Citrus Sinensis ID: 018300

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------36
MQACSGAAVMGSLQQPIWVKGPRLPSEGSVMVGFPNQIRLNMVKPCRCSSIEGSLVTGRPPSSVSVPIPEIGGDGSSFVDYSLGEADPEVCEIITKEKERQFKSLELIASENFTSRAVMEAVGSCLTNKYSEGLPGKRYYGGNEYIDELETLCQKRALAAFNLDENKWGVNVQPLSGSPANFEVYTAILKPHDRIMGLDLPHGGHLSHGFMTPKRRVSGTSIYFESMPYRLDESTGLVDYDMLEKTAILFRPKLIIAGASAYPRDFDYPRMRQIADAVGALLMMDMAHISGLVAASVVADPFKYCDVVTTTTHKSLRGPRGGMIFFKKDPVLGVELESAINNAVFPGLQVGFVSYVFL
ccccccHHHHcccccccccccccccccccccccccccHHccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccEEEcccccccHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHccccEEEcccccccccccccccccccccCEEEEEEEEEEcccccccccccHHHHHHHHHHHcccEEEEccccccccccHHHHHHHHHHHccEEEEHHHHHHHHHHccccccccccccEEEcccccccccccccEEEECccccccHHHHHHHHccccccccccccccccc
************LQQPIWVKGPRLPSEGSVMVGFPNQIRLNMVKPCRCSSIEGSLV********************SFVDYSLGEADPEVCEIITKEKERQFKSLELIASENFTSRAVMEAVGSCLTNKYSEGLPGKRYYGGNEYIDELETLCQKRALAAFNLDENKWGVNVQPLSGSPANFEVYTAILKPHDRIMGLDLPHGGHLSHGFMTPKRRVSGTSIYFESMPYRLDESTGLVDYDMLEKTAILFRPKLIIAGASAYPRDFDYPRMRQIADAVGALLMMDMAHISGLVAASVVADPFKYCDVVTTTTHKSLRGPRGGMIFFKKDPVLGVELESAINNAVFPGLQVGFVSYVFL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQACSGAAVMGSLQQPIWVKGPRLPSEGSVMVGFPNQIRLNMVKPCRCSSIEGSLVTGRPPSSVSVPIPEIGGDGSSFVDYSLGEADPEVCEIITKEKERQFKSLELIASENFTSRAVMEAVGSCLTNKYSEGLPGKRYYGGNEYIDELETLCQKRALAAFNLDENKWGVNVQPLSGSPANFEVYTAILKPHDRIMGLDLPHGGHLSHGFMTPKRRVSGTSIYFESMPYRLDESTGLVDYDMLEKTAILFRPKLIIAGASAYPRDFDYPRMRQIADAVGALLMMDMAHISGLVAASVVADPFKYCDVVTTTTHKSLRGPRGGMIFFKKDPVLGVELESAINNAVFPGLQVGFVSYVFL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Serine hydroxymethyltransferase Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.probableQ8R887
Serine hydroxymethyltransferase Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.probableQ5LD58
Serine hydroxymethyltransferase Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major source of one-carbon groups required for the biosynthesis of purines, thymidylate, methionine, and other important biomolecules. Also exhibits THF-independent aldolase activity toward beta-hydroxyamino acids, producing glycine and aldehydes, via a retro-aldol mechanism.probableB1I6M4

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.1.-.-Transferring one-carbon groups.probable
2.1.2.-Hydroxymethyl-, formyl- and related transferases.probable
2.1.2.1Glycine hydroxymethyltransferase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1RV3, chain A
Confidence level:very confident
Coverage over the Query: 76-357
View the alignment between query and template
View the model in PyMOL