Citrus Sinensis ID: 018279

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------36
MTASRQNCNAASLLFFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEMMDFGYPQYTEANILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGIQYKKNEVFLDVVEHVNILVNSNGQIIRSDVVGALKMRTYLSGMPECKLGLNDRILLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLNTQVKPLIWVEAQVERHSRSRVEILVKARSQFKERSTATNVEIELPVSSDASNPDVRTSMGSASYVPEDEALIWKIRSFPGGKEYMLRAEFTLPSITAEEATPERKAPIRVKFEIPYFTVSGIQVRYLKIIEKSGYHALPWVRYITMAGEYELRLI
cccccccccHHHHHHHHHHHHHHHHHHccccHHHHHcccHHHHHHHHHHHHHcccccccccccHHHHHccccccccccccccccEEEcccccccccEECccEEEEEEEEEEEEEEcccccEEEEEEEEEEEEEEEEccccCEEEECccHHHHHHcccccccccEEcccccccccccccccccccEEEECcccccEEEEEEEEcccccccEEEEEEEEEccccEEEEEEEEEEccccccCEEEEEEEccccccccccEEEEcccEEEECccccEEEEEEcccccccEEEEEEEECccccccccccccccccEEEEEEccEEECccEEEEEEEEEEcccccccccEEEEEEEccEEEEEc
**ASRQNCNAASLLFFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEMMDFGYPQYTEANILSEFIKTDAYR***TQRPPMAVTNAVSWRSEGIQYKKNEVFLDVVEHVNILVNSNGQIIRSDVVGALKMRTYLSGMPECKLGLNDRILLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLNTQVKPLIWVEAQVERHSRSRVEILVKARSQFKERSTATNVEIELPVSSDASNPDVRTSMGSASYVPEDEALIWKIRSFPGGKEYMLRAEFTLPSITA*******KAPIRVKFEIPYFTVSGIQVRYLKIIEKSGYHALPWVRYITMAGEYELRLI
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTASRQNCNAASLLFFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEMMDFGYPQYTEANILSEFIKTDAYRMEVTQRPPMAVTNAVSWRSEGIQYKKNEVFLDVVEHVNILVNSNGQIIRSDVVGALKMRTYLSGMPECKLGLNDRILLEAQGRSTKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLNTQVKPLIWVEAQVERHSRSRVEILVKARSQFKERSTATNVEIELPVSSDASNPDVRTSMGSASYVPEDEALIWKIRSFPGGKEYMLRAEFTLPSITAEEATPERKAPIRVKFEIPYFTVSGIQVRYLKIIEKSGYHALPWVRYITMAGEYELRLI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
AP-1 complex subunit mu-1 Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the trans-Golgi network (TGN) and endosomes. The AP complexes mediate the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo molecules.probableP35585
AP-1 complex subunit mu-1-I Required for many aspects of development and behavior, including negative regulation of vulval differentiation.probableP35602
AP-1 complex subunit mu Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the trans-Golgi network (TGN) and endosomes. The AP complexes mediate the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo molecules. Also involved in early steps of phagocytosis and macropinocytosis.probableQ54HS9

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1W63, chain M
Confidence level:very confident
Coverage over the Query: 1-78,89-150,165-295,308-358
View the alignment between query and template
View the model in PyMOL