Citrus Sinensis ID: 018223


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------36
MPPKQQSKAELAKKQKIVEDKTFGLKNKNKSKNVQKYVQNLKQNVQPKPDQSKVAAKKKKEEEKAKEKELNDLFKIAVSQPKVPVGVDPKSILCEFYKAGQCQKGFKCKFSHDLNVQRKGEKIDIYSDKRDKETMEDWDQETLEKVVESKNKEYQQNKPTDIVCKYFLEAVEKKQYGWFWVCPNGGKDCHYRHALPPGYVLKSQMKALLEEEAEKITIEEEIENQRAKITTTTPMTPELFTEWKKKKIAERDAGLAAERAERAKNDRMSGRELFLSDSSWFVDDAEAYDKYQREEESHVTEQKANGNSARDGPSNSAKAGQEDEVVPDDDDELDMDELNELEASLAKTSIQIQDPSNGS
cccccccHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHccccccccccccccccccccHHccccccccccccccHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHccccccEEccccccccccccccccccccccHHHHHHHHHHHHccHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEECccccccccHHHHHHHHHHHcccHHHHHccccccccccccccccccccccccccccccccHHHHHHHHccccccEEcccccccc
************************************************************************LFKIAVSQPKVPVGVDPKSILCEFYKAGQCQKGFKCKFSHDLNVQRKGE**DIYS*KRD****************************TDIVCKYFLEAVEKKQYGWFWVCPNGGKDCHYRHALPPGYVLKSQMKALL*****************A**TTTTPMTPELFTEW****************************ELFLSDSSWFVDDAEAYDK**************************************DDDELDMDELNELEASLAKT***********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPPKQQSKAELAKKQKIVEDKTFGLKNKNKSKNVQKYVQNLKQNVQPKPDQSxxxxxxxxxxxxxxxxxxxxxFKIAVSQPKVPVGVDPKSILCEFYKAGQCQKGFKCKFSHDLNVQRKGEKIDIYSDKRDKETMEDWDQETLEKVVESKNKEYQQNKPTDIVCKYFLEAVEKKQYGWFWVCPNGGKDCHYRHALPPGYVLKSQMKAxxxxxxxxxxxxxxxxxxxxxITTTTPMTPELFTEWKKKKIAERDAGLAAERAERAKNDRMSGRELFLSDSSWFVDDAEAYDKYQREEESHVTEQKANGNSARDGPSNSAKAGQEDEVVPDDDDELDMDELNELEASLAKTSIQIQDPSNGS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Zinc finger CCCH domain-containing protein 21 confidentQ9SK74
Translation machinery-associated protein 46 probableQ12000
Zinc finger CCCH domain-containing protein 11 probableQ0JHZ2

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2RHK, chain C
Confidence level:confident
Coverage over the Query: 84-116,159-197
View the alignment between query and template
View the model in PyMOL
Template: 4A9A, chain C
Confidence level:confident
Coverage over the Query: 211-277
View the alignment between query and template
View the model in PyMOL
Template: 3U9G, chain A
Confidence level:probable
Coverage over the Query: 92-169,180-197
View the alignment between query and template
View the model in PyMOL