Citrus Sinensis ID: 018194


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------36
MDSLALFCTGALLAGGLYWFVCVLGPAEQKGKRAVNLSGGSISAEEVEDNYKEYWKFFKRPKETTKEKVPDFVDTFYNLVTDIYEWGWGQSFHFSPSIPGKSHRDATRLHEEMAVDLIDVKAGDRILDVGCGVGGPMRAIAAHSRANVVGITINEYQVNRARLHNKKAGLDSLCEVVCGNFLKMPFEDNHFDGAYSIEATCHAPKLEDVYAEVFRVLKPGSLYVSYEWVTTDKYEAENKEHVDIIQGIERGDALPGLRSYAEITEIAKRVGFEVVKEKDLAKPPAQPWWTRLKMGRFAYWRNHILVTILAALGIAPKGTVGVHDMLFKTADYLTRGGETGIFTPMHMVLLRKPHPPKSS
cccccccHHHHHHHccHHHHHHHHcHHHHcccHHHHcccccccHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHccccccCCccccccccHHHHHHHHHHHHHHHcccccccEEEEEccccccHHHHHHHHcccEEEEEcccHHHHHHHHHHHHHccccccEEEEEccccccccccccccEEEEEHHccccccHHHHHHHHHHccccccEEEEEEEEcccccccccHHHHHHHHHHcccccccccccHHHHHHHHHHcccEEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHccccccccEEEEEECccccccc
***LALFCTGALLAGGLYWFVCVLGPAEQ****************EVEDNYKEYWKFFKRPKETTKEKVPDFVDTFYNLVTDIYEWGWGQSFHFSPSIPGKSHRDATRLHEEMAVDLIDVKAGDRILDVGCGVGGPMRAIAAHSRANVVGITINEYQVNRARLHNKKAGLDSLCEVVCGNFLKMPFEDNHFDGAYSIEATCHAPKLEDVYAEVFRVLKPGSLYVSYEWVTTDKYEAENKEHVDIIQGIERGDALPGLRSYAEITEIAKRVGFEVVKEKDLAKPPAQPWWTRLKMGRFAYWRNHILVTILAALGIAPKGTVGVHDMLFKTADYLTRGGETGIFTPMHMVLL**PH*****
xxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDSLALFCTGALLAGGLYWFVCVLGPAEQKGKRAVNLSGGSISAEEVEDNYKEYWKFFKRPKETTKEKVPDFVDTFYNLVTDIYEWGWGQSFHFSPSIPGKSHRDATRLHEEMAVDLIDVKAGDRILDVGCGVGGPMRAIAAHSRANVVGITINEYQVNRARLHNKKAGLDSLCEVVCGNFLKMPFEDNHFDGAYSIEATCHAPKLEDVYAEVFRVLKPGSLYVSYEWVTTDKYEAENKEHVDIIQGIERGDALPGLRSYAEITEIAKRVGFEVVKEKDLAKPPAQPWWTRLKMGRFAYWRNHILVTILAALGIAPKGTVGVHDMLFKTADYLTRGGETGIFTPMHMVLLRKPHPPKSS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
24-methylenesterol C-methyltransferase 2 Catalyzes the methyl transfer from S-adenosyl-methionine to the methylene group of 24-methylene lophenol to form 24-ethylidene lophenol.confidentO82427
24-methylenesterol C-methyltransferase 2 Catalyzes the methyl transfer from S-adenosyl-methionine to the methylene group of 24-methylene lophenol to form 24-ethylidene lophenol.confidentQ39227
Sterol 24-C-methyltransferase Catalyzes the methyl transfer from S-adenosyl-methionine to the C-24 of zymosterol to form fecosterol.probableQ6BRB7

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3BUS, chain A
Confidence level:very confident
Coverage over the Query: 87-281
View the alignment between query and template
View the model in PyMOL
Template: 3MGG, chain A
Confidence level:very confident
Coverage over the Query: 108-351
View the alignment between query and template
View the model in PyMOL
Template: 3VC1, chain A
Confidence level:very confident
Coverage over the Query: 44-281
View the alignment between query and template
View the model in PyMOL