Citrus Sinensis ID: 018283


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------36
MLSILIENMGLLCSKNRRYNAADSEENAQTAEIERRIEQETKAEKHIQKLLLLGAGESGKSTIFKQIKLLFQTGFDEAELKSYISVIHANVYQTIKVLYDGSKELAQNETDSMKFVVSSENKEIGEKLSEIGGRLDYPRLTKELAEDIETLWADPAIQDDVLYARVRTTGVVEIQFSPVGEHKKSGEVYRLFDVGGQRNERRKWIHLFEGVSAVIFCAAISEYDQTLFEDEQKNRMMETKELFDWVLKQPCFEKTSFMLFLNKFDIFEKKVLKVPLNVCEWFKDYQPVSTGKQEIENAYEFVKKKFEELYFQSTAPDRVDRVFKIYRTTALDPKLVKKTFKLVDETLRRRHLFEAGLL
cccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHccHHHHHHHHHHHHHccccccccccHHHHHHHHHHHcccccHHHHHHHccccccEEEEECcccccccccccEEEEEEEcccccccccEEcccccccEEEEEEEcccccccccccccccHHHHHHHHHHHHHcccccccccEEEEEccHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccccccccccEEEECccccccHHHHHHHHHHHHHHHHHHHHcccc
****LIENMGLLC*********************************IQKLLLLGAGESGKSTIFKQIKLLFQTGFDEAELKSYISVIHANVYQTIKVLYDGSKELAQNETDSMKFVVSSENKEIGEKLSEIGGRLDYPRLTKELAEDIETLWADPAIQDDVLYARVRTTGVVEIQFSPVGEHKKSGEVYRLFDVGGQRNERRKWIHLFEGVSAVIFCAAISEYDQTLFEDEQKNRMMETKELFDWVLKQPCFEKTSFMLFLNKFDIFEKKVLKVPLNVCEWFKDYQPVSTGKQEIENAYEFVKKKFEELYFQSTAPDRVDRVFKIYRTTALDPKLVKKTFKLVDETLRRRHLFEAGLL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLSILIENMGLLCSKNRRYNAADSEENAQTAEIERRIEQETKAEKHIQKLLLLGAGESGKSTIFKQIKLLFQTGFDEAELKSYISVIHANVYQTIKVLYDGSKELAQNETDSMKFVVSSENKEIGEKLSEIGGRLDYPRLTKELAEDIETLWADPAIQDDVLYARVRTTGVVEIQFSPVGEHKKSGEVYRLFDVGGQRNERRKWIHLFEGVSAVIFCAAISEYDQTLFEDEQKNRMMETKELFDWVLKQPCFEKTSFMLFLNKFDIFEKKVLKVPLNVCEWFKDYQPVSTGKQEIENAYEFVKKKFEELYFQSTAPDRVDRVFKIYRTTALDPKLVKKTFKLVDETLRRRHLFEAGLL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Guanine nucleotide-binding protein alpha-1 subunit Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems.confidentQ0DJ33
Guanine nucleotide-binding protein alpha-2 subunit Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems.confidentP93163
Guanine nucleotide-binding protein alpha-1 subunit Exhibits a fast rate of basal nucleotide exchange. Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. Together with GCR1, may regulate the cell cycle via a signaling cascade that uses phosphatidylinositol-specific phospholipase C (PI-PLC) as an effector and inositol 1,4,5-trisphosphate(IP(3)) as a second messenger. Promotes abscisic acid (ABA) responses in guard cells. But, together with GCR1 and GB1, acts as a negative regulator of ABA during seed germination and early seedling development. Involved in the blue light (BL) signaling. Together with GCR1 and ADT3, required for BL-mediated synthesis of phenylpyruvate and subsequently of phenylalanine (Phe), in etiolated seedlings.confidentP18064

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2XTZ, chain A
Confidence level:very confident
Coverage over the Query: 45-355
View the alignment between query and template
View the model in PyMOL
Template: 1AZS, chain C
Confidence level:very confident
Coverage over the Query: 43-357
View the alignment between query and template
View the model in PyMOL