Citrus Sinensis ID: 018221


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------36
MEAKATVIGSSLVEPSILDLANNQPLTTVPPRFVRLEIDHPLIRNDDTSTQQLPVIDMHRLLSGDDSELEKLDNTCKEWGFFQLINHGVSSSLVEKVKAEIQDFFNLPIDEKKKFWQQPGDSEGFGQHFIASEEQKLDWGYGFTMVTLPTHLRKPHLFPKLPLPFRDDLEVYSTEIKNLTLKILDQMAKALRMDPNDMEELFENGMQAFRMNYYPPCLQPEKVVGHNSHCDASALTVLLQINEMDGLQIKKDGKWVAVKPLPDAFVVNIGDVLEILTNGTYPSIEHRATVNSVKERLSLATFYSPKLDGELGPATSLIAPKTPALFKRISVVDHLKIFFSSELRGKSFVDFLRIQNQGS
ccccccccccccccHHHHHHHHccccccccccccccccccccccccccccccccEEEccccccccHHHHHHHHHHHHHccEEEEEcccccHHHHHHHHHHHHHHHcccHHHHHHHccccccccccccccccccccccccEEEEEEEccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHcccccEEEEEccccccccccccccccccccccEEEEEEccccccEEEEEccEEEEcccccccEEEEEccEEEEECcccccccccEEECcccccEEEEEEEEcccccccECccccccccccccccccccHHHHHHHHHHccccccccccHHccccccc
************VEPSILDLANNQPLTTVPPRFVRLEIDHPLIRND**STQQLPVIDMHRLLSGDDSELEKLDNTCKEWGFFQLINHGVSSSLVEKVKAEIQDFFNLPIDEKKKFWQQPGDSEGFGQHFIASEEQKLDWGYGFTMVTLPTHLRKPHLFPKLPLPFRDDLEVYSTEIKNLTLKILDQMAKALRMDPNDMEELFENGMQAFRMNYYPPCLQPEKVVGHNSHCDASALTVLLQINEMDGLQIKKDGKWVAVKPLPDAFVVNIGDVLEILTNGTYPSIEHRATVNSVKERLSLATFYSPKLDGELGPATSLIAPKTPALFKRISVVDHLKIFFSSELRGKSFVDFLRI*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEAKATVIGSSLVEPSILDLANNQPLTTVPPRFVRLEIDHPLIRNDDTSTQQLPVIDMHRLLSGDDSELEKLDNTCKEWGFFQLINHGVSSSLVEKVKAEIQDFFNLPIDEKKKFWQQPGDSEGFGQHFIASEEQKLDWGYGFTMVTLPTHLRKPHLFPKLPLPFRDDLEVYSTEIKNLTLKILDQMAKALRMDPNDMEELFENGMQAFRMNYYPPCLQPEKVVGHNSHCDASALTVLLQINEMDGLQIKKDGKWVAVKPLPDAFVVNIGDVLEILTNGTYPSIEHRATVNSVKERLSLATFYSPKLDGELGPATSLIAPKTPALFKRISVVDHLKIFFSSELRGKSFVDFLRIQNQGS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein SRG1 probableQ39224
Codeine O-demethylase Non-heme dioxygenase catalyzing the conversion of codeine to morphine. Catalyzes also, with lower efficiency, the 3-O-demethylation of thebaine to oripavine and of (S)-scoulerine to 3-O-demethylscoulerine. No activity with (S)-reticuline, salutaridine, papaverine, (S)-corytuberine, oripavine, pavine or noscapine.probableD4N502
Thebaine 6-O-demethylase Non-heme dioxygenase catalyzing the conversion of thebaine to neopinione. Catalyzes also, with lower efficiency, the 6-O-demethylation of oripavine to morphinone. No activity with (S)-reticuline, salutaridine, papaverine, (S)-corytuberine, (S)-scoulerine, pavine, noscapine or codeine.probableD4N500

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.14.-.-Acting on paired donors, with incorporation or reduction of molecular oxygen.probable
1.14.11.-With 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1W9Y, chain A
Confidence level:very confident
Coverage over the Query: 52-351
View the alignment between query and template
View the model in PyMOL
Template: 1GP6, chain A
Confidence level:very confident
Coverage over the Query: 13-347
View the alignment between query and template
View the model in PyMOL