Citrus Sinensis ID: 018266

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------36

MARDNDQSKFIDSSDFLTVLASEGVEFLLSRQGKVPLSSCGGKTICLFFSANWCRPCKTFTPQLVQLYDTLRTRGTELEVIFISFDHDENGFEEHFKSSDGTLIEEDLIGLIEDYGADAYPFTRKRREELKAIDDSKRQGGKLEQLLAIEGRDYVLSRDHRKITVSELAGKTIGLYFGAHWCPPCRSFTSQLIEVYNELKTTANHCFEVVLVSTDRDHKEFDLNHSIMPWLAIPYEDRARQDLCRIFNIKGIPALVLIGPDGKTISTNGKEMISLYGAKAFPFTESRIAEIETALKKEGDALPREVKDVKHEHELKLDMAKAYVCDCCKMRGRFWAFSCDVCNYDLHPKCVEGINLNL

cccccccccccccccHHHHcccccccEEEccccEEEcccccccEEEEEEECcccHHHHHHHHHHHHHHHHHccccccEEEEEEECccccccHHHHHHccccccccccHHHHHHccccccccccccccHHHHHccccccccccHHHHHHHccccccccccccccccccccccEEEEEEEccccHHHHHHHHHHHHHHHHHHHcccccEEEEEEEccccHHHHHHHHcccccEEECccccccHHHHHHcccccccEEEEEcccccEECccHHHHHHHcccccccccHHHHHHHHHHHHHHccccccCCcccccccHHHHcccccccccccccccccEEEEcccccccccccccccccccc

*************SDFLTVLASEGVEFLLSRQGKVPLSSCGGKTICLFFSANWCRPCKTFTPQLVQLYDTLRTRGTELEVIFISFDHDENGFEEHFKSSDGTLIEEDLIGLIEDYGADAYPFTRKRREELKAIDDSKRQGGKLEQLLAIEGRDYVLSRDHRKITVSELAGKTIGLYFGAHWCPPCRSFTSQLIEVYNELKTTANHCFEVVLVSTDRDHKEFDLNHSIMPWLAIPYEDRARQDLCRIFNIKGIPALVLIGPDGKTISTNGKEMISLYGAKAFPFTESRIAEIETAL********REVKDVKHEHELKLDMAKAYVCDCCKMRGRFWAFSCDVCNYDLHPKCVEGINL**

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Probable nucleoredoxin 3	Probable thiol-disulfide oxidoreductase that may participate in various redox reactions.	probable	Q8VZQ0

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3S9F, chain A
Confidence level:very confident
Coverage over the Query: 146-285
View the alignment between query and template
View the model in PyMOL

Template: 2LRN, chain A
Confidence level:very confident
Coverage over the Query: 24-122
View the alignment between query and template
View the model in PyMOL

Template: 1V5N, chain A
Confidence level:very confident
Coverage over the Query: 277-355
View the alignment between query and template
View the model in PyMOL

Template: 3APO, chain A
Confidence level:confident
Coverage over the Query: 41-89,110-217,241-301
View the alignment between query and template
View the model in PyMOL