.90A {Haemophilus influenzae} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >3drn_A Peroxiredoxin, bacterioferritin comigratory prote homolog; bacterioferritin comigratory protein, oxidore; HET: CIT; 2.15A {Sulfolobus solfataricus} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3rhb_A ATGRXC5, glutaredoxin-C5, chloroplastic; thioredoxin fold, thiol-disulfide oxidoreductase, glutaredox oxidoreductase; HET: GSH; 1.20A {Arabidopsis thaliana} PDB: 3rhc_A* 3fz9_A* 3fza_A* | Back alignment and structure |
|---|
| >3msz_A Glutaredoxin 1; alpha-beta sandwich, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: GSH; 2.05A {Francisella tularensis subsp} PDB: 3lgc_A* | Back alignment and structure |
|---|
| >2k8s_A Thioredoxin; dimer, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Nitrosomonas europaea} | Back alignment and structure |
|---|
| >2ls5_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, NEW structural genomics research consortium; NMR {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2wfc_A Peroxiredoxin 5, PRDX5; oxidoreductase, antioxidant enzymes; 1.75A {Arenicola marina} | Back alignment and structure |
|---|
| >1wjk_A C330018D20RIK protein; glutaredoxin, thioredoxin fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2yzh_A Probable thiol peroxidase; redox protein, antioxidant, oxidoreductase, STRU genomics, NPPSFA; 1.85A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1psq_A Probable thiol peroxidase; structural genomics, NYSGXRC, PSI, structure initiative, NEW YORK SGX research center for STRU genomics; 2.30A {Streptococcus pneumoniae} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >1tp9_A Peroxiredoxin, PRX D (type II); oligomer, thioredoxin fold, oxidoreductase; 1.62A {Populus trichocarpa} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >1zof_A Alkyl hydroperoxide-reductase; decamer, toroide-shaped complex, oxidoreductase; 2.95A {Helicobacter pylori} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >2p31_A CL683, glutathione peroxidase 7; thioredoxin fold, NPGPX, phospholipid hydroperoxidase, struc genomics, structural genomics consortium, SGC; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4gqc_A Thiol peroxidase, peroxiredoxin Q; CXXXXC motif, fully folded, locally unfolded, peroxide, DTT, structural genomics, riken; 2.00A {Aeropyrum pernix} PDB: 2cx3_A 2cx4_A 4gqf_A | Back alignment and structure |
|---|
| >1we0_A Alkyl hydroperoxide reductase C; peroxiredoxin, AHPC, oxidoreductase; 2.90A {Amphibacillus xylanus} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >2lus_A Thioredoxion; CR-Trp16, oxidoreductase; NMR {Carcinoscorpius rotundicauda} | Back alignment and structure |
|---|
| >1wik_A Thioredoxin-like protein 2; picot homology 2 domain, picot protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2pwj_A Mitochondrial peroxiredoxin; alpha and beta protein, oxidoreductase; 2.80A {Pisum sativum} | Back alignment and structure |
|---|
| >1xvw_A Hypothetical protein RV2238C/MT2298; thioredoxin fold, oxidized cystein sulfenic acid, structural genomics, PSI; 1.90A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 1xxu_A | Back alignment and structure |
|---|
| >3feu_A Putative lipoprotein; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Vibrio fischeri} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >1nm3_A Protein HI0572; hybrid, peroxiredoxin, glutaredoxin, electron transport; 2.80A {Haemophilus influenzae} SCOP: c.47.1.1 c.47.1.10 | Back alignment and structure |
|---|
| >3h8q_A Thioredoxin reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC, developmental protein, differentiation; 2.21A {Homo sapiens} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3zrd_A Thiol peroxidase; oxidoreductase, 2Cys peroxiredoxin, thioredoxin-fold, ROS PR; 1.74A {Yersinia pseudotuberculosis} PDB: 2xpe_A 2xpd_A 3zre_A 2yjh_A 4af2_A 3hvs_A* 1qxh_A* 3i43_A* 3hvv_A 3hvx_A | Back alignment and structure |
|---|
| >3uma_A Hypothetical peroxiredoxin protein; nysgrc, PSI biology, structural genomics, NEW YORK structura genomics research consortium; 2.20A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3kij_A Probable glutathione peroxidase 8; human PDI-peroxidase, membrane, oxidoreductase, transmembrane; 1.80A {Homo sapiens} SCOP: c.47.1.0 PDB: 3cyn_A | Back alignment and structure |
|---|
| >2f8a_A Glutathione peroxidase 1; thioredoxin fold, structural genomics, structural genomics consortium, SGC, oxidoreductase; 1.50A {Homo sapiens} SCOP: c.47.1.10 PDB: 1gp1_A 2he3_A | Back alignment and structure |
|---|
| >2obi_A PHGPX, GPX-4, phospholipid hydroperoxide glutathione peroxidase (GPX4); human GPX4, selenoprotein, thioredoxin-fold, anti-oxidatve defense system; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >3gyk_A 27KDA outer membrane protein; APC61738.2, silicibacter pomeroyi DSS-3, thioredoxin-like, oxidoreductase, structural genomics, PSI-2; HET: MSE; 1.76A {Silicibacter pomeroyi} | Back alignment and structure |
|---|
| >1z6m_A Conserved hypothetical protein; structural genomics, MCSG,, protein structure initiative, midwest center for structural genomics; HET: MSE; 1.30A {Enterococcus faecalis} SCOP: c.47.1.13 | Back alignment and structure |
|---|
| >2e7p_A Glutaredoxin; thioredoxin fold, poplar, electron transport; HET: GSH; 2.10A {Populus tremula x populus tremuloides} PDB: 1z7p_A 1z7r_A | Back alignment and structure |
|---|
| >1un2_A DSBA, thiol-disulfide interchange protein; disulfide oxidoreductase, oxidoreductase, protein disulfide isomerase, protein folding, thioredoxin; 2.4A {Escherichia coli} SCOP: c.47.1.13 | Back alignment and structure |
|---|
| >3ctg_A Glutaredoxin-2; reduced form, electron transport, mitochondrion, redox-activ transit peptide, transport, oxidoreductase; 1.50A {Saccharomyces cerevisiae} PDB: 3ctf_A 3d4m_A 3d5j_A* | Back alignment and structure |
|---|
| >2gs3_A PHGPX, GPX-4, phospholipid hydroperoxide glutathione peroxidase; GSHPX-4,phospholipid hydroperoxide; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3p7x_A Probable thiol peroxidase; thioredoxin fold, oxidoreductase; HET: PG4; 1.96A {Staphylococcus aureus} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >2rem_A Disulfide oxidoreductase; disulfide oxidoreductase, DSBA, thioredoxin fold, redox- active center; 1.90A {Xylella fastidiosa} | Back alignment and structure |
|---|
| >1ego_A Glutaredoxin; electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 1egr_A 1grx_A* 1qfn_A | Back alignment and structure |
|---|
| >3mng_A Peroxiredoxin-5, mitochondrial; peroxidase, PRXV, substrate analog, DTT, oxidoreductase; 1.45A {Homo sapiens} SCOP: c.47.1.10 PDB: 2vl3_A 1oc3_A 2vl2_A 2vl9_A 1urm_A 1hd2_A 1h4o_A | Back alignment and structure |
|---|
| >1uul_A Tryparedoxin peroxidase homologue; peroxiredoxin, oxidoreductase; 2.8A {Trypanosoma cruzi} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >1zye_A Thioredoxin-dependent peroxide reductase; catenane, dodecamer, peroxiredoxin, oxidoreductase; 3.30A {Bos taurus} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >2i81_A 2-Cys peroxiredoxin; structural genomics consortium, SGC, oxidoreductase; 2.45A {Plasmodium vivax sai-1} PDB: 2h66_A | Back alignment and structure |
|---|
| >3l9s_A Thiol:disulfide interchange protein; thioredoxin-fold, DSBA, thiol-disulfide oxidoreductase, DISU bond, redox-active center; 1.58A {Salmonella enterica subsp} SCOP: c.47.1.13 PDB: 1a23_A 1a24_A 1a2j_A 1a2l_A 1a2m_A 1dsb_A 1fvk_A 3dks_A 1bq7_A 1fvj_A 1acv_A 1u3a_A* 1ti1_A* 2hi7_A* 2leg_A* 2zup_A* 3e9j_B* 1ac1_A 2b6m_A 2b3s_A | Back alignment and structure |
|---|
| >1xzo_A BSSCO, hypothetical protein YPMQ; thioredoxin-like fold, structural genomics, montreal-kingsto bacterial structural genomics initiative, BSGI; 1.70A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1on4_A | Back alignment and structure |
|---|
| >2b7k_A SCO1 protein; metallochaperone, cytochrome C oxidase, metal binding protein; 1.80A {Saccharomyces cerevisiae} SCOP: c.47.1.10 PDB: 2b7j_A | Back alignment and structure |
|---|
| >2v2g_A Peroxiredoxin 6; oxidoreductase, antioxidant enzymes; 1.60A {Arenicola marina} PDB: 2v32_A 2v41_A | Back alignment and structure |
|---|
| >1prx_A HORF6; peroxiredoxin, hydrogen peroxide, redox regulation, cellular signaling, antioxidant; 2.00A {Homo sapiens} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >2h01_A 2-Cys peroxiredoxin; thioredoxin peroxidase, structural genomics, SGC, structural genomics consortium, oxidoreductase; 2.30A {Plasmodium yoelii} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >2jsy_A Probable thiol peroxidase; solution structure, antioxidant, oxidoreductase; NMR {Bacillus subtilis} PDB: 2jsz_A | Back alignment and structure |
|---|
| >3gx8_A Monothiol glutaredoxin-5, mitochondrial; TRX fold, electron transport, mitochondrion, redox-active center, transit peptide, transport; 1.67A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2wci_A Glutaredoxin-4; redox-active center, iron-sulfur cluster scaffolder, Fe2S2, homodimer, transport, glutathione, thioredoxin fold; HET: GSH; 1.90A {Escherichia coli} PDB: 1yka_A | Back alignment and structure |
|---|
| >1eej_A Thiol:disulfide interchange protein; oxidoreductase, protein disulfide isomerase, protein folding, redox protein, redox-active center; HET: MES; 1.90A {Escherichia coli} SCOP: c.47.1.9 d.17.3.1 PDB: 1tjd_A 1jzd_A 1jzo_A 1g0t_A 2iyj_A | Back alignment and structure |
|---|
| >2ct6_A SH3 domain-binding glutamic acid-rich-like protein 2; SH3BGRL2,FASH3, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1aba_A Glutaredoxin; electron transport; HET: MES; 1.45A {Enterobacteria phage T4} SCOP: c.47.1.1 PDB: 1aaz_A 1de1_A 1de2_A | Back alignment and structure |
|---|
| >3zyw_A Glutaredoxin-3; metal binding protein; 1.84A {Homo sapiens} | Back alignment and structure |
|---|
| >1xcc_A 1-Cys peroxiredoxin; unknown function, structural genomics, structural genomics consortium, SGC; 2.30A {Plasmodium yoelii} SCOP: c.47.1.10 PDB: 3tb2_A | Back alignment and structure |
|---|
| >3ipz_A Monothiol glutaredoxin-S14, chloroplastic; electron transport, PL redox-active center, transit peptide, transport, oxidoreduc; 2.40A {Arabidopsis thaliana} PDB: 2lku_A | Back alignment and structure |
|---|
| >3ztl_A Thioredoxin peroxidase; oxidoreductase, reductase, schistosomiasis, thioredoxin fold; 3.00A {Schistosoma mansoni} PDB: 3zvj_A 3zvj_D | Back alignment and structure |
|---|
| >3c7m_A Thiol:disulfide interchange protein DSBA-like; redox protein, periplasm, redox-active center, oxidoreductase; HET: PGE; 1.55A {Escherichia coli} PDB: 3l9u_A | Back alignment and structure |
|---|
| >1t1v_A SH3BGRL3, SH3 domain-binding glutamic acid-rich protein-LIK; glutaredoxin, thioredoxin fold, protein 3D-structure, X-RAY crystallography; 1.60A {Mus musculus} SCOP: c.47.1.14 PDB: 1j0f_A 1sj6_A | Back alignment and structure |
|---|
| >1t3b_A Thiol:disulfide interchange protein DSBC; oxidoreductase, protein disulfide isomerase, protein folding, redox protein; 2.50A {Haemophilus influenzae} SCOP: c.47.1.9 d.17.3.1 | Back alignment and structure |
|---|
| >4dvc_A Thiol:disulfide interchange protein DSBA; pilus assembly, oxidoreductase, thioredoxin fold, D disulfide bond, DSBB; HET: DMS; 1.20A {Vibrio cholerae} PDB: 2ijy_A 1bed_A | Back alignment and structure |
|---|
| >3gkn_A Bacterioferritin comigratory protein; BCP, PRX, atypical 2-Cys, oxidoreduc; HET: BIH; 1.47A {Xanthomonas campestris PV} PDB: 3gkk_A 3gkm_A | Back alignment and structure |
|---|
| >1xvq_A Thiol peroxidase; thioredoxin fold, structural genomics, PSI, protein structur initiative, TB structural genomics consortium, TBSGC; 1.75A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 1y25_A | Back alignment and structure |
|---|
| >2axo_A Hypothetical protein ATU2684; alpha beta protein., structural genomics, PSI, protein struc initiative; 1.80A {Agrobacterium tumefaciens str} SCOP: c.47.1.19 | Back alignment and structure |
|---|
| >1h75_A Glutaredoxin-like protein NRDH; electron transport, thioredoxin, redox protein; 1.7A {Escherichia coli} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1v58_A Thiol:disulfide interchange protein DSBG; reduced DSBG, redox protein, protein disulfide isomerase, thioredoxin fold; 1.70A {Escherichia coli} SCOP: c.47.1.9 d.17.3.1 PDB: 1v57_A 2h0i_A 2h0h_A 2h0g_A 2iy2_A | Back alignment and structure |
|---|
| >1r7h_A NRDH-redoxin; thioredoxin, glutaredoxin, redox protein, domain swapping, electron transport; 2.69A {Corynebacterium ammoniagenes} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3h93_A Thiol:disulfide interchange protein DSBA; disulfide bond, redox-active center, transcription regulator; HET: MSE GOL; 1.50A {Pseudomonas aeruginosa PAO1} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3gha_A Disulfide bond formation protein D; BDBD, DSBA-like, TRX-like, oxidoreductase, competence, redox-active center; 1.40A {Bacillus subtilis} PDB: 3eu4_A 3gh9_A 3eu3_A | Back alignment and structure |
|---|
| >3sbc_A Peroxiredoxin TSA1; alpha-beta fold, peroxidase, cytosol, oxidoreductase; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4f82_A Thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.85A {Burkholderia cenocepacia} | Back alignment and structure |
|---|
| >2i3y_A Epididymal secretory glutathione peroxidase; thioredoxin fold, epididymal androgen related protein, struc genomics, structural genomics consortium; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2wul_A Glutaredoxin related protein 5; chromosome 14 open reading frame 87, oxidoreductase, thiored family, GLRX5, FLB4739; HET: GSH; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1kte_A Thioltransferase; redox-active center, electron transport, acetylation; 2.20A {Sus scrofa} SCOP: c.47.1.1 PDB: 1jhb_A 1b4q_A* | Back alignment and structure |
|---|
| >3bci_A Disulfide bond protein A; thiol-disulfide oxidoreductase, redox protein, protein folding, redox active centre; 1.81A {Staphylococcus aureus} PDB: 3bd2_A 3bck_A | Back alignment and structure |
|---|
| >2a4v_A Peroxiredoxin DOT5; yeast nuclear thiol peroxidase, atypical 2-Cys peroxiredoxin, oxidoreductase; 1.80A {Saccharomyces cerevisiae} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >3l4n_A Monothiol glutaredoxin-6; C-terminal domain of GRX6, oxidoreductase; HET: GSH; 1.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3a2v_A Probable peroxiredoxin; thioredoxin peroxidase, hydrogen peroxide, antioxidant, oxidoreductase, redox-active center; 1.65A {Aeropyrum pernix} PDB: 1x0r_A 2zct_A 2nvl_A 2e2g_A 2cv4_A* 3a5w_A 2e2m_A 3a2x_A 3a2w_A | Back alignment and structure |
|---|
| >2r37_A Glutathione peroxidase 3; plasma, structural genomics consort oxidoreductase, secreted, selenium, selenocysteine; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >2yzh_A Probable thiol peroxidase; redox protein, antioxidant, oxidoreductase, STRU genomics, NPPSFA; 1.85A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3f4s_A Alpha-DSBA1, putative uncharacterized protein; thioredoxin-fold, oxidoreductase; HET: PGE; 1.55A {Wolbachia pipientis} PDB: 3f4r_A* 3f4t_A* | Back alignment and structure |
|---|
| >1q98_A Thiol peroxidase, TPX; structural genomics, NYSGXRC, PSI, protein structure initiative; 1.90A {Haemophilus influenzae} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >3gn3_A Putative protein-disulfide isomerase; MCSG, PSI, structural GEN protein structure initiative, midwest center for structural genomics; 2.50A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >1u6t_A SH3 domain-binding glutamic acid-rich-like protein; SH3-binding, glutaredoxin, thioredoxin fold, crystallography, protein binding; HET: CIT; 1.90A {Homo sapiens} PDB: 1wry_A | Back alignment and structure |
|---|
| >1psq_A Probable thiol peroxidase; structural genomics, NYSGXRC, PSI, structure initiative, NEW YORK SGX research center for STRU genomics; 2.30A {Streptococcus pneumoniae} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >3ixr_A Bacterioferritin comigratory protein; alpha beta protein, oxidoreductase; 1.60A {Xylella fastidiosa} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 360 | ||||
| d2djka1 | 133 | c.47.1.2 (A:1-133) Protein disulfide isomerase, PD | 3e-21 | |
| d2b5ea1 | 140 | c.47.1.2 (A:365-504) Protein disulfide isomerase, | 5e-20 | |
| d2djja1 | 116 | c.47.1.2 (A:6-121) Protein disulfide isomerase, PD | 6e-17 | |
| d1bjxa_ | 110 | c.47.1.2 (A:) Protein disulfide isomerase, PDI {Hu | 9e-13 | |
| d1thxa_ | 108 | c.47.1.1 (A:) Thioredoxin {Anabaena sp., pcc 7120 | 6e-11 | |
| d2b5ea3 | 125 | c.47.1.2 (A:240-364) Protein disulfide isomerase, | 7e-11 | |
| d1meka_ | 120 | c.47.1.2 (A:) Protein disulfide isomerase, PDI {Hu | 2e-10 | |
| d1g7ea_ | 122 | c.47.1.7 (A:) Endoplasmic reticulum protein ERP29, | 7e-10 | |
| d1dbya_ | 107 | c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardt | 3e-09 | |
| d2trxa_ | 108 | c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId | 4e-09 | |
| d2c0ga2 | 122 | c.47.1.7 (A:1024-1145) Windbeutel, N-terminal doma | 6e-09 | |
| d2b5ea4 | 119 | c.47.1.2 (A:23-141) Protein disulfide isomerase, P | 9e-08 | |
| d1fb6a_ | 104 | c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia olera | 1e-07 | |
| d1nw2a_ | 105 | c.47.1.1 (A:) Thioredoxin {Alicyclobacillus acidoc | 5e-07 | |
| d1a8ya1 | 124 | c.47.1.3 (A:3-126) Calsequestrin {Rabbit (Oryctola | 1e-06 | |
| d1ep7a_ | 112 | c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardt | 4e-06 | |
| d1nhoa_ | 85 | c.47.1.1 (A:) MTH807, thioredoxin/glutaredoxin-lik | 6e-06 | |
| d1qgva_ | 137 | c.47.1.8 (A:) spliceosomal protein U5-15Kd {Human | 7e-06 | |
| d2es7a1 | 119 | c.47.1.20 (A:7-125) Hydrogenase-1 operon protein H | 7e-06 | |
| d2hfda1 | 132 | c.47.1.20 (A:1-132) Hydrogenase-1 operon protein H | 8e-06 | |
| d1f9ma_ | 112 | c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia olera | 4e-05 | |
| d2trcp_ | 217 | c.47.1.6 (P:) Phosducin {Rat (Rattus norvegicus) [ | 5e-05 | |
| d1syra_ | 103 | c.47.1.1 (A:) Thioredoxin {Malarial parasite (Plas | 5e-05 | |
| d1xwaa_ | 111 | c.47.1.1 (A:) Thioredoxin {Fruit fly (Drosophila m | 1e-04 | |
| d1ti3a_ | 113 | c.47.1.1 (A:) Thioredoxin {European aspen (Populus | 3e-04 | |
| d1gh2a_ | 107 | c.47.1.1 (A:) Thioredoxin-like protein, N-terminal | 5e-04 | |
| d1fo5a_ | 85 | c.47.1.1 (A:) MJ0307, thioredoxin/glutaredoxin-lik | 8e-04 | |
| d1xfla_ | 114 | c.47.1.1 (A:) Thioredoxin {Thale cress (Arabidopsi | 0.004 |
| >d2djka1 c.47.1.2 (A:1-133) Protein disulfide isomerase, PDI {Fungi (Humicola insolens) [TaxId: 34413]} Length = 133 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Thioredoxin fold superfamily: Thioredoxin-like family: PDI-like domain: Protein disulfide isomerase, PDI species: Fungi (Humicola insolens) [TaxId: 34413]
Score = 86.1 bits (213), Expect = 3e-21
Identities = 29/126 (23%), Positives = 51/126 (40%), Gaps = 1/126 (0%)
Query: 102 PLVTKLTDINSASVHSSPIKLQVYVFAKADDLKSLLEPLEDIARNFKGKIMFTAVDIADE 161
PL+ ++ + S+ I L A++ K L + L+ IA +G I F +D
Sbjct: 6 PLIGEIGPETYSDYMSAGIPLAYIFAETAEERKELSDKLKPIAEAQRGVINFGTIDAKAF 65
Query: 162 DLAKPFLTLFGLEESKNTVVTAFDNKAISKFLLESDLTPSNIEEFCSRLLHGTLTPYLKS 221
L L ++ + F E ++T I+ F + G + P +KS
Sbjct: 66 GAHAGNLNLKT-DKFPAFAIQEVAKNQKFPFDQEKEITFEAIKAFVDDFVAGKIEPSIKS 124
Query: 222 QPIPDN 227
+PIP+
Sbjct: 125 EPIPEK 130
|
| >d2b5ea1 c.47.1.2 (A:365-504) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 140 | Back information, alignment and structure |
|---|
| >d2djja1 c.47.1.2 (A:6-121) Protein disulfide isomerase, PDI {Fungi (Humicola insolens) [TaxId: 34413]} Length = 116 | Back information, alignment and structure |
|---|
| >d1bjxa_ c.47.1.2 (A:) Protein disulfide isomerase, PDI {Human (Homo sapiens) [TaxId: 9606]} Length = 110 | Back information, alignment and structure |
|---|
| >d1thxa_ c.47.1.1 (A:) Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} Length = 108 | Back information, alignment and structure |
|---|
| >d2b5ea3 c.47.1.2 (A:240-364) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 125 | Back information, alignment and structure |
|---|
| >d1meka_ c.47.1.2 (A:) Protein disulfide isomerase, PDI {Human (Homo sapiens) [TaxId: 9606]} Length = 120 | Back information, alignment and structure |
|---|
| >d1g7ea_ c.47.1.7 (A:) Endoplasmic reticulum protein ERP29, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 122 | Back information, alignment and structure |
|---|
| >d1dbya_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} Length = 107 | Back information, alignment and structure |
|---|
| >d2trxa_ c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId: 562]} Length = 108 | Back information, alignment and structure |
|---|
| >d2c0ga2 c.47.1.7 (A:1024-1145) Windbeutel, N-terminal domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 122 | Back information, alignment and structure |
|---|
| >d2b5ea4 c.47.1.2 (A:23-141) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 119 | Back information, alignment and structure |
|---|
| >d1fb6a_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin M [TaxId: 3562]} Length = 104 | Back information, alignment and structure |
|---|
| >d1nw2a_ c.47.1.1 (A:) Thioredoxin {Alicyclobacillus acidocaldarius, formerly Bacillus acidocaldarius [TaxId: 405212]} Length = 105 | Back information, alignment and structure |
|---|
| >d1a8ya1 c.47.1.3 (A:3-126) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 124 | Back information, alignment and structure |
|---|
| >d1ep7a_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} Length = 112 | Back information, alignment and structure |
|---|
| >d1nhoa_ c.47.1.1 (A:) MTH807, thioredoxin/glutaredoxin-like protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 85 | Back information, alignment and structure |
|---|
| >d1qgva_ c.47.1.8 (A:) spliceosomal protein U5-15Kd {Human (Homo sapiens) [TaxId: 9606]} Length = 137 | Back information, alignment and structure |
|---|
| >d2es7a1 c.47.1.20 (A:7-125) Hydrogenase-1 operon protein HyaE {Salmonella typhimurium [TaxId: 90371]} Length = 119 | Back information, alignment and structure |
|---|
| >d2hfda1 c.47.1.20 (A:1-132) Hydrogenase-1 operon protein HyaE {Escherichia coli [TaxId: 562]} Length = 132 | Back information, alignment and structure |
|---|
| >d1f9ma_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin F [TaxId: 3562]} Length = 112 | Back information, alignment and structure |
|---|
| >d2trcp_ c.47.1.6 (P:) Phosducin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 217 | Back information, alignment and structure |
|---|
| >d1syra_ c.47.1.1 (A:) Thioredoxin {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 103 | Back information, alignment and structure |
|---|
| >d1xwaa_ c.47.1.1 (A:) Thioredoxin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 111 | Back information, alignment and structure |
|---|
| >d1ti3a_ c.47.1.1 (A:) Thioredoxin {European aspen (Populus tremula), thioredoxin H [TaxId: 113636]} Length = 113 | Back information, alignment and structure |
|---|
| >d1gh2a_ c.47.1.1 (A:) Thioredoxin-like protein, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d1fo5a_ c.47.1.1 (A:) MJ0307, thioredoxin/glutaredoxin-like protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 85 | Back information, alignment and structure |
|---|
| >d1xfla_ c.47.1.1 (A:) Thioredoxin {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 114 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 360 | |||
| d2b5ea1 | 140 | Protein disulfide isomerase, PDI {Baker's yeast (S | 99.94 | |
| d2b5ea4 | 119 | Protein disulfide isomerase, PDI {Baker's yeast (S | 99.9 | |
| d2djja1 | 116 | Protein disulfide isomerase, PDI {Fungi (Humicola | 99.89 | |
| d1meka_ | 120 | Protein disulfide isomerase, PDI {Human (Homo sapi | 99.88 | |
| d1thxa_ | 108 | Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} | 99.87 | |
| d2trxa_ | 108 | Thioredoxin {Escherichia coli [TaxId: 562]} | 99.87 | |
| d1fb6a_ | 104 | Thioredoxin {Spinach (Spinacia oleracea), thioredo | 99.87 | |
| d1dbya_ | 107 | Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 | 99.86 | |
| d1bjxa_ | 110 | Protein disulfide isomerase, PDI {Human (Homo sapi | 99.85 | |
| d1nw2a_ | 105 | Thioredoxin {Alicyclobacillus acidocaldarius, form | 99.84 | |
| d2djka1 | 133 | Protein disulfide isomerase, PDI {Fungi (Humicola | 99.83 | |
| d1a8ya1 | 124 | Calsequestrin {Rabbit (Oryctolagus cuniculus) [Tax | 99.83 | |
| d1a8ya2 | 102 | Calsequestrin {Rabbit (Oryctolagus cuniculus) [Tax | 99.79 | |
| d2c0ga2 | 122 | Windbeutel, N-terminal domain {Fruit fly (Drosophi | 99.79 | |
| d1ep7a_ | 112 | Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 | 99.78 | |
| d1f9ma_ | 112 | Thioredoxin {Spinach (Spinacia oleracea), thioredo | 99.76 | |
| d1gh2a_ | 107 | Thioredoxin-like protein, N-terminal domain {Human | 99.75 | |
| d1g7ea_ | 122 | Endoplasmic reticulum protein ERP29, N-terminal do | 99.75 | |
| d1xfla_ | 114 | Thioredoxin {Thale cress (Arabidopsis thaliana) [T | 99.75 | |
| d1xwaa_ | 111 | Thioredoxin {Fruit fly (Drosophila melanogaster) [ | 99.74 | |
| d2ifqa1 | 105 | Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} | 99.74 | |
| d1ti3a_ | 113 | Thioredoxin {European aspen (Populus tremula), thi | 99.74 | |
| d1syra_ | 103 | Thioredoxin {Malarial parasite (Plasmodium falcipa | 99.73 | |
| d1r26a_ | 113 | Thioredoxin {Trypanosoma brucei [TaxId: 5691]} | 99.7 | |
| d1qgva_ | 137 | spliceosomal protein U5-15Kd {Human (Homo sapiens) | 99.69 | |
| d1fo5a_ | 85 | MJ0307, thioredoxin/glutaredoxin-like protein {Arc | 99.69 | |
| d1a8la2 | 107 | Protein disulfide isomerase, PDI {Archaeon Pyrococ | 99.67 | |
| d2es7a1 | 119 | Hydrogenase-1 operon protein HyaE {Salmonella typh | 99.65 | |
| d1nhoa_ | 85 | MTH807, thioredoxin/glutaredoxin-like protein {Arc | 99.65 | |
| d2hfda1 | 132 | Hydrogenase-1 operon protein HyaE {Escherichia col | 99.64 | |
| d2b5ea3 | 125 | Protein disulfide isomerase, PDI {Baker's yeast (S | 99.61 | |
| d1zmaa1 | 115 | Bacterocin transport accessory protein Bta {Strept | 99.61 | |
| d2b5ea4 | 119 | Protein disulfide isomerase, PDI {Baker's yeast (S | 99.6 | |
| d1thxa_ | 108 | Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} | 99.58 | |
| d1nw2a_ | 105 | Thioredoxin {Alicyclobacillus acidocaldarius, form | 99.52 | |
| d1fb6a_ | 104 | Thioredoxin {Spinach (Spinacia oleracea), thioredo | 99.51 | |
| d1woua_ | 119 | Putative 42-9-9 protein (thioredoxin containing pr | 99.5 | |
| d2fwha1 | 117 | Thiol:disulfide interchange protein DsbD, C-termin | 99.5 | |
| d1dbya_ | 107 | Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 | 99.49 | |
| d1hyua4 | 96 | Alkyl hydroperoxide reductase subunit F (AhpF), N- | 99.49 | |
| d2trxa_ | 108 | Thioredoxin {Escherichia coli [TaxId: 562]} | 99.47 | |
| d1meka_ | 120 | Protein disulfide isomerase, PDI {Human (Homo sapi | 99.46 | |
| d1a8ya1 | 124 | Calsequestrin {Rabbit (Oryctolagus cuniculus) [Tax | 99.45 | |
| d2trcp_ | 217 | Phosducin {Rat (Rattus norvegicus) [TaxId: 10116]} | 99.37 | |
| d2b5ea1 | 140 | Protein disulfide isomerase, PDI {Baker's yeast (S | 99.36 | |
| d2djja1 | 116 | Protein disulfide isomerase, PDI {Fungi (Humicola | 99.35 | |
| d2c0ga2 | 122 | Windbeutel, N-terminal domain {Fruit fly (Drosophi | 99.35 | |
| d1ep7a_ | 112 | Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 | 99.28 | |
| d1r26a_ | 113 | Thioredoxin {Trypanosoma brucei [TaxId: 5691]} | 99.27 | |
| d1f9ma_ | 112 | Thioredoxin {Spinach (Spinacia oleracea), thioredo | 99.22 | |
| d1xfla_ | 114 | Thioredoxin {Thale cress (Arabidopsis thaliana) [T | 99.18 | |
| d1syra_ | 103 | Thioredoxin {Malarial parasite (Plasmodium falcipa | 99.18 | |
| d1gh2a_ | 107 | Thioredoxin-like protein, N-terminal domain {Human | 99.15 | |
| d1a8la2 | 107 | Protein disulfide isomerase, PDI {Archaeon Pyrococ | 99.15 | |
| d1g7ea_ | 122 | Endoplasmic reticulum protein ERP29, N-terminal do | 99.13 | |
| d2ifqa1 | 105 | Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} | 99.12 | |
| d1xwaa_ | 111 | Thioredoxin {Fruit fly (Drosophila melanogaster) [ | 99.12 | |
| d1ti3a_ | 113 | Thioredoxin {European aspen (Populus tremula), thi | 99.11 | |
| d1nhoa_ | 85 | MTH807, thioredoxin/glutaredoxin-like protein {Arc | 99.04 | |
| d1zzoa1 | 134 | Lipoprotein DsbF {Mycobacterium tuberculosis [TaxI | 99.03 | |
| d1z5ye1 | 136 | Thioredoxin-like protein CcmG (CycY, DsbE) {Escher | 99.02 | |
| d1fo5a_ | 85 | MJ0307, thioredoxin/glutaredoxin-like protein {Arc | 99.02 | |
| d1sena_ | 135 | Thioredoxin-like protein p19, TLP19 {Human (Homo s | 99.0 | |
| d2fy6a1 | 143 | Peptide methionine sulfoxide reductase MsrA/MsrB, | 98.99 | |
| d2es7a1 | 119 | Hydrogenase-1 operon protein HyaE {Salmonella typh | 98.99 | |
| d1zmaa1 | 115 | Bacterocin transport accessory protein Bta {Strept | 98.97 | |
| d2hfda1 | 132 | Hydrogenase-1 operon protein HyaE {Escherichia col | 98.94 | |
| d1qgva_ | 137 | spliceosomal protein U5-15Kd {Human (Homo sapiens) | 98.91 | |
| d2b5xa1 | 143 | thiol:disulfide oxidoreductase YkuV {Bacillus subt | 98.9 | |
| d1lu4a_ | 134 | Soluble secreted antigen MPT53 {Mycobacterium tube | 98.9 | |
| d1knga_ | 144 | Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyr | 98.88 | |
| d2dlxa1 | 147 | UBX domain-containing protein 7 {Human (Homo sapie | 98.86 | |
| d1st9a_ | 137 | Thiol-disulfide oxidoreductase ResA {Bacillus subt | 98.8 | |
| d1i5ga_ | 144 | Tryparedoxin II {Crithidia fasciculata [TaxId: 565 | 98.77 | |
| d1wjka_ | 100 | Thioredoxin-like structure containing protein C330 | 98.76 | |
| d1hyua4 | 96 | Alkyl hydroperoxide reductase subunit F (AhpF), N- | 98.74 | |
| d1o73a_ | 144 | Tryparedoxin I {Trypanosoma brucei brucei [TaxId: | 98.63 | |
| d1woua_ | 119 | Putative 42-9-9 protein (thioredoxin containing pr | 98.58 | |
| d1jfua_ | 176 | Membrane-anchored thioredoxin-like protein TlpA, s | 98.52 | |
| d2cvba1 | 187 | Probable thiol-disulfide isomerase/thioredoxin TTH | 98.5 | |
| d1o8xa_ | 144 | Tryparedoxin I {Crithidia fasciculata [TaxId: 5656 | 98.44 | |
| d2fwha1 | 117 | Thiol:disulfide interchange protein DsbD, C-termin | 98.37 | |
| d1z6na1 | 166 | Hypothetical protein PA1234 {Pseudomonas aeruginos | 98.14 | |
| d2trcp_ | 217 | Phosducin {Rat (Rattus norvegicus) [TaxId: 10116]} | 98.13 | |
| d2djka1 | 133 | Protein disulfide isomerase, PDI {Fungi (Humicola | 98.08 | |
| d2b5ea2 | 98 | Protein disulfide isomerase, PDI {Baker's yeast (S | 97.85 | |
| d2dlxa1 | 147 | UBX domain-containing protein 7 {Human (Homo sapie | 97.83 | |
| d2fy6a1 | 143 | Peptide methionine sulfoxide reductase MsrA/MsrB, | 97.74 | |
| d2b5xa1 | 143 | thiol:disulfide oxidoreductase YkuV {Bacillus subt | 97.63 | |
| d1zzoa1 | 134 | Lipoprotein DsbF {Mycobacterium tuberculosis [TaxI | 97.59 | |
| d1lu4a_ | 134 | Soluble secreted antigen MPT53 {Mycobacterium tube | 97.51 | |
| d1st9a_ | 137 | Thiol-disulfide oxidoreductase ResA {Bacillus subt | 97.5 | |
| d1a8la1 | 119 | Protein disulfide isomerase, PDI {Archaeon Pyrococ | 97.48 | |
| d1knga_ | 144 | Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyr | 97.42 | |
| d2b5ea3 | 125 | Protein disulfide isomerase, PDI {Baker's yeast (S | 97.3 | |
| d1z5ye1 | 136 | Thioredoxin-like protein CcmG (CycY, DsbE) {Escher | 97.3 | |
| d1a8ya3 | 119 | Calsequestrin {Rabbit (Oryctolagus cuniculus) [Tax | 97.27 | |
| d2cvba1 | 187 | Probable thiol-disulfide isomerase/thioredoxin TTH | 97.17 | |
| d1wjka_ | 100 | Thioredoxin-like structure containing protein C330 | 97.08 | |
| d1z6ma1 | 172 | Hypothetical protein EF0770 {Enterococcus faecalis | 96.99 | |
| d1egoa_ | 85 | Glutaredoxin (Grx, thioltransferase) {Escherichia | 96.97 | |
| d1a8ya2 | 102 | Calsequestrin {Rabbit (Oryctolagus cuniculus) [Tax | 96.94 | |
| d1eeja1 | 156 | Disulfide bond isomerase, DsbC, C-terminal domain | 96.89 | |
| d1iloa_ | 77 | MTH985, a thioredoxin {Archaeon Methanobacterium t | 96.81 | |
| d1r7ha_ | 74 | Glutaredoxin-like NRDH-redoxin {Corynebacterium am | 96.73 | |
| d1h75a_ | 76 | Glutaredoxin-like NRDH-redoxin {Escherichia coli [ | 96.69 | |
| d1bjxa_ | 110 | Protein disulfide isomerase, PDI {Human (Homo sapi | 96.66 | |
| d1sena_ | 135 | Thioredoxin-like protein p19, TLP19 {Human (Homo s | 96.63 | |
| d2f8aa1 | 184 | Glutathione peroxidase {Human (Homo sapiens) [TaxI | 96.54 | |
| d1o73a_ | 144 | Tryparedoxin I {Trypanosoma brucei brucei [TaxId: | 96.47 | |
| d1i5ga_ | 144 | Tryparedoxin II {Crithidia fasciculata [TaxId: 565 | 96.45 | |
| d1t3ba1 | 150 | Disulfide bond isomerase, DsbC, C-terminal domain | 96.4 | |
| d1nm3a1 | 74 | C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus | 96.33 | |
| d2cx4a1 | 160 | Bacterioferritin comigratory protein {Archaeon Aer | 96.27 | |
| d1fova_ | 82 | Glutaredoxin (Grx, thioltransferase) {Escherichia | 96.25 | |
| d1v58a1 | 169 | Thiol:disulfide interchange protein DsbG, C-termin | 96.1 | |
| d1e2ya_ | 167 | Tryparedoxin peroxidase (thioredoxin peroxidase ho | 96.03 | |
| d1o8xa_ | 144 | Tryparedoxin I {Crithidia fasciculata [TaxId: 5656 | 95.94 | |
| d2zcta1 | 237 | Peroxiredoxin {Aeropyrum pernix [TaxId: 56636]} | 95.75 | |
| d1un2a_ | 195 | Disulfide-bond formation facilitator (DsbA) {Esche | 95.71 | |
| d2bmxa1 | 169 | Alkyl hydroperoxide reductase AhpC {Mycobacterium | 95.61 | |
| d2a4va1 | 156 | Peroxiredoxin dot5 {Baker's yeast (Saccharomyces c | 95.53 | |
| d1xvwa1 | 153 | Putative peroxiredoxin Rv2238c/MT2298 {Mycobacteri | 95.49 | |
| d1a8la1 | 119 | Protein disulfide isomerase, PDI {Archaeon Pyrococ | 95.44 | |
| d1ktea_ | 105 | Glutaredoxin (Grx, thioltransferase) {Pig (Sus scr | 95.43 | |
| d1we0a1 | 166 | Alkyl hydroperoxide reductase AhpC {Amphibacillus | 95.11 | |
| d1wp0a1 | 160 | Thioredoxin-like protein Sco1 (YpmQ), soluble doma | 94.97 | |
| d1z6na1 | 166 | Hypothetical protein PA1234 {Pseudomonas aeruginos | 94.96 | |
| d1jfua_ | 176 | Membrane-anchored thioredoxin-like protein TlpA, s | 94.87 | |
| d1qxha_ | 164 | Thiol peroxidase Tpx {Escherichia coli [TaxId: 562 | 94.8 | |
| d1zyea1 | 158 | Peroxiredoxin-3 (AOP-1, SP-22) {Cow (Bos taurus) [ | 94.61 | |
| d1hyua3 | 102 | Alkyl hydroperoxide reductase subunit F (AhpF), N- | 94.39 | |
| d1ttza_ | 75 | Hypothetical protein XCC2852 {Xanthomonas campestr | 94.29 | |
| d1uula_ | 194 | Tryparedoxin peroxidase (thioredoxin peroxidase ho | 94.11 | |
| d1zofa1 | 170 | Thioredoxin reductase TsaA {Helicobacter pylori [T | 94.03 | |
| d1xzoa1 | 172 | Thioredoxin-like protein Sco1 (YpmQ), soluble doma | 94.01 | |
| d1a8ya3 | 119 | Calsequestrin {Rabbit (Oryctolagus cuniculus) [Tax | 93.94 | |
| d2b5ea2 | 98 | Protein disulfide isomerase, PDI {Baker's yeast (S | 93.0 | |
| d1beda_ | 181 | Disulfide-bond formation facilitator (DsbA) {Vibri | 92.95 | |
| d1psqa_ | 163 | Probable thiol peroxidase PsaD {Streptococcus pneu | 92.89 | |
| d2h01a1 | 170 | Thioredoxin peroxidase 2 (thioredoxin peroxidase B | 92.51 | |
| d1q98a_ | 164 | Thiol peroxidase Tpx {Haemophilus influenzae [TaxI | 92.2 | |
| d1wika_ | 109 | Thioredoxin-like protein 2 {Mouse (Mus musculus) [ | 92.18 | |
| d1xvqa_ | 166 | Thiol peroxidase Tpx {Mycobacterium tuberculosis [ | 92.13 | |
| d1n8ja_ | 186 | Alkyl hydroperoxide reductase AhpC {Salmonella typ | 92.05 | |
| d1qmva_ | 197 | Thioredoxin peroxidase 2 (thioredoxin peroxidase B | 89.77 | |
| d2b7ka1 | 169 | Thioredoxin-like protein Sco1 (YpmQ), soluble doma | 88.4 | |
| d1prxa_ | 220 | 1-Cys peroxiredoxin {Human (Homo sapiens) [TaxId: | 88.22 | |
| d1t3ba1 | 150 | Disulfide bond isomerase, DsbC, C-terminal domain | 87.11 | |
| d2bmxa1 | 169 | Alkyl hydroperoxide reductase AhpC {Mycobacterium | 87.04 | |
| d1fvka_ | 188 | Disulfide-bond formation facilitator (DsbA) {Esche | 86.42 | |
| d1eeja1 | 156 | Disulfide bond isomerase, DsbC, C-terminal domain | 86.17 | |
| d2a4va1 | 156 | Peroxiredoxin dot5 {Baker's yeast (Saccharomyces c | 83.73 | |
| d1t1va_ | 93 | SH3BGRL3 {Mouse (Mus musculus) [TaxId: 10090]} | 82.14 | |
| d1abaa_ | 87 | Glutaredoxin (Grx, thioltransferase) {Bacteriophag | 81.53 |
| >d2b5ea1 c.47.1.2 (A:365-504) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Thioredoxin fold superfamily: Thioredoxin-like family: PDI-like domain: Protein disulfide isomerase, PDI species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.94 E-value=1.8e-27 Score=184.74 Aligned_cols=123 Identities=33% Similarity=0.599 Sum_probs=112.3
Q ss_pred cccCCCCCCCCCceEEEcCccccccccccCccEEEEEeCCCChhhHHHHHHHHHHHHHhcCC-CCEEEEEEeCCCCCCCC
Q 018164 219 LKSQPIPDNTNANVQIVVGKTFDDLVLNSHKDVLLEVYTPWCVTCETTSKQIEKLAKHFKGL-DNLVIAKIDASANEHPK 297 (360)
Q Consensus 219 ~~se~~p~~~~~~v~~l~~~~~~~~~~~~~~~~~v~f~~~~c~~c~~~~~~~~~la~~~~~~-~~~~~~~id~~~~~~~~ 297 (360)
++||++|+++++.|.+|+++||++.+.+.+++++|+||||||++|+.+.|.|+++|+.+++. ..+.++.+|++.+....
T Consensus 1 ~~Se~ip~~~~~~V~~l~~~nf~~~v~~~~k~vlV~F~a~wC~~C~~~~p~~~~la~~~~~~~~~v~~~~~d~~~~~~~~ 80 (140)
T d2b5ea1 1 VKSQEIFENQDSSVFQLVGKNHDEIVNDPKKDVLVLYYAPWCGHCKRLAPTYQELADTYANATSDVLIAKLDHTENDVRG 80 (140)
T ss_dssp CCCCCCCCCCSCSEEEECTTTHHHHHHCTTCCEEEEEECTTCHHHHHHHHHHHHHHHHHHHHCSSCEEEEEEGGGCCCSS
T ss_pred CCCCcCCccCCCCcEEecCcCHHHHHhcCCCCEEEEEEeccCcccchhHHHHHHHHHHHhccccceEEEeeeccchhccc
Confidence 48999999999999999999999999888899999999999999999999999999998643 26899999998887788
Q ss_pred CCCCCCcEEEEEeCCCccCceEecCCCCHHHHHHHHHHhcCCCC
Q 018164 298 LQVEEYPTLLFYPAGDKANPIKVSARSSSKNIAAFIKEQLKEKD 341 (360)
Q Consensus 298 ~~i~~~Pti~~~~~g~~~~~~~~~g~~~~~~l~~~i~~~~~~~~ 341 (360)
++|.++||+++|++|+...++.|.|.++.+.|.+||++++....
T Consensus 81 ~~v~~~Ptl~~f~~g~~~~~~~y~G~~t~~~l~~fi~~~~~~~~ 124 (140)
T d2b5ea1 81 VVIEGYPTIVLYPGGKKSESVVYQGSRSLDSLFDFIKENGHFDV 124 (140)
T ss_dssp CCCSSSSEEEEECCTTSCCCCBCCSCCCHHHHHHHHHHHCTTCC
T ss_pred cccccCCeEEEEECCEEcceeEeCCCCCHHHHHHHHHHcCCCCC
Confidence 99999999999999988878899999999999999999876543
|
| >d2b5ea4 c.47.1.2 (A:23-141) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2djja1 c.47.1.2 (A:6-121) Protein disulfide isomerase, PDI {Fungi (Humicola insolens) [TaxId: 34413]} | Back information, alignment and structure |
|---|
| >d1meka_ c.47.1.2 (A:) Protein disulfide isomerase, PDI {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1thxa_ c.47.1.1 (A:) Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} | Back information, alignment and structure |
|---|
| >d2trxa_ c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fb6a_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin M [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d1dbya_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1bjxa_ c.47.1.2 (A:) Protein disulfide isomerase, PDI {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nw2a_ c.47.1.1 (A:) Thioredoxin {Alicyclobacillus acidocaldarius, formerly Bacillus acidocaldarius [TaxId: 405212]} | Back information, alignment and structure |
|---|
| >d2djka1 c.47.1.2 (A:1-133) Protein disulfide isomerase, PDI {Fungi (Humicola insolens) [TaxId: 34413]} | Back information, alignment and structure |
|---|
| >d1a8ya1 c.47.1.3 (A:3-126) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1a8ya2 c.47.1.3 (A:127-228) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d2c0ga2 c.47.1.7 (A:1024-1145) Windbeutel, N-terminal domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1ep7a_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1f9ma_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin F [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d1gh2a_ c.47.1.1 (A:) Thioredoxin-like protein, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g7ea_ c.47.1.7 (A:) Endoplasmic reticulum protein ERP29, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1xfla_ c.47.1.1 (A:) Thioredoxin {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1xwaa_ c.47.1.1 (A:) Thioredoxin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2ifqa1 c.47.1.1 (A:1-105) Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ti3a_ c.47.1.1 (A:) Thioredoxin {European aspen (Populus tremula), thioredoxin H [TaxId: 113636]} | Back information, alignment and structure |
|---|
| >d1syra_ c.47.1.1 (A:) Thioredoxin {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1r26a_ c.47.1.1 (A:) Thioredoxin {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1qgva_ c.47.1.8 (A:) spliceosomal protein U5-15Kd {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fo5a_ c.47.1.1 (A:) MJ0307, thioredoxin/glutaredoxin-like protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1a8la2 c.47.1.2 (A:120-226) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2es7a1 c.47.1.20 (A:7-125) Hydrogenase-1 operon protein HyaE {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1nhoa_ c.47.1.1 (A:) MTH807, thioredoxin/glutaredoxin-like protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d2hfda1 c.47.1.20 (A:1-132) Hydrogenase-1 operon protein HyaE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2b5ea3 c.47.1.2 (A:240-364) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1zmaa1 c.47.1.1 (A:1-115) Bacterocin transport accessory protein Bta {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2b5ea4 c.47.1.2 (A:23-141) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1thxa_ c.47.1.1 (A:) Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} | Back information, alignment and structure |
|---|
| >d1nw2a_ c.47.1.1 (A:) Thioredoxin {Alicyclobacillus acidocaldarius, formerly Bacillus acidocaldarius [TaxId: 405212]} | Back information, alignment and structure |
|---|
| >d1fb6a_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin M [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d1woua_ c.47.1.16 (A:) Putative 42-9-9 protein (thioredoxin containing protein Txnl5) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fwha1 c.47.1.1 (A:428-544) Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1dbya_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1hyua4 c.47.1.2 (A:103-198) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2trxa_ c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1meka_ c.47.1.2 (A:) Protein disulfide isomerase, PDI {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a8ya1 c.47.1.3 (A:3-126) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d2trcp_ c.47.1.6 (P:) Phosducin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2b5ea1 c.47.1.2 (A:365-504) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2djja1 c.47.1.2 (A:6-121) Protein disulfide isomerase, PDI {Fungi (Humicola insolens) [TaxId: 34413]} | Back information, alignment and structure |
|---|
| >d2c0ga2 c.47.1.7 (A:1024-1145) Windbeutel, N-terminal domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1ep7a_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1r26a_ c.47.1.1 (A:) Thioredoxin {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1f9ma_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin F [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d1xfla_ c.47.1.1 (A:) Thioredoxin {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1syra_ c.47.1.1 (A:) Thioredoxin {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1gh2a_ c.47.1.1 (A:) Thioredoxin-like protein, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a8la2 c.47.1.2 (A:120-226) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1g7ea_ c.47.1.7 (A:) Endoplasmic reticulum protein ERP29, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2ifqa1 c.47.1.1 (A:1-105) Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xwaa_ c.47.1.1 (A:) Thioredoxin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1ti3a_ c.47.1.1 (A:) Thioredoxin {European aspen (Populus tremula), thioredoxin H [TaxId: 113636]} | Back information, alignment and structure |
|---|
| >d1nhoa_ c.47.1.1 (A:) MTH807, thioredoxin/glutaredoxin-like protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1zzoa1 c.47.1.10 (A:45-178) Lipoprotein DsbF {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1z5ye1 c.47.1.10 (E:49-184) Thioredoxin-like protein CcmG (CycY, DsbE) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fo5a_ c.47.1.1 (A:) MJ0307, thioredoxin/glutaredoxin-like protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1sena_ c.47.1.1 (A:) Thioredoxin-like protein p19, TLP19 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fy6a1 c.47.1.10 (A:33-175) Peptide methionine sulfoxide reductase MsrA/MsrB, N-terminal domain {Neisseria meningitidis serogroup A [TaxId: 65699]} | Back information, alignment and structure |
|---|
| >d2es7a1 c.47.1.20 (A:7-125) Hydrogenase-1 operon protein HyaE {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1zmaa1 c.47.1.1 (A:1-115) Bacterocin transport accessory protein Bta {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2hfda1 c.47.1.20 (A:1-132) Hydrogenase-1 operon protein HyaE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qgva_ c.47.1.8 (A:) spliceosomal protein U5-15Kd {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b5xa1 c.47.1.10 (A:1-143) thiol:disulfide oxidoreductase YkuV {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1lu4a_ c.47.1.10 (A:) Soluble secreted antigen MPT53 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1knga_ c.47.1.10 (A:) Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyrhizobium japonicum [TaxId: 375]} | Back information, alignment and structure |
|---|
| >d2dlxa1 c.47.1.24 (A:1-147) UBX domain-containing protein 7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1st9a_ c.47.1.10 (A:) Thiol-disulfide oxidoreductase ResA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1i5ga_ c.47.1.10 (A:) Tryparedoxin II {Crithidia fasciculata [TaxId: 5656]} | Back information, alignment and structure |
|---|
| >d1wjka_ c.47.1.1 (A:) Thioredoxin-like structure containing protein C330018D20Rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1hyua4 c.47.1.2 (A:103-198) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1o73a_ c.47.1.10 (A:) Tryparedoxin I {Trypanosoma brucei brucei [TaxId: 5702]} | Back information, alignment and structure |
|---|
| >d1woua_ c.47.1.16 (A:) Putative 42-9-9 protein (thioredoxin containing protein Txnl5) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jfua_ c.47.1.10 (A:) Membrane-anchored thioredoxin-like protein TlpA, soluble domain {Bradyrhizobium japonicum [TaxId: 375]} | Back information, alignment and structure |
|---|
| >d2cvba1 c.47.1.10 (A:2-188) Probable thiol-disulfide isomerase/thioredoxin TTHA0593 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1o8xa_ c.47.1.10 (A:) Tryparedoxin I {Crithidia fasciculata [TaxId: 5656]} | Back information, alignment and structure |
|---|
| >d2fwha1 c.47.1.1 (A:428-544) Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1z6na1 c.47.1.1 (A:1-166) Hypothetical protein PA1234 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2trcp_ c.47.1.6 (P:) Phosducin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2djka1 c.47.1.2 (A:1-133) Protein disulfide isomerase, PDI {Fungi (Humicola insolens) [TaxId: 34413]} | Back information, alignment and structure |
|---|
| >d2b5ea2 c.47.1.2 (A:142-239) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2dlxa1 c.47.1.24 (A:1-147) UBX domain-containing protein 7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fy6a1 c.47.1.10 (A:33-175) Peptide methionine sulfoxide reductase MsrA/MsrB, N-terminal domain {Neisseria meningitidis serogroup A [TaxId: 65699]} | Back information, alignment and structure |
|---|
| >d2b5xa1 c.47.1.10 (A:1-143) thiol:disulfide oxidoreductase YkuV {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1zzoa1 c.47.1.10 (A:45-178) Lipoprotein DsbF {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1lu4a_ c.47.1.10 (A:) Soluble secreted antigen MPT53 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1st9a_ c.47.1.10 (A:) Thiol-disulfide oxidoreductase ResA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1a8la1 c.47.1.2 (A:1-119) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1knga_ c.47.1.10 (A:) Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyrhizobium japonicum [TaxId: 375]} | Back information, alignment and structure |
|---|
| >d2b5ea3 c.47.1.2 (A:240-364) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1z5ye1 c.47.1.10 (E:49-184) Thioredoxin-like protein CcmG (CycY, DsbE) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1a8ya3 c.47.1.3 (A:229-347) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d2cvba1 c.47.1.10 (A:2-188) Probable thiol-disulfide isomerase/thioredoxin TTHA0593 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1wjka_ c.47.1.1 (A:) Thioredoxin-like structure containing protein C330018D20Rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1z6ma1 c.47.1.13 (A:1-172) Hypothetical protein EF0770 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1egoa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1a8ya2 c.47.1.3 (A:127-228) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1eeja1 c.47.1.9 (A:61-216) Disulfide bond isomerase, DsbC, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1iloa_ c.47.1.1 (A:) MTH985, a thioredoxin {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1r7ha_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Corynebacterium ammoniagenes [TaxId: 1697]} | Back information, alignment and structure |
|---|
| >d1h75a_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1bjxa_ c.47.1.2 (A:) Protein disulfide isomerase, PDI {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sena_ c.47.1.1 (A:) Thioredoxin-like protein p19, TLP19 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f8aa1 c.47.1.10 (A:12-195) Glutathione peroxidase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1o73a_ c.47.1.10 (A:) Tryparedoxin I {Trypanosoma brucei brucei [TaxId: 5702]} | Back information, alignment and structure |
|---|
| >d1i5ga_ c.47.1.10 (A:) Tryparedoxin II {Crithidia fasciculata [TaxId: 5656]} | Back information, alignment and structure |
|---|
| >d1t3ba1 c.47.1.9 (A:61-210) Disulfide bond isomerase, DsbC, C-terminal domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1nm3a1 c.47.1.1 (A:166-239) C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2cx4a1 c.47.1.10 (A:4-163) Bacterioferritin comigratory protein {Archaeon Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1fova_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli, Grx3 [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1v58a1 c.47.1.9 (A:62-230) Thiol:disulfide interchange protein DsbG, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e2ya_ c.47.1.10 (A:) Tryparedoxin peroxidase (thioredoxin peroxidase homologue) {Crithidia fasciculata [TaxId: 5656]} | Back information, alignment and structure |
|---|
| >d1o8xa_ c.47.1.10 (A:) Tryparedoxin I {Crithidia fasciculata [TaxId: 5656]} | Back information, alignment and structure |
|---|
| >d2zcta1 c.47.1.10 (A:6-242) Peroxiredoxin {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1un2a_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bmxa1 c.47.1.10 (A:2-170) Alkyl hydroperoxide reductase AhpC {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2a4va1 c.47.1.10 (A:59-214) Peroxiredoxin dot5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1xvwa1 c.47.1.10 (A:1-153) Putative peroxiredoxin Rv2238c/MT2298 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1a8la1 c.47.1.2 (A:1-119) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1ktea_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1we0a1 c.47.1.10 (A:1-166) Alkyl hydroperoxide reductase AhpC {Amphibacillus xylanus [TaxId: 1449]} | Back information, alignment and structure |
|---|
| >d1wp0a1 c.47.1.10 (A:138-297) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z6na1 c.47.1.1 (A:1-166) Hypothetical protein PA1234 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1jfua_ c.47.1.10 (A:) Membrane-anchored thioredoxin-like protein TlpA, soluble domain {Bradyrhizobium japonicum [TaxId: 375]} | Back information, alignment and structure |
|---|
| >d1qxha_ c.47.1.10 (A:) Thiol peroxidase Tpx {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zyea1 c.47.1.10 (A:6-163) Peroxiredoxin-3 (AOP-1, SP-22) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1hyua3 c.47.1.2 (A:1-102) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1ttza_ c.47.1.1 (A:) Hypothetical protein XCC2852 {Xanthomonas campestris [TaxId: 339]} | Back information, alignment and structure |
|---|
| >d1uula_ c.47.1.10 (A:) Tryparedoxin peroxidase (thioredoxin peroxidase homologue) {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1zofa1 c.47.1.10 (A:1-170) Thioredoxin reductase TsaA {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1xzoa1 c.47.1.10 (A:3-174) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1a8ya3 c.47.1.3 (A:229-347) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d2b5ea2 c.47.1.2 (A:142-239) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1beda_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1psqa_ c.47.1.10 (A:) Probable thiol peroxidase PsaD {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2h01a1 c.47.1.10 (A:2-171) Thioredoxin peroxidase 2 (thioredoxin peroxidase B, 2-cys peroxiredoxin) {Plasmodium yoelii [TaxId: 5861]} | Back information, alignment and structure |
|---|
| >d1q98a_ c.47.1.10 (A:) Thiol peroxidase Tpx {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1wika_ c.47.1.1 (A:) Thioredoxin-like protein 2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1xvqa_ c.47.1.10 (A:) Thiol peroxidase Tpx {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1n8ja_ c.47.1.10 (A:) Alkyl hydroperoxide reductase AhpC {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1qmva_ c.47.1.10 (A:) Thioredoxin peroxidase 2 (thioredoxin peroxidase B, 2-cys peroxiredoxin) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b7ka1 c.47.1.10 (A:111-279) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Baker's yeast(Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1prxa_ c.47.1.10 (A:) 1-Cys peroxiredoxin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t3ba1 c.47.1.9 (A:61-210) Disulfide bond isomerase, DsbC, C-terminal domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2bmxa1 c.47.1.10 (A:2-170) Alkyl hydroperoxide reductase AhpC {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1fvka_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1eeja1 c.47.1.9 (A:61-216) Disulfide bond isomerase, DsbC, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2a4va1 c.47.1.10 (A:59-214) Peroxiredoxin dot5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1t1va_ c.47.1.14 (A:) SH3BGRL3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1abaa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|